--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:16:23 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/2res/folP2/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1169.33 -1173.54 2 -1169.34 -1172.48 -------------------------------------- TOTAL -1169.33 -1173.14 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.903352 0.093210 0.377258 1.533693 0.863336 1023.15 1118.35 1.000 r(A<->C){all} 0.149065 0.017457 0.000072 0.412475 0.107190 220.93 276.95 1.000 r(A<->G){all} 0.173909 0.021158 0.000008 0.465948 0.137857 196.02 213.51 1.000 r(A<->T){all} 0.171662 0.020280 0.000085 0.453853 0.136474 52.48 139.45 1.004 r(C<->G){all} 0.167944 0.019182 0.000048 0.442659 0.135621 125.73 145.76 1.010 r(C<->T){all} 0.167614 0.019015 0.000072 0.434899 0.132391 218.86 232.91 1.001 r(G<->T){all} 0.169806 0.020668 0.000129 0.474175 0.133175 193.80 195.64 1.000 pi(A){all} 0.163182 0.000163 0.139364 0.189014 0.162720 925.83 1213.42 1.000 pi(C){all} 0.284991 0.000232 0.256031 0.315173 0.285138 1269.99 1280.28 1.000 pi(G){all} 0.360312 0.000267 0.330397 0.393567 0.360416 1001.21 1170.72 1.000 pi(T){all} 0.191515 0.000180 0.165788 0.217443 0.191522 1294.94 1296.72 1.000 alpha{1,2} 0.423223 0.222206 0.000180 1.397468 0.258042 1141.36 1209.72 1.000 alpha{3} 0.453237 0.232402 0.000124 1.421469 0.293250 1186.38 1219.19 1.000 pinvar{all} 0.998271 0.000004 0.994455 0.999999 0.998913 1222.10 1345.46 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1128.38328 Model 2: PositiveSelection -1128.38328 Model 0: one-ratio -1128.383514 Model 7: beta -1128.38328 Model 8: beta&w>1 -1128.38328 Model 0 vs 1 4.6800000018265564E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0
>C1 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA >C2 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA >C3 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA >C4 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA >C5 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA >C6 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=291 C1 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE C2 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE C3 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE C4 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE C5 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE C6 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE ************************************************** C1 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA C2 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA C3 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA C4 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA C5 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA C6 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA ************************************************** C1 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP C2 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP C3 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP C4 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP C5 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP C6 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP ************************************************** C1 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF C2 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF C3 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF C4 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF C5 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF C6 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF ************************************************** C1 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL C2 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL C3 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL C4 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL C5 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL C6 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL ************************************************** C1 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA C2 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA C3 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA C4 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA C5 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA C6 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA ***************************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8730] Library Relaxation: Multi_proc [96] Relaxation Summary: [8730]--->[8730] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.494 Mb, Max= 30.841 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE C2 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE C3 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE C4 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE C5 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE C6 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE ************************************************** C1 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA C2 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA C3 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA C4 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA C5 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA C6 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA ************************************************** C1 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP C2 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP C3 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP C4 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP C5 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP C6 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP ************************************************** C1 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF C2 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF C3 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF C4 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF C5 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF C6 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF ************************************************** C1 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL C2 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL C3 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL C4 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL C5 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL C6 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL ************************************************** C1 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA C2 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA C3 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA C4 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA C5 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA C6 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA ***************************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT C2 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT C3 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT C4 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT C5 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT C6 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT ************************************************** C1 CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA C2 CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA C3 CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA C4 CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA C5 CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA C6 CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA ************************************************** C1 CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG C2 CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG C3 CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG C4 CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG C5 CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG C6 CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG ************************************************** C1 GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG C2 GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG C3 GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG C4 GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG C5 GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG C6 GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG ************************************************** C1 CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC C2 CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC C3 CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC C4 CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC C5 CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC C6 CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC ************************************************** C1 TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA C2 TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA C3 TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA C4 TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA C5 TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA C6 TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA ************************************************** C1 GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG C2 GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG C3 GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG C4 GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG C5 GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG C6 GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG ************************************************** C1 CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG C2 CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG C3 CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG C4 CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG C5 CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG C6 CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG ************************************************** C1 CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC C2 CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC C3 CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC C4 CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC C5 CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC C6 CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC ************************************************** C1 TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT C2 TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT C3 TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT C4 TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT C5 TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT C6 TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT ************************************************** C1 TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC C2 TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC C3 TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC C4 TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC C5 TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC C6 TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC ************************************************** C1 GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC C2 GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC C3 GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC C4 GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC C5 GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC C6 GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC ************************************************** C1 CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG C2 CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG C3 CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG C4 CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG C5 CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG C6 CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG ************************************************** C1 GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG C2 GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG C3 GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG C4 GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG C5 GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG C6 GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG ************************************************** C1 GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG C2 GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG C3 GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG C4 GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG C5 GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG C6 GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG ************************************************** C1 GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC C2 GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC C3 GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC C4 GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC C5 GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC C6 GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC ************************************************** C1 CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA C2 CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA C3 CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA C4 CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA C5 CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA C6 CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA ************************************************** C1 CGCGCACGGTGAGGGGACTCGCA C2 CGCGCACGGTGAGGGGACTCGCA C3 CGCGCACGGTGAGGGGACTCGCA C4 CGCGCACGGTGAGGGGACTCGCA C5 CGCGCACGGTGAGGGGACTCGCA C6 CGCGCACGGTGAGGGGACTCGCA *********************** >C1 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA CGCGCACGGTGAGGGGACTCGCA >C2 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA CGCGCACGGTGAGGGGACTCGCA >C3 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA CGCGCACGGTGAGGGGACTCGCA >C4 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA CGCGCACGGTGAGGGGACTCGCA >C5 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA CGCGCACGGTGAGGGGACTCGCA >C6 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA CGCGCACGGTGAGGGGACTCGCA >C1 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA >C2 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA >C3 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA >C4 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA >C5 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA >C6 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 873 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579788907 Setting output file names to "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 83703708 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0506668054 Seed = 404798614 Swapseed = 1579788907 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1953.815734 -- -24.965149 Chain 2 -- -1953.815847 -- -24.965149 Chain 3 -- -1953.815847 -- -24.965149 Chain 4 -- -1953.815550 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1953.815847 -- -24.965149 Chain 2 -- -1953.815734 -- -24.965149 Chain 3 -- -1953.815847 -- -24.965149 Chain 4 -- -1953.815734 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1953.816] (-1953.816) (-1953.816) (-1953.816) * [-1953.816] (-1953.816) (-1953.816) (-1953.816) 500 -- (-1202.148) (-1202.700) [-1176.301] (-1189.532) * [-1179.984] (-1201.190) (-1220.206) (-1195.121) -- 0:00:00 1000 -- (-1180.208) (-1195.451) (-1191.789) [-1181.238] * [-1173.693] (-1204.976) (-1179.942) (-1178.430) -- 0:00:00 1500 -- (-1173.130) (-1174.654) (-1175.763) [-1177.372] * (-1177.536) (-1198.578) [-1177.131] (-1180.081) -- 0:00:00 2000 -- (-1179.788) (-1178.982) (-1179.658) [-1175.822] * (-1182.820) (-1185.865) (-1181.486) [-1173.303] -- 0:00:00 2500 -- [-1177.220] (-1184.004) (-1185.576) (-1179.445) * [-1173.956] (-1183.462) (-1180.378) (-1174.399) -- 0:00:00 3000 -- [-1174.705] (-1177.783) (-1182.966) (-1180.716) * (-1186.809) [-1174.241] (-1178.239) (-1179.206) -- 0:00:00 3500 -- (-1183.527) [-1186.183] (-1182.058) (-1176.908) * (-1184.002) (-1179.613) (-1185.161) [-1179.877] -- 0:00:00 4000 -- [-1176.721] (-1177.424) (-1178.151) (-1178.353) * (-1183.005) [-1177.470] (-1180.689) (-1184.744) -- 0:00:00 4500 -- (-1179.267) (-1179.092) [-1175.456] (-1182.258) * [-1180.498] (-1178.331) (-1190.116) (-1177.948) -- 0:00:00 5000 -- [-1183.196] (-1175.910) (-1181.474) (-1178.705) * [-1181.622] (-1180.332) (-1179.373) (-1192.104) -- 0:00:00 Average standard deviation of split frequencies: 0.122975 5500 -- (-1172.399) (-1181.574) [-1179.203] (-1172.691) * (-1179.672) (-1177.702) (-1178.243) [-1178.042] -- 0:00:00 6000 -- [-1173.942] (-1190.969) (-1181.633) (-1174.896) * (-1178.343) [-1175.704] (-1174.319) (-1181.623) -- 0:00:00 6500 -- (-1183.727) (-1183.151) [-1178.532] (-1177.217) * (-1183.292) (-1178.483) (-1189.384) [-1173.246] -- 0:00:00 7000 -- [-1184.826] (-1177.751) (-1182.374) (-1180.989) * [-1175.676] (-1179.115) (-1179.368) (-1184.829) -- 0:00:00 7500 -- (-1178.574) (-1175.365) [-1177.777] (-1179.903) * [-1173.545] (-1181.677) (-1182.925) (-1179.615) -- 0:00:00 8000 -- (-1176.540) (-1183.847) [-1175.902] (-1178.046) * (-1179.269) [-1178.356] (-1181.698) (-1185.988) -- 0:00:00 8500 -- (-1176.457) (-1182.240) (-1180.374) [-1175.428] * [-1173.807] (-1181.921) (-1178.123) (-1172.892) -- 0:00:00 9000 -- (-1175.917) [-1176.204] (-1184.907) (-1177.901) * [-1179.328] (-1184.273) (-1186.985) (-1177.756) -- 0:00:00 9500 -- [-1177.800] (-1182.108) (-1177.256) (-1185.305) * (-1180.719) (-1183.790) (-1181.642) [-1180.833] -- 0:00:00 10000 -- (-1185.247) [-1181.085] (-1176.553) (-1182.589) * (-1179.794) (-1174.527) [-1184.543] (-1180.103) -- 0:00:00 Average standard deviation of split frequencies: 0.072920 10500 -- [-1175.903] (-1179.086) (-1179.116) (-1178.350) * (-1181.028) (-1184.807) (-1177.597) [-1182.113] -- 0:00:00 11000 -- [-1177.883] (-1179.170) (-1176.413) (-1183.027) * (-1184.100) (-1175.641) (-1181.807) [-1181.553] -- 0:01:29 11500 -- (-1182.205) (-1179.356) [-1177.186] (-1182.840) * (-1179.490) [-1173.626] (-1182.384) (-1174.860) -- 0:01:25 12000 -- (-1177.718) (-1188.704) (-1178.664) [-1177.389] * (-1178.990) [-1181.502] (-1177.220) (-1180.381) -- 0:01:22 12500 -- (-1184.604) (-1179.184) [-1174.029] (-1182.030) * (-1181.311) [-1175.862] (-1174.895) (-1184.611) -- 0:01:19 13000 -- (-1173.120) (-1176.759) [-1174.964] (-1177.360) * [-1175.701] (-1183.778) (-1178.452) (-1187.772) -- 0:01:15 13500 -- (-1172.209) (-1169.464) (-1176.893) [-1181.165] * (-1176.846) (-1181.232) [-1175.206] (-1182.152) -- 0:01:13 14000 -- (-1169.485) (-1172.843) (-1179.889) [-1179.442] * [-1173.811] (-1179.110) (-1189.913) (-1186.376) -- 0:01:10 14500 -- [-1170.699] (-1172.260) (-1186.185) (-1186.662) * [-1187.410] (-1178.754) (-1179.404) (-1178.540) -- 0:01:07 15000 -- [-1177.477] (-1172.233) (-1177.747) (-1176.108) * [-1176.644] (-1179.683) (-1178.927) (-1188.625) -- 0:01:05 Average standard deviation of split frequencies: 0.067764 15500 -- (-1171.977) [-1169.077] (-1179.001) (-1180.761) * (-1179.974) (-1176.128) [-1178.416] (-1182.281) -- 0:01:03 16000 -- (-1170.208) (-1169.508) (-1176.357) [-1176.759] * (-1177.550) (-1181.383) [-1180.701] (-1187.910) -- 0:01:01 16500 -- (-1170.046) (-1170.313) (-1187.509) [-1180.178] * [-1189.261] (-1177.390) (-1177.640) (-1179.118) -- 0:00:59 17000 -- (-1170.086) (-1168.564) (-1182.053) [-1176.546] * (-1179.241) (-1177.430) (-1186.015) [-1174.874] -- 0:00:57 17500 -- (-1172.360) (-1168.431) [-1182.227] (-1180.467) * (-1185.486) (-1179.060) (-1174.394) [-1171.155] -- 0:00:56 18000 -- [-1171.997] (-1170.870) (-1183.468) (-1180.046) * (-1183.387) [-1178.005] (-1176.772) (-1174.416) -- 0:00:54 18500 -- (-1173.383) (-1167.981) [-1174.934] (-1180.610) * (-1173.541) (-1175.127) (-1178.885) [-1175.097] -- 0:00:53 19000 -- [-1172.935] (-1171.510) (-1178.747) (-1176.303) * (-1177.005) (-1173.534) (-1177.862) [-1169.253] -- 0:00:51 19500 -- (-1168.701) (-1171.502) (-1188.051) [-1174.685] * (-1177.024) (-1182.241) (-1184.819) [-1169.212] -- 0:00:50 20000 -- (-1169.812) (-1168.286) (-1177.844) [-1173.183] * (-1184.893) (-1175.387) (-1180.884) [-1168.723] -- 0:00:49 Average standard deviation of split frequencies: 0.051841 20500 -- (-1169.763) (-1169.206) (-1182.117) [-1181.565] * (-1184.230) [-1179.279] (-1184.089) (-1170.764) -- 0:00:47 21000 -- (-1170.546) [-1168.985] (-1176.482) (-1179.280) * [-1183.323] (-1179.782) (-1176.631) (-1170.096) -- 0:00:46 21500 -- (-1168.946) [-1171.050] (-1177.897) (-1180.288) * (-1175.522) (-1187.838) (-1175.857) [-1169.057] -- 0:00:45 22000 -- (-1171.520) (-1171.350) (-1176.635) [-1181.810] * (-1179.645) (-1179.192) [-1174.086] (-1168.683) -- 0:00:44 22500 -- (-1170.474) [-1168.772] (-1177.432) (-1183.552) * (-1190.268) (-1182.854) (-1180.718) [-1170.618] -- 0:00:43 23000 -- (-1170.449) (-1169.852) (-1180.623) [-1178.108] * [-1178.216] (-1184.126) (-1182.075) (-1169.862) -- 0:00:42 23500 -- (-1170.185) [-1170.529] (-1186.194) (-1177.770) * (-1185.609) (-1179.362) [-1180.891] (-1169.485) -- 0:00:41 24000 -- (-1168.145) (-1168.645) (-1176.332) [-1174.294] * (-1180.602) (-1182.565) (-1182.106) [-1170.919] -- 0:00:40 24500 -- (-1170.976) (-1170.399) [-1180.082] (-1179.861) * [-1173.715] (-1180.467) (-1189.540) (-1170.404) -- 0:00:39 25000 -- (-1171.018) (-1171.258) [-1178.491] (-1174.975) * (-1170.310) (-1183.818) (-1185.814) [-1172.884] -- 0:00:39 Average standard deviation of split frequencies: 0.059338 25500 -- [-1170.158] (-1170.870) (-1180.421) (-1177.430) * (-1170.387) (-1183.767) (-1181.260) [-1172.314] -- 0:00:38 26000 -- (-1169.194) (-1170.297) [-1177.633] (-1172.583) * (-1169.902) (-1183.448) (-1188.682) [-1172.792] -- 0:01:14 26500 -- (-1168.725) (-1171.611) (-1176.674) [-1172.898] * (-1172.238) (-1175.043) [-1173.953] (-1171.504) -- 0:01:13 27000 -- (-1169.443) (-1170.812) [-1179.400] (-1177.926) * (-1169.826) (-1187.993) [-1175.416] (-1170.946) -- 0:01:12 27500 -- [-1168.256] (-1170.785) (-1180.251) (-1181.202) * (-1168.716) [-1180.876] (-1173.565) (-1169.638) -- 0:01:10 28000 -- [-1168.448] (-1169.152) (-1180.919) (-1178.561) * (-1170.958) [-1175.281] (-1178.783) (-1168.756) -- 0:01:09 28500 -- (-1169.157) [-1169.066] (-1177.737) (-1188.408) * (-1168.976) (-1177.691) (-1177.211) [-1169.973] -- 0:01:08 29000 -- (-1172.549) (-1168.860) (-1177.576) [-1179.468] * (-1169.553) (-1194.600) [-1178.630] (-1169.103) -- 0:01:06 29500 -- (-1168.485) [-1168.131] (-1175.564) (-1180.992) * (-1168.785) (-1183.587) [-1178.055] (-1169.723) -- 0:01:05 30000 -- (-1168.239) (-1168.646) [-1176.571] (-1184.159) * [-1168.872] (-1179.290) (-1182.153) (-1168.944) -- 0:01:04 Average standard deviation of split frequencies: 0.052264 30500 -- [-1169.780] (-1174.341) (-1176.847) (-1180.818) * (-1171.759) [-1179.252] (-1174.900) (-1169.062) -- 0:01:03 31000 -- (-1168.428) [-1171.310] (-1175.521) (-1181.839) * (-1168.522) (-1184.938) (-1177.145) [-1169.440] -- 0:01:02 31500 -- [-1168.753] (-1173.076) (-1185.474) (-1177.639) * (-1170.592) (-1174.086) (-1178.052) [-1169.810] -- 0:01:01 32000 -- [-1168.909] (-1169.644) (-1186.885) (-1176.643) * (-1169.856) [-1176.611] (-1183.755) (-1169.868) -- 0:01:00 32500 -- [-1169.609] (-1170.402) (-1183.606) (-1176.693) * (-1174.609) (-1176.627) [-1178.131] (-1172.279) -- 0:00:59 33000 -- [-1172.316] (-1170.132) (-1185.061) (-1183.979) * (-1170.104) (-1177.503) (-1180.063) [-1168.931] -- 0:00:58 33500 -- (-1172.341) (-1169.518) (-1180.214) [-1178.228] * [-1168.345] (-1184.567) (-1185.401) (-1169.247) -- 0:00:57 34000 -- (-1168.988) (-1171.312) (-1178.542) [-1183.372] * (-1169.352) (-1183.616) (-1182.106) [-1173.345] -- 0:00:56 34500 -- (-1169.110) (-1170.222) (-1183.011) [-1176.049] * (-1169.506) (-1183.142) [-1184.896] (-1169.256) -- 0:00:55 35000 -- (-1170.140) (-1169.586) [-1175.256] (-1174.480) * [-1167.975] (-1180.385) (-1175.541) (-1168.682) -- 0:00:55 Average standard deviation of split frequencies: 0.039284 35500 -- [-1169.805] (-1170.132) (-1171.963) (-1181.551) * [-1168.566] (-1182.239) (-1179.677) (-1169.410) -- 0:00:54 36000 -- (-1172.908) (-1171.841) (-1169.309) [-1180.325] * (-1169.250) [-1182.875] (-1180.752) (-1168.429) -- 0:00:53 36500 -- (-1173.691) (-1172.424) [-1169.903] (-1180.926) * (-1169.449) [-1179.031] (-1184.109) (-1170.287) -- 0:00:52 37000 -- [-1169.803] (-1168.767) (-1170.312) (-1181.050) * [-1171.964] (-1187.403) (-1177.393) (-1169.457) -- 0:00:52 37500 -- [-1170.632] (-1170.408) (-1170.733) (-1187.466) * [-1174.724] (-1177.194) (-1176.884) (-1170.067) -- 0:00:51 38000 -- (-1170.297) (-1170.305) [-1168.699] (-1180.232) * (-1170.370) (-1181.671) [-1174.533] (-1171.494) -- 0:00:50 38500 -- [-1169.788] (-1169.299) (-1171.112) (-1180.455) * (-1167.992) (-1178.028) (-1178.760) [-1168.933] -- 0:00:49 39000 -- [-1169.707] (-1169.269) (-1174.512) (-1183.556) * [-1170.036] (-1179.592) (-1176.960) (-1170.693) -- 0:00:49 39500 -- (-1174.487) (-1169.303) (-1173.449) [-1179.535] * (-1171.148) [-1182.005] (-1178.405) (-1169.401) -- 0:00:48 40000 -- (-1174.661) [-1168.564] (-1171.712) (-1180.318) * (-1169.660) [-1181.746] (-1182.071) (-1169.725) -- 0:00:48 Average standard deviation of split frequencies: 0.048024 40500 -- (-1169.272) (-1169.171) (-1172.463) [-1174.644] * (-1169.269) [-1181.143] (-1170.091) (-1169.472) -- 0:00:47 41000 -- (-1171.149) [-1169.279] (-1169.146) (-1179.534) * (-1168.419) (-1175.922) (-1170.496) [-1169.209] -- 0:00:46 41500 -- (-1171.595) (-1169.540) [-1169.695] (-1183.003) * [-1168.579] (-1177.798) (-1171.553) (-1170.432) -- 0:01:09 42000 -- (-1171.260) [-1171.677] (-1171.552) (-1176.024) * (-1170.936) (-1178.335) (-1173.175) [-1168.919] -- 0:01:08 42500 -- (-1171.783) [-1168.675] (-1170.066) (-1174.882) * [-1169.205] (-1185.036) (-1172.250) (-1169.895) -- 0:01:07 43000 -- (-1169.702) (-1170.141) [-1169.288] (-1178.919) * (-1168.473) (-1179.167) [-1168.236] (-1172.694) -- 0:01:06 43500 -- (-1171.300) (-1169.808) (-1168.387) [-1180.228] * (-1170.213) (-1179.765) [-1169.760] (-1171.999) -- 0:01:05 44000 -- (-1175.924) [-1170.074] (-1168.859) (-1181.603) * (-1170.861) (-1188.393) (-1170.401) [-1171.049] -- 0:01:05 44500 -- (-1172.277) (-1168.947) [-1169.006] (-1178.144) * [-1168.868] (-1181.237) (-1168.866) (-1169.001) -- 0:01:04 45000 -- [-1172.563] (-1174.537) (-1170.976) (-1178.037) * [-1171.090] (-1178.858) (-1170.764) (-1168.876) -- 0:01:03 Average standard deviation of split frequencies: 0.042456 45500 -- (-1169.787) (-1171.032) (-1172.366) [-1179.625] * [-1170.087] (-1176.692) (-1174.079) (-1168.747) -- 0:01:02 46000 -- (-1170.138) [-1168.500] (-1170.337) (-1179.630) * [-1170.959] (-1181.903) (-1170.986) (-1169.230) -- 0:01:02 46500 -- (-1170.214) (-1168.496) (-1168.581) [-1181.483] * (-1170.193) [-1174.482] (-1170.744) (-1169.393) -- 0:01:01 47000 -- (-1170.213) (-1168.420) [-1168.299] (-1181.397) * (-1171.631) [-1175.939] (-1173.423) (-1169.377) -- 0:01:00 47500 -- (-1168.753) (-1169.387) [-1169.212] (-1178.604) * (-1169.671) (-1181.064) (-1172.297) [-1171.056] -- 0:01:00 48000 -- (-1169.127) (-1170.437) [-1169.066] (-1182.191) * [-1170.583] (-1174.300) (-1170.381) (-1171.799) -- 0:00:59 48500 -- [-1169.713] (-1169.280) (-1170.310) (-1177.911) * [-1174.735] (-1182.099) (-1172.998) (-1170.915) -- 0:00:58 49000 -- [-1168.933] (-1168.004) (-1170.291) (-1182.315) * (-1176.380) [-1178.894] (-1172.775) (-1173.595) -- 0:00:58 49500 -- (-1171.061) (-1173.626) (-1170.285) [-1181.762] * (-1169.753) (-1180.693) [-1168.009] (-1171.631) -- 0:00:57 50000 -- (-1172.834) [-1169.970] (-1170.552) (-1184.305) * (-1168.947) (-1179.549) [-1169.393] (-1169.478) -- 0:00:57 Average standard deviation of split frequencies: 0.041868 50500 -- (-1168.327) (-1172.671) (-1168.388) [-1176.572] * [-1168.427] (-1185.985) (-1171.792) (-1172.520) -- 0:00:56 51000 -- (-1169.364) [-1178.029] (-1167.937) (-1185.402) * (-1169.136) (-1176.430) (-1172.040) [-1170.814] -- 0:00:55 51500 -- [-1169.842] (-1171.542) (-1169.309) (-1192.865) * (-1168.952) (-1183.712) (-1171.462) [-1173.073] -- 0:00:55 52000 -- (-1168.726) [-1170.273] (-1172.190) (-1177.372) * [-1169.280] (-1179.389) (-1169.908) (-1169.291) -- 0:00:54 52500 -- (-1168.570) (-1170.440) [-1168.344] (-1176.673) * [-1169.219] (-1182.336) (-1167.801) (-1170.361) -- 0:00:54 53000 -- (-1170.365) (-1170.937) [-1169.163] (-1181.651) * (-1168.622) (-1178.704) (-1170.997) [-1168.746] -- 0:00:53 53500 -- (-1171.325) (-1172.190) (-1169.939) [-1178.250] * [-1169.720] (-1175.029) (-1168.917) (-1168.784) -- 0:00:53 54000 -- (-1171.626) [-1169.191] (-1170.384) (-1186.719) * [-1168.999] (-1183.070) (-1171.102) (-1173.271) -- 0:00:52 54500 -- (-1171.864) [-1170.525] (-1168.058) (-1182.290) * (-1170.951) [-1175.965] (-1171.230) (-1169.759) -- 0:00:52 55000 -- [-1171.103] (-1170.772) (-1174.025) (-1181.503) * [-1169.125] (-1179.145) (-1170.029) (-1169.246) -- 0:00:51 Average standard deviation of split frequencies: 0.038988 55500 -- (-1168.543) (-1169.433) (-1171.840) [-1178.581] * [-1169.884] (-1186.007) (-1171.064) (-1170.593) -- 0:00:51 56000 -- (-1169.489) (-1168.729) (-1171.703) [-1173.538] * (-1169.937) (-1185.968) [-1170.557] (-1171.054) -- 0:01:07 56500 -- (-1172.193) (-1171.370) [-1168.623] (-1173.905) * (-1168.668) (-1188.871) (-1171.182) [-1168.417] -- 0:01:06 57000 -- (-1174.325) (-1169.732) (-1171.656) [-1176.787] * (-1168.131) (-1181.394) [-1173.731] (-1169.679) -- 0:01:06 57500 -- (-1171.600) (-1169.602) [-1174.741] (-1183.674) * [-1168.152] (-1186.065) (-1173.552) (-1171.364) -- 0:01:05 58000 -- [-1171.870] (-1169.502) (-1169.878) (-1184.777) * [-1169.676] (-1177.105) (-1171.756) (-1171.487) -- 0:01:04 58500 -- (-1169.015) [-1167.980] (-1170.748) (-1181.210) * (-1168.936) (-1179.465) (-1168.271) [-1171.091] -- 0:01:04 59000 -- (-1169.050) (-1169.239) (-1172.414) [-1175.780] * (-1170.660) (-1192.263) (-1169.610) [-1169.348] -- 0:01:03 59500 -- (-1170.087) (-1172.303) (-1171.726) [-1175.820] * (-1169.213) [-1168.702] (-1170.809) (-1168.945) -- 0:01:03 60000 -- (-1168.888) [-1170.585] (-1170.139) (-1175.136) * (-1168.937) (-1173.737) [-1171.978] (-1171.148) -- 0:01:02 Average standard deviation of split frequencies: 0.036567 60500 -- (-1170.220) (-1171.483) (-1172.640) [-1174.026] * (-1168.567) [-1171.094] (-1171.937) (-1172.082) -- 0:01:02 61000 -- [-1168.808] (-1169.099) (-1175.313) (-1185.080) * (-1168.596) (-1170.148) (-1171.426) [-1170.410] -- 0:01:01 61500 -- [-1168.335] (-1170.028) (-1170.992) (-1178.624) * [-1168.659] (-1171.356) (-1169.168) (-1172.009) -- 0:01:01 62000 -- (-1170.235) [-1170.179] (-1170.881) (-1180.011) * (-1168.561) (-1171.149) [-1171.582] (-1172.678) -- 0:01:00 62500 -- (-1172.144) (-1169.515) [-1170.490] (-1179.577) * (-1169.025) (-1169.137) [-1170.706] (-1174.452) -- 0:01:00 63000 -- (-1168.725) (-1170.667) [-1171.913] (-1180.478) * (-1168.513) (-1171.058) [-1169.142] (-1173.216) -- 0:00:59 63500 -- (-1169.629) (-1170.969) [-1170.839] (-1175.883) * (-1169.976) (-1170.756) [-1168.209] (-1171.614) -- 0:00:58 64000 -- (-1169.543) (-1176.166) (-1169.365) [-1178.578] * (-1170.392) (-1170.905) [-1168.662] (-1169.935) -- 0:00:58 64500 -- (-1168.777) [-1171.331] (-1168.219) (-1177.634) * (-1172.927) [-1171.866] (-1168.900) (-1168.858) -- 0:00:58 65000 -- (-1168.489) (-1168.907) [-1168.301] (-1179.356) * [-1169.066] (-1168.507) (-1171.979) (-1170.541) -- 0:00:57 Average standard deviation of split frequencies: 0.029364 65500 -- (-1169.289) (-1171.464) [-1167.894] (-1185.504) * (-1169.996) (-1170.970) (-1167.622) [-1169.957] -- 0:00:57 66000 -- (-1170.272) (-1171.361) [-1169.957] (-1181.155) * (-1172.787) [-1168.360] (-1168.055) (-1171.986) -- 0:00:56 66500 -- [-1170.637] (-1169.090) (-1169.061) (-1187.287) * (-1168.396) [-1168.419] (-1170.618) (-1171.782) -- 0:00:56 67000 -- [-1172.931] (-1168.850) (-1168.294) (-1171.667) * (-1169.709) (-1168.533) [-1168.506] (-1169.735) -- 0:00:55 67500 -- (-1171.635) (-1169.041) (-1168.307) [-1176.463] * (-1169.831) (-1168.313) (-1169.945) [-1168.737] -- 0:00:55 68000 -- (-1168.429) (-1174.921) [-1170.578] (-1177.692) * (-1170.315) (-1170.032) [-1168.949] (-1168.871) -- 0:00:54 68500 -- (-1170.206) (-1171.622) [-1170.338] (-1185.570) * (-1173.861) (-1168.728) (-1169.547) [-1169.531] -- 0:00:54 69000 -- (-1174.329) [-1171.415] (-1169.043) (-1181.979) * (-1172.671) (-1168.507) (-1170.019) [-1170.029] -- 0:00:53 69500 -- [-1169.836] (-1169.470) (-1171.754) (-1185.346) * [-1173.480] (-1170.320) (-1171.351) (-1168.712) -- 0:00:53 70000 -- (-1170.442) [-1168.463] (-1170.310) (-1174.076) * (-1172.347) (-1168.159) [-1169.148] (-1170.455) -- 0:00:53 Average standard deviation of split frequencies: 0.024460 70500 -- (-1174.936) (-1168.467) [-1169.255] (-1174.247) * (-1172.387) [-1171.891] (-1170.681) (-1169.876) -- 0:00:52 71000 -- (-1171.353) [-1168.358] (-1171.675) (-1182.731) * [-1174.019] (-1171.367) (-1169.525) (-1171.426) -- 0:01:05 71500 -- (-1169.366) (-1171.756) (-1171.871) [-1177.733] * [-1171.107] (-1172.276) (-1167.970) (-1169.902) -- 0:01:04 72000 -- [-1170.220] (-1172.435) (-1170.271) (-1173.373) * (-1168.010) (-1170.372) (-1169.544) [-1169.807] -- 0:01:04 72500 -- (-1172.330) (-1169.099) [-1170.540] (-1183.332) * (-1170.856) [-1170.172] (-1171.432) (-1168.846) -- 0:01:03 73000 -- [-1169.758] (-1170.215) (-1170.916) (-1177.459) * (-1170.598) (-1172.980) [-1171.486] (-1168.932) -- 0:01:03 73500 -- [-1170.725] (-1172.294) (-1168.682) (-1186.455) * [-1170.598] (-1172.384) (-1169.488) (-1170.964) -- 0:01:03 74000 -- (-1168.634) (-1170.877) [-1169.302] (-1182.439) * [-1172.253] (-1169.302) (-1169.505) (-1174.890) -- 0:01:02 74500 -- [-1168.456] (-1170.989) (-1168.528) (-1181.980) * [-1170.624] (-1169.549) (-1170.364) (-1174.984) -- 0:01:02 75000 -- (-1172.670) (-1170.639) [-1168.575] (-1188.483) * (-1169.391) (-1170.494) (-1169.588) [-1174.414] -- 0:01:01 Average standard deviation of split frequencies: 0.024466 75500 -- (-1169.774) (-1170.107) (-1170.451) [-1174.783] * (-1169.104) (-1170.759) [-1169.635] (-1173.887) -- 0:01:01 76000 -- [-1170.043] (-1170.857) (-1170.645) (-1184.696) * (-1169.433) [-1172.416] (-1171.256) (-1171.411) -- 0:01:00 76500 -- [-1171.723] (-1173.586) (-1172.564) (-1170.278) * (-1171.123) [-1168.582] (-1169.272) (-1171.835) -- 0:01:00 77000 -- [-1170.240] (-1170.532) (-1172.026) (-1170.942) * [-1174.060] (-1169.439) (-1170.708) (-1170.310) -- 0:00:59 77500 -- [-1170.668] (-1169.970) (-1171.347) (-1170.880) * (-1169.990) (-1169.570) [-1168.806] (-1170.882) -- 0:00:59 78000 -- (-1168.944) (-1169.532) (-1171.794) [-1171.518] * (-1172.810) (-1170.324) [-1168.726] (-1169.943) -- 0:00:59 78500 -- (-1169.065) (-1171.471) [-1171.104] (-1170.443) * (-1171.736) (-1168.922) [-1172.392] (-1169.325) -- 0:00:58 79000 -- [-1170.908] (-1170.566) (-1170.139) (-1169.684) * [-1172.194] (-1168.817) (-1171.880) (-1170.579) -- 0:00:58 79500 -- [-1170.492] (-1171.199) (-1169.529) (-1168.990) * [-1169.924] (-1168.404) (-1173.024) (-1168.503) -- 0:00:57 80000 -- (-1170.639) (-1175.920) [-1169.614] (-1170.507) * [-1168.516] (-1169.279) (-1169.308) (-1171.341) -- 0:00:57 Average standard deviation of split frequencies: 0.022401 80500 -- (-1170.685) (-1172.277) (-1168.783) [-1170.187] * [-1168.022] (-1168.204) (-1169.358) (-1172.412) -- 0:00:57 81000 -- (-1170.508) (-1169.823) [-1170.173] (-1170.843) * (-1169.171) [-1169.362] (-1168.597) (-1168.193) -- 0:00:56 81500 -- (-1168.286) [-1172.112] (-1170.025) (-1173.039) * (-1169.242) (-1169.793) (-1169.123) [-1168.112] -- 0:00:56 82000 -- (-1167.885) (-1169.652) (-1169.670) [-1170.679] * (-1167.841) (-1169.946) (-1170.431) [-1169.153] -- 0:00:55 82500 -- [-1169.021] (-1170.618) (-1169.352) (-1168.671) * (-1168.453) [-1169.946] (-1173.423) (-1172.755) -- 0:00:55 83000 -- [-1169.595] (-1169.930) (-1169.640) (-1171.484) * [-1167.948] (-1170.271) (-1168.536) (-1170.535) -- 0:00:55 83500 -- (-1168.635) [-1169.475] (-1174.897) (-1169.031) * (-1168.245) (-1169.608) (-1167.900) [-1168.486] -- 0:00:54 84000 -- (-1171.383) (-1168.570) (-1172.284) [-1173.546] * [-1169.864] (-1173.457) (-1167.900) (-1168.776) -- 0:00:54 84500 -- [-1168.661] (-1168.075) (-1170.908) (-1174.142) * (-1169.905) (-1169.825) [-1169.753] (-1170.826) -- 0:00:54 85000 -- (-1172.813) [-1168.259] (-1171.942) (-1169.404) * (-1170.099) (-1171.101) [-1170.617] (-1168.893) -- 0:00:53 Average standard deviation of split frequencies: 0.019906 85500 -- [-1168.901] (-1170.229) (-1170.823) (-1167.859) * (-1170.741) (-1168.377) (-1172.020) [-1168.142] -- 0:00:53 86000 -- (-1173.439) (-1169.297) (-1170.565) [-1169.118] * (-1170.162) [-1168.740] (-1171.485) (-1169.956) -- 0:00:53 86500 -- (-1167.757) [-1171.875] (-1170.344) (-1171.151) * (-1168.929) (-1168.407) [-1174.757] (-1171.355) -- 0:00:52 87000 -- (-1168.731) [-1168.552] (-1171.298) (-1170.275) * (-1167.991) (-1174.440) (-1173.804) [-1168.596] -- 0:01:02 87500 -- (-1168.648) (-1169.243) (-1168.921) [-1172.863] * (-1167.800) (-1170.301) [-1171.224] (-1171.588) -- 0:01:02 88000 -- (-1170.039) (-1169.005) [-1169.012] (-1168.414) * (-1170.621) (-1168.544) (-1171.225) [-1168.077] -- 0:01:02 88500 -- (-1168.353) (-1169.598) (-1168.332) [-1170.453] * [-1171.128] (-1169.640) (-1171.185) (-1169.072) -- 0:01:01 89000 -- [-1169.159] (-1172.515) (-1169.757) (-1169.159) * (-1167.631) (-1169.203) (-1171.159) [-1169.195] -- 0:01:01 89500 -- [-1168.176] (-1174.139) (-1170.639) (-1168.248) * [-1170.214] (-1169.661) (-1173.076) (-1169.130) -- 0:01:01 90000 -- (-1168.531) (-1170.551) [-1171.981] (-1168.238) * [-1169.710] (-1168.345) (-1171.625) (-1169.029) -- 0:01:00 Average standard deviation of split frequencies: 0.020220 90500 -- (-1170.985) [-1170.231] (-1170.727) (-1168.325) * (-1170.808) (-1175.185) [-1171.104] (-1169.294) -- 0:01:00 91000 -- [-1168.526] (-1172.810) (-1174.238) (-1168.274) * (-1168.682) (-1175.198) [-1168.904] (-1168.210) -- 0:00:59 91500 -- [-1169.846] (-1171.898) (-1170.410) (-1169.850) * [-1168.937] (-1169.888) (-1171.334) (-1170.680) -- 0:00:59 92000 -- [-1176.542] (-1175.520) (-1171.611) (-1170.639) * [-1169.018] (-1168.207) (-1169.953) (-1170.546) -- 0:00:59 92500 -- [-1173.984] (-1177.566) (-1169.387) (-1173.288) * (-1174.158) (-1169.244) (-1173.819) [-1172.663] -- 0:00:58 93000 -- (-1170.308) (-1172.609) [-1171.064] (-1169.853) * (-1180.012) [-1175.878] (-1168.477) (-1171.288) -- 0:00:58 93500 -- (-1171.674) (-1168.991) [-1169.929] (-1168.858) * (-1170.882) [-1170.802] (-1168.875) (-1170.989) -- 0:00:58 94000 -- (-1171.782) (-1169.570) (-1168.056) [-1168.140] * (-1167.725) [-1172.796] (-1170.631) (-1170.963) -- 0:00:57 94500 -- [-1168.611] (-1169.570) (-1174.874) (-1168.628) * (-1168.483) (-1170.976) (-1171.616) [-1170.998] -- 0:00:57 95000 -- (-1171.400) (-1169.357) [-1169.400] (-1169.803) * (-1168.302) (-1171.674) [-1171.655] (-1171.904) -- 0:00:57 Average standard deviation of split frequencies: 0.022097 95500 -- (-1174.317) (-1168.123) (-1168.810) [-1170.298] * (-1168.495) (-1172.162) (-1175.101) [-1172.505] -- 0:00:56 96000 -- (-1172.542) (-1168.537) [-1168.965] (-1170.168) * [-1169.646] (-1171.700) (-1172.151) (-1170.666) -- 0:00:56 96500 -- (-1173.865) (-1168.784) (-1168.625) [-1171.629] * (-1168.120) (-1171.185) [-1171.401] (-1170.482) -- 0:00:56 97000 -- (-1174.505) [-1168.619] (-1172.115) (-1173.207) * [-1171.481] (-1172.504) (-1171.509) (-1170.102) -- 0:00:55 97500 -- (-1173.564) [-1168.888] (-1170.130) (-1175.456) * (-1173.518) (-1170.641) [-1168.478] (-1169.590) -- 0:00:55 98000 -- (-1170.971) (-1173.021) [-1172.973] (-1175.914) * (-1174.964) [-1168.643] (-1170.942) (-1169.856) -- 0:00:55 98500 -- (-1170.167) (-1171.282) [-1169.003] (-1170.843) * (-1177.759) (-1170.571) [-1169.276] (-1174.526) -- 0:00:54 99000 -- (-1170.550) (-1171.049) (-1173.769) [-1169.797] * (-1172.828) [-1174.080] (-1169.593) (-1172.442) -- 0:00:54 99500 -- (-1172.082) [-1172.416] (-1168.677) (-1169.049) * (-1169.082) (-1172.253) (-1169.446) [-1174.140] -- 0:00:54 100000 -- (-1169.187) [-1170.023] (-1170.148) (-1174.193) * (-1169.175) [-1168.452] (-1170.179) (-1172.640) -- 0:00:54 Average standard deviation of split frequencies: 0.023674 100500 -- [-1169.403] (-1171.315) (-1169.995) (-1168.737) * (-1169.850) (-1170.692) [-1173.735] (-1170.113) -- 0:00:53 101000 -- (-1168.085) [-1172.559] (-1170.567) (-1169.189) * [-1169.696] (-1169.905) (-1171.167) (-1170.897) -- 0:00:53 101500 -- [-1171.371] (-1171.945) (-1169.882) (-1170.300) * (-1174.496) [-1169.262] (-1169.673) (-1170.886) -- 0:00:53 102000 -- [-1170.537] (-1170.202) (-1171.345) (-1171.586) * (-1174.142) (-1171.196) (-1172.110) [-1170.739] -- 0:00:52 102500 -- (-1169.050) [-1171.504] (-1169.072) (-1169.795) * (-1174.069) (-1173.479) (-1168.354) [-1170.517] -- 0:00:52 103000 -- (-1168.312) (-1168.168) [-1169.755] (-1171.263) * [-1172.377] (-1172.641) (-1168.199) (-1172.606) -- 0:01:00 103500 -- (-1172.145) (-1170.671) (-1170.318) [-1167.720] * (-1173.096) (-1169.795) [-1168.675] (-1168.144) -- 0:01:00 104000 -- (-1171.550) [-1168.537] (-1173.963) (-1170.950) * (-1174.288) [-1168.712] (-1169.613) (-1167.751) -- 0:01:00 104500 -- (-1169.284) (-1168.008) [-1169.119] (-1168.496) * (-1172.323) (-1169.519) [-1169.656] (-1170.259) -- 0:00:59 105000 -- (-1171.499) (-1168.305) (-1167.788) [-1168.057] * (-1170.213) (-1168.465) [-1171.217] (-1170.711) -- 0:00:59 Average standard deviation of split frequencies: 0.020260 105500 -- (-1169.498) (-1169.144) (-1168.722) [-1168.443] * (-1170.864) (-1168.994) [-1171.307] (-1169.301) -- 0:00:59 106000 -- (-1169.796) (-1168.556) [-1170.475] (-1169.315) * (-1171.785) (-1168.067) [-1168.243] (-1171.374) -- 0:00:59 106500 -- (-1169.857) (-1170.140) [-1170.032] (-1168.952) * (-1171.134) (-1169.740) (-1170.058) [-1170.781] -- 0:00:58 107000 -- [-1171.721] (-1170.173) (-1168.372) (-1169.618) * (-1169.776) (-1169.965) [-1172.534] (-1171.228) -- 0:00:58 107500 -- [-1169.187] (-1169.628) (-1177.010) (-1169.316) * (-1173.138) [-1169.760] (-1175.149) (-1171.645) -- 0:00:58 108000 -- (-1176.986) [-1169.935] (-1168.871) (-1170.108) * [-1169.819] (-1170.010) (-1176.817) (-1168.037) -- 0:00:57 108500 -- [-1172.701] (-1170.476) (-1168.481) (-1169.852) * (-1168.052) [-1170.013] (-1171.813) (-1171.200) -- 0:00:57 109000 -- (-1176.874) (-1169.483) (-1170.827) [-1170.782] * (-1170.102) [-1168.791] (-1171.500) (-1168.046) -- 0:00:57 109500 -- [-1171.046] (-1169.483) (-1170.635) (-1173.049) * (-1170.605) [-1171.453] (-1170.270) (-1168.027) -- 0:00:56 110000 -- (-1169.993) [-1168.446] (-1171.497) (-1169.549) * (-1169.001) (-1169.158) (-1167.686) [-1169.420] -- 0:00:56 Average standard deviation of split frequencies: 0.019879 110500 -- (-1172.244) (-1171.574) [-1170.178] (-1170.549) * (-1168.241) (-1169.574) [-1168.467] (-1170.113) -- 0:00:56 111000 -- (-1171.831) (-1170.929) [-1170.668] (-1169.004) * [-1167.883] (-1169.091) (-1168.142) (-1173.605) -- 0:00:56 111500 -- (-1168.002) (-1171.819) (-1170.691) [-1169.270] * (-1169.357) (-1169.091) (-1168.728) [-1170.540] -- 0:00:55 112000 -- [-1168.668] (-1173.409) (-1168.767) (-1170.761) * (-1168.426) (-1170.054) [-1169.579] (-1168.187) -- 0:00:55 112500 -- (-1170.722) (-1181.503) (-1169.331) [-1169.388] * (-1168.058) [-1168.467] (-1169.735) (-1168.238) -- 0:00:55 113000 -- (-1168.204) (-1171.137) [-1169.358] (-1173.004) * (-1168.847) [-1168.410] (-1168.231) (-1167.974) -- 0:00:54 113500 -- [-1168.035] (-1169.490) (-1169.079) (-1170.672) * (-1169.803) [-1170.517] (-1171.735) (-1168.721) -- 0:00:54 114000 -- [-1170.883] (-1169.861) (-1172.931) (-1168.188) * [-1169.393] (-1169.361) (-1170.119) (-1171.102) -- 0:00:54 114500 -- (-1168.980) (-1172.919) [-1170.050] (-1169.415) * (-1169.176) (-1170.580) (-1171.081) [-1171.547] -- 0:00:54 115000 -- (-1173.601) [-1171.880] (-1168.941) (-1168.414) * [-1168.492] (-1171.540) (-1171.243) (-1175.420) -- 0:00:53 Average standard deviation of split frequencies: 0.019642 115500 -- [-1171.666] (-1169.926) (-1169.075) (-1169.686) * [-1167.868] (-1171.521) (-1169.402) (-1174.612) -- 0:00:53 116000 -- (-1169.870) (-1169.449) [-1168.855] (-1171.802) * (-1170.270) (-1171.140) (-1171.085) [-1170.803] -- 0:00:53 116500 -- (-1169.397) (-1168.105) (-1168.150) [-1168.574] * [-1171.151] (-1172.118) (-1171.003) (-1170.639) -- 0:00:53 117000 -- (-1170.044) [-1168.533] (-1168.833) (-1168.762) * (-1169.139) (-1171.866) [-1171.727] (-1168.475) -- 0:00:52 117500 -- [-1171.186] (-1171.378) (-1172.151) (-1169.653) * [-1167.863] (-1170.683) (-1169.133) (-1170.076) -- 0:00:52 118000 -- (-1170.155) [-1170.332] (-1172.337) (-1173.215) * (-1169.170) (-1168.565) (-1169.571) [-1169.682] -- 0:00:52 118500 -- (-1168.688) (-1171.628) (-1169.894) [-1168.656] * (-1169.978) (-1169.487) (-1168.609) [-1169.906] -- 0:00:52 119000 -- [-1171.072] (-1171.733) (-1170.436) (-1169.023) * (-1172.447) [-1169.760] (-1171.231) (-1170.201) -- 0:00:59 119500 -- (-1168.673) [-1169.558] (-1170.681) (-1168.526) * (-1171.334) [-1168.757] (-1171.372) (-1173.564) -- 0:00:58 120000 -- [-1168.201] (-1170.932) (-1170.606) (-1168.676) * (-1169.037) [-1170.883] (-1174.164) (-1169.622) -- 0:00:58 Average standard deviation of split frequencies: 0.016278 120500 -- (-1169.766) (-1173.011) (-1170.784) [-1169.313] * (-1170.023) (-1171.120) (-1169.781) [-1170.221] -- 0:00:58 121000 -- [-1172.501] (-1169.333) (-1172.701) (-1171.672) * (-1168.572) (-1169.877) [-1168.662] (-1171.606) -- 0:00:58 121500 -- (-1170.580) [-1169.867] (-1172.640) (-1171.573) * (-1168.383) (-1171.481) [-1170.711] (-1171.249) -- 0:00:57 122000 -- (-1169.991) (-1169.544) (-1170.217) [-1171.401] * (-1168.206) (-1169.410) (-1168.477) [-1170.598] -- 0:00:57 122500 -- [-1168.836] (-1169.496) (-1172.127) (-1168.698) * [-1168.477] (-1176.253) (-1172.987) (-1169.191) -- 0:00:57 123000 -- (-1174.884) [-1169.924] (-1170.530) (-1171.262) * [-1168.516] (-1177.886) (-1171.560) (-1170.657) -- 0:00:57 123500 -- (-1170.957) [-1168.821] (-1170.680) (-1172.375) * (-1169.663) (-1175.409) (-1169.150) [-1170.757] -- 0:00:56 124000 -- (-1171.341) (-1168.377) [-1168.658] (-1169.822) * (-1170.701) [-1172.559] (-1170.062) (-1169.041) -- 0:00:56 124500 -- (-1170.793) (-1171.739) [-1168.692] (-1169.742) * (-1171.497) [-1167.941] (-1170.015) (-1168.213) -- 0:00:56 125000 -- (-1171.199) (-1170.527) (-1168.829) [-1172.145] * (-1172.509) [-1168.816] (-1170.178) (-1171.393) -- 0:00:56 Average standard deviation of split frequencies: 0.018903 125500 -- [-1171.627] (-1172.082) (-1174.820) (-1174.090) * (-1172.017) (-1170.259) (-1169.437) [-1169.666] -- 0:00:55 126000 -- (-1173.370) [-1171.043] (-1171.865) (-1177.364) * [-1168.855] (-1169.331) (-1169.637) (-1171.019) -- 0:00:55 126500 -- [-1172.081] (-1168.399) (-1169.312) (-1175.709) * (-1168.857) (-1175.808) (-1169.793) [-1173.947] -- 0:00:55 127000 -- [-1171.701] (-1177.785) (-1169.777) (-1173.004) * [-1168.496] (-1170.709) (-1170.084) (-1168.005) -- 0:00:54 127500 -- (-1171.042) (-1177.495) [-1169.427] (-1169.981) * (-1170.437) [-1170.125] (-1170.643) (-1168.734) -- 0:00:54 128000 -- [-1171.331] (-1171.770) (-1168.620) (-1168.794) * (-1168.447) (-1168.496) [-1172.157] (-1169.356) -- 0:00:54 128500 -- (-1169.485) [-1168.622] (-1169.853) (-1170.718) * [-1168.559] (-1168.980) (-1169.314) (-1169.854) -- 0:00:54 129000 -- (-1170.473) [-1168.642] (-1169.393) (-1168.380) * (-1168.300) [-1168.836] (-1169.665) (-1170.726) -- 0:00:54 129500 -- (-1173.741) (-1169.431) [-1171.353] (-1171.704) * (-1169.963) (-1168.534) [-1170.469] (-1176.615) -- 0:00:53 130000 -- [-1170.672] (-1172.155) (-1170.250) (-1170.554) * (-1170.653) [-1172.220] (-1171.915) (-1178.421) -- 0:00:53 Average standard deviation of split frequencies: 0.020644 130500 -- [-1170.941] (-1168.195) (-1170.974) (-1168.725) * (-1170.202) (-1175.574) [-1168.145] (-1174.027) -- 0:00:53 131000 -- (-1170.474) [-1168.825] (-1171.392) (-1172.434) * (-1169.006) (-1176.462) [-1168.463] (-1168.881) -- 0:00:53 131500 -- [-1169.676] (-1169.877) (-1172.399) (-1170.419) * [-1168.106] (-1172.376) (-1168.915) (-1168.427) -- 0:00:52 132000 -- (-1176.764) [-1172.506] (-1174.101) (-1169.778) * (-1170.519) (-1169.737) [-1169.182] (-1170.548) -- 0:00:52 132500 -- [-1167.843] (-1169.409) (-1169.644) (-1170.301) * [-1170.114] (-1169.977) (-1170.093) (-1169.141) -- 0:00:52 133000 -- [-1170.281] (-1170.492) (-1170.519) (-1170.737) * (-1175.480) (-1169.571) (-1171.141) [-1168.410] -- 0:00:52 133500 -- (-1168.571) (-1168.352) [-1172.329] (-1169.215) * (-1174.278) (-1168.237) (-1169.600) [-1168.427] -- 0:00:51 134000 -- [-1168.275] (-1168.751) (-1169.961) (-1168.892) * (-1171.279) [-1168.793] (-1171.532) (-1168.413) -- 0:00:51 134500 -- (-1168.914) (-1168.417) (-1170.442) [-1171.250] * (-1173.403) (-1169.753) [-1170.885] (-1168.413) -- 0:00:51 135000 -- (-1170.955) [-1169.889] (-1173.345) (-1169.701) * (-1170.010) [-1170.893] (-1170.286) (-1168.414) -- 0:00:57 Average standard deviation of split frequencies: 0.020250 135500 -- (-1168.126) [-1170.393] (-1169.908) (-1172.597) * (-1169.849) (-1169.397) [-1171.503] (-1168.662) -- 0:00:57 136000 -- [-1168.903] (-1171.669) (-1168.436) (-1170.797) * (-1170.848) (-1169.555) (-1170.971) [-1172.552] -- 0:00:57 136500 -- (-1170.848) (-1172.278) [-1168.613] (-1175.052) * (-1172.819) (-1169.614) [-1168.507] (-1170.487) -- 0:00:56 137000 -- (-1168.972) (-1170.759) [-1171.879] (-1174.096) * [-1170.482] (-1169.914) (-1168.544) (-1168.999) -- 0:00:56 137500 -- (-1168.568) (-1170.016) (-1169.679) [-1171.966] * (-1174.937) (-1170.515) [-1168.348] (-1169.642) -- 0:00:56 138000 -- (-1168.620) [-1168.849] (-1171.791) (-1173.680) * (-1170.080) (-1169.526) [-1168.430] (-1170.046) -- 0:00:56 138500 -- [-1168.512] (-1169.868) (-1177.387) (-1179.031) * [-1170.094] (-1168.926) (-1168.747) (-1170.946) -- 0:00:55 139000 -- (-1168.294) (-1172.457) (-1168.731) [-1179.265] * [-1169.845] (-1169.661) (-1173.270) (-1170.404) -- 0:00:55 139500 -- [-1170.175] (-1168.380) (-1168.727) (-1171.659) * [-1171.659] (-1169.636) (-1173.261) (-1167.846) -- 0:00:55 140000 -- (-1170.653) (-1170.571) [-1168.061] (-1168.763) * (-1168.786) [-1170.301] (-1169.081) (-1173.085) -- 0:00:55 Average standard deviation of split frequencies: 0.020293 140500 -- (-1170.586) [-1170.614] (-1168.187) (-1170.673) * (-1172.978) [-1169.016] (-1169.500) (-1170.268) -- 0:00:55 141000 -- (-1169.450) [-1170.953] (-1167.927) (-1169.903) * (-1173.100) (-1170.077) [-1168.681] (-1169.479) -- 0:00:54 141500 -- [-1172.690] (-1172.692) (-1169.720) (-1169.540) * (-1173.933) (-1170.340) [-1169.465] (-1169.574) -- 0:00:54 142000 -- (-1169.644) (-1175.581) [-1168.832] (-1169.537) * [-1171.850] (-1171.252) (-1170.340) (-1171.946) -- 0:00:54 142500 -- (-1170.079) (-1169.136) [-1169.878] (-1169.036) * [-1168.611] (-1170.566) (-1169.311) (-1169.622) -- 0:00:54 143000 -- (-1170.144) (-1169.962) [-1171.119] (-1173.313) * (-1168.651) [-1169.851] (-1170.413) (-1169.624) -- 0:00:53 143500 -- (-1172.500) (-1170.342) [-1168.227] (-1173.041) * (-1172.077) (-1172.863) [-1168.062] (-1168.829) -- 0:00:53 144000 -- (-1175.933) [-1171.647] (-1170.724) (-1169.177) * (-1168.101) [-1173.188] (-1173.264) (-1169.858) -- 0:00:53 144500 -- [-1171.199] (-1169.507) (-1168.437) (-1169.848) * [-1169.556] (-1168.295) (-1170.217) (-1169.139) -- 0:00:53 145000 -- (-1172.126) (-1172.515) (-1170.953) [-1170.382] * (-1171.441) (-1168.343) [-1169.850] (-1169.146) -- 0:00:53 Average standard deviation of split frequencies: 0.020826 145500 -- (-1175.082) (-1169.072) (-1171.180) [-1172.572] * (-1171.105) [-1168.729] (-1174.097) (-1169.283) -- 0:00:52 146000 -- (-1170.028) (-1169.125) [-1169.059] (-1169.751) * [-1168.648] (-1168.535) (-1170.602) (-1169.137) -- 0:00:52 146500 -- (-1169.391) (-1170.678) [-1169.422] (-1171.301) * (-1167.665) (-1170.618) (-1173.035) [-1172.135] -- 0:00:52 147000 -- (-1168.535) [-1168.221] (-1168.185) (-1172.780) * (-1168.862) (-1170.990) [-1168.304] (-1170.608) -- 0:00:52 147500 -- (-1169.165) (-1168.202) [-1168.961] (-1174.462) * (-1168.338) (-1171.217) (-1169.748) [-1170.385] -- 0:00:52 148000 -- [-1169.182] (-1169.491) (-1171.894) (-1169.849) * (-1168.499) (-1169.230) (-1170.869) [-1169.688] -- 0:00:51 148500 -- (-1167.916) [-1168.270] (-1172.721) (-1170.877) * (-1168.511) (-1175.411) (-1170.000) [-1169.472] -- 0:00:51 149000 -- (-1169.255) (-1168.245) (-1167.903) [-1168.907] * (-1170.349) (-1170.327) [-1169.919] (-1170.657) -- 0:00:51 149500 -- [-1168.687] (-1169.034) (-1170.469) (-1169.996) * (-1174.430) (-1172.611) [-1168.989] (-1171.445) -- 0:00:51 150000 -- (-1172.582) [-1169.438] (-1171.418) (-1171.922) * [-1168.969] (-1169.488) (-1168.682) (-1171.986) -- 0:00:51 Average standard deviation of split frequencies: 0.018077 150500 -- [-1173.568] (-1168.540) (-1174.694) (-1172.565) * (-1169.298) (-1174.036) [-1168.149] (-1172.612) -- 0:00:50 151000 -- (-1173.353) [-1170.748] (-1169.448) (-1175.037) * (-1170.615) (-1170.476) (-1168.766) [-1170.217] -- 0:00:50 151500 -- (-1173.633) [-1171.432] (-1169.877) (-1170.900) * (-1171.690) (-1170.346) (-1169.704) [-1170.358] -- 0:00:56 152000 -- (-1175.539) [-1170.524] (-1175.182) (-1168.922) * (-1170.518) (-1173.512) [-1169.415] (-1169.092) -- 0:00:55 152500 -- [-1170.698] (-1168.852) (-1170.272) (-1169.712) * (-1168.291) (-1172.152) (-1169.222) [-1168.359] -- 0:00:55 153000 -- (-1171.273) [-1170.328] (-1173.087) (-1169.387) * [-1168.461] (-1169.710) (-1168.845) (-1168.268) -- 0:00:55 153500 -- [-1170.185] (-1170.279) (-1172.778) (-1169.778) * (-1168.649) [-1169.169] (-1171.205) (-1168.338) -- 0:00:55 154000 -- (-1171.019) (-1172.995) [-1170.699] (-1171.099) * [-1170.930] (-1172.255) (-1168.719) (-1171.946) -- 0:00:54 154500 -- (-1172.661) [-1170.451] (-1171.148) (-1172.216) * (-1168.617) [-1171.766] (-1168.906) (-1169.882) -- 0:00:54 155000 -- (-1169.229) [-1170.462] (-1173.901) (-1173.640) * (-1173.310) [-1175.050] (-1168.233) (-1169.810) -- 0:00:54 Average standard deviation of split frequencies: 0.017292 155500 -- (-1170.056) [-1170.263] (-1173.608) (-1171.086) * (-1172.003) [-1170.466] (-1171.343) (-1173.235) -- 0:00:54 156000 -- [-1169.330] (-1171.522) (-1168.425) (-1171.230) * (-1171.469) (-1173.333) [-1169.637] (-1170.660) -- 0:00:54 156500 -- [-1169.248] (-1172.088) (-1169.494) (-1170.909) * (-1169.415) (-1172.903) [-1169.079] (-1170.176) -- 0:00:53 157000 -- (-1169.273) (-1169.757) [-1172.260] (-1169.108) * (-1172.407) (-1170.701) [-1169.672] (-1169.163) -- 0:00:53 157500 -- [-1170.536] (-1170.458) (-1172.063) (-1169.807) * (-1172.458) (-1169.949) (-1170.438) [-1171.660] -- 0:00:53 158000 -- (-1174.257) [-1168.950] (-1177.465) (-1170.540) * [-1170.272] (-1175.329) (-1170.693) (-1168.576) -- 0:00:53 158500 -- (-1172.557) [-1169.794] (-1173.574) (-1169.493) * (-1170.941) [-1170.262] (-1172.514) (-1170.517) -- 0:00:53 159000 -- (-1170.423) [-1169.792] (-1173.064) (-1170.453) * [-1172.188] (-1170.801) (-1171.671) (-1172.072) -- 0:00:52 159500 -- (-1173.738) (-1171.129) [-1168.555] (-1170.555) * [-1172.415] (-1169.048) (-1172.839) (-1175.990) -- 0:00:52 160000 -- (-1173.367) (-1173.244) (-1168.092) [-1171.800] * [-1169.836] (-1169.628) (-1173.124) (-1170.143) -- 0:00:52 Average standard deviation of split frequencies: 0.019457 160500 -- (-1174.924) (-1172.076) [-1168.879] (-1171.288) * (-1169.790) [-1167.945] (-1169.460) (-1169.201) -- 0:00:52 161000 -- (-1173.942) (-1172.383) (-1170.657) [-1172.655] * [-1170.677] (-1168.030) (-1172.581) (-1169.642) -- 0:00:52 161500 -- (-1174.228) (-1169.115) (-1168.886) [-1172.214] * (-1170.750) (-1173.268) [-1168.837] (-1169.135) -- 0:00:51 162000 -- (-1171.798) [-1169.816] (-1170.749) (-1169.624) * [-1171.618] (-1169.472) (-1169.062) (-1170.564) -- 0:00:51 162500 -- (-1169.364) (-1169.692) (-1169.756) [-1168.502] * (-1171.055) (-1168.587) [-1172.836] (-1170.195) -- 0:00:51 163000 -- (-1173.409) (-1173.513) (-1173.037) [-1168.265] * (-1169.537) [-1170.860] (-1170.046) (-1170.319) -- 0:00:51 163500 -- (-1171.719) (-1170.645) (-1173.126) [-1171.245] * (-1170.169) (-1171.217) [-1169.079] (-1170.953) -- 0:00:51 164000 -- (-1172.524) (-1170.093) [-1169.475] (-1170.176) * (-1170.329) (-1169.100) [-1167.851] (-1169.869) -- 0:00:50 164500 -- (-1171.121) [-1171.143] (-1172.581) (-1171.087) * (-1169.141) [-1168.485] (-1168.004) (-1169.521) -- 0:00:50 165000 -- [-1168.661] (-1177.186) (-1170.587) (-1169.081) * [-1169.601] (-1168.472) (-1172.138) (-1173.698) -- 0:00:50 Average standard deviation of split frequencies: 0.021014 165500 -- (-1171.486) (-1175.142) (-1170.243) [-1169.483] * (-1171.403) [-1168.562] (-1172.027) (-1170.801) -- 0:00:50 166000 -- [-1171.389] (-1168.082) (-1172.119) (-1171.258) * (-1169.535) (-1168.376) (-1170.126) [-1168.884] -- 0:00:50 166500 -- [-1170.267] (-1170.071) (-1171.845) (-1171.935) * (-1170.184) [-1168.554] (-1169.810) (-1170.473) -- 0:00:50 167000 -- (-1170.238) (-1173.736) (-1169.998) [-1170.656] * (-1173.063) (-1172.691) [-1170.115] (-1168.919) -- 0:00:49 167500 -- (-1171.694) (-1168.349) (-1169.790) [-1171.341] * (-1173.312) [-1170.181] (-1172.295) (-1169.486) -- 0:00:54 168000 -- (-1170.896) (-1168.999) [-1172.014] (-1169.566) * (-1168.550) (-1176.697) [-1168.235] (-1171.109) -- 0:00:54 168500 -- (-1171.983) (-1168.212) (-1170.167) [-1169.298] * (-1168.345) (-1170.983) (-1170.321) [-1168.645] -- 0:00:54 169000 -- [-1170.607] (-1168.036) (-1169.373) (-1169.865) * [-1169.562] (-1170.883) (-1171.013) (-1170.530) -- 0:00:54 169500 -- (-1169.902) (-1168.609) (-1171.907) [-1168.870] * (-1168.822) (-1171.540) (-1170.675) [-1168.852] -- 0:00:53 170000 -- (-1172.269) (-1170.675) [-1171.160] (-1169.181) * (-1169.211) (-1169.142) [-1169.391] (-1169.809) -- 0:00:53 Average standard deviation of split frequencies: 0.019181 170500 -- (-1169.770) (-1169.678) [-1169.947] (-1168.684) * [-1168.437] (-1169.177) (-1169.964) (-1169.806) -- 0:00:53 171000 -- (-1171.320) (-1169.326) (-1171.818) [-1171.886] * (-1168.381) [-1170.984] (-1172.824) (-1172.734) -- 0:00:53 171500 -- (-1170.691) (-1171.697) (-1173.910) [-1170.969] * (-1168.758) (-1168.463) (-1170.305) [-1168.572] -- 0:00:53 172000 -- (-1168.812) (-1172.785) [-1168.438] (-1174.533) * [-1169.732] (-1173.253) (-1169.239) (-1168.697) -- 0:00:52 172500 -- [-1168.995] (-1171.914) (-1169.241) (-1169.325) * (-1170.269) (-1171.672) [-1169.122] (-1168.948) -- 0:00:52 173000 -- (-1168.796) (-1169.148) (-1172.293) [-1169.218] * [-1169.578] (-1172.478) (-1171.208) (-1172.421) -- 0:00:52 173500 -- [-1168.714] (-1169.735) (-1171.002) (-1172.784) * (-1169.875) [-1172.560] (-1169.583) (-1171.223) -- 0:00:52 174000 -- [-1169.358] (-1168.175) (-1169.852) (-1173.002) * (-1169.696) (-1170.299) [-1172.961] (-1168.020) -- 0:00:52 174500 -- (-1173.230) (-1169.726) [-1170.441] (-1168.588) * (-1171.967) [-1168.668] (-1171.569) (-1168.000) -- 0:00:52 175000 -- (-1169.145) (-1169.338) (-1170.598) [-1168.642] * (-1177.872) [-1167.953] (-1174.111) (-1170.641) -- 0:00:51 Average standard deviation of split frequencies: 0.018591 175500 -- (-1169.964) [-1168.350] (-1172.626) (-1168.660) * (-1170.247) (-1168.414) [-1171.656] (-1171.876) -- 0:00:51 176000 -- [-1167.865] (-1170.164) (-1170.609) (-1168.305) * (-1172.694) [-1168.276] (-1168.516) (-1172.866) -- 0:00:51 176500 -- (-1170.621) [-1170.968] (-1169.734) (-1169.775) * (-1173.710) (-1168.071) (-1169.071) [-1170.118] -- 0:00:51 177000 -- (-1172.748) [-1170.347] (-1171.062) (-1174.229) * (-1174.759) (-1169.243) [-1170.324] (-1170.371) -- 0:00:51 177500 -- (-1171.136) [-1171.281] (-1171.743) (-1170.162) * (-1169.333) [-1170.673] (-1169.707) (-1170.991) -- 0:00:50 178000 -- (-1172.156) [-1170.836] (-1170.581) (-1169.277) * [-1168.458] (-1168.243) (-1176.737) (-1169.572) -- 0:00:50 178500 -- (-1169.860) [-1170.827] (-1170.865) (-1169.878) * [-1171.515] (-1168.055) (-1172.088) (-1169.740) -- 0:00:50 179000 -- (-1171.772) [-1169.631] (-1171.860) (-1168.536) * (-1172.147) [-1168.264] (-1169.028) (-1170.792) -- 0:00:50 179500 -- [-1168.432] (-1174.945) (-1170.553) (-1169.838) * (-1168.855) [-1168.190] (-1169.665) (-1169.540) -- 0:00:50 180000 -- (-1168.135) (-1172.932) (-1169.954) [-1168.330] * (-1169.602) [-1168.507] (-1168.395) (-1168.456) -- 0:00:50 Average standard deviation of split frequencies: 0.020567 180500 -- (-1168.628) (-1171.671) [-1170.074] (-1167.856) * (-1169.417) [-1168.897] (-1170.444) (-1169.531) -- 0:00:49 181000 -- [-1168.724] (-1171.516) (-1174.200) (-1168.749) * (-1169.247) [-1170.392] (-1168.668) (-1171.722) -- 0:00:49 181500 -- (-1168.430) (-1172.057) [-1169.163] (-1167.859) * [-1168.899] (-1168.295) (-1169.075) (-1169.514) -- 0:00:49 182000 -- (-1168.735) (-1172.213) (-1169.992) [-1169.066] * (-1170.362) (-1168.869) [-1167.966] (-1169.545) -- 0:00:49 182500 -- [-1169.631] (-1169.717) (-1171.864) (-1170.884) * [-1172.168] (-1171.285) (-1169.230) (-1171.021) -- 0:00:49 183000 -- (-1168.285) (-1169.135) [-1171.033] (-1171.914) * (-1170.067) (-1174.415) (-1168.514) [-1169.080] -- 0:00:49 183500 -- (-1168.308) [-1168.996] (-1171.173) (-1168.834) * (-1168.969) (-1172.132) (-1167.876) [-1169.073] -- 0:00:53 184000 -- (-1168.749) (-1168.077) [-1170.364] (-1168.834) * (-1169.722) [-1171.984] (-1170.820) (-1169.526) -- 0:00:53 184500 -- (-1170.375) (-1173.205) (-1171.584) [-1168.609] * (-1170.512) (-1171.786) [-1171.573] (-1170.345) -- 0:00:53 185000 -- (-1173.551) (-1170.695) [-1170.140] (-1172.358) * (-1170.225) (-1169.774) [-1172.126] (-1168.912) -- 0:00:52 Average standard deviation of split frequencies: 0.020275 185500 -- [-1169.164] (-1170.978) (-1168.863) (-1174.808) * (-1171.553) [-1169.626] (-1175.642) (-1168.270) -- 0:00:52 186000 -- (-1168.067) [-1169.226] (-1168.100) (-1168.671) * (-1172.829) [-1169.978] (-1173.683) (-1169.993) -- 0:00:52 186500 -- (-1169.429) (-1169.298) [-1168.152] (-1171.677) * (-1178.982) [-1170.284] (-1171.702) (-1172.088) -- 0:00:52 187000 -- (-1171.955) (-1173.165) (-1168.709) [-1171.435] * (-1174.542) (-1168.390) (-1169.628) [-1169.079] -- 0:00:52 187500 -- (-1171.277) [-1173.775] (-1174.482) (-1169.573) * (-1169.536) [-1171.253] (-1170.977) (-1168.955) -- 0:00:52 188000 -- [-1173.239] (-1174.111) (-1169.582) (-1168.888) * [-1170.079] (-1168.248) (-1172.473) (-1170.957) -- 0:00:51 188500 -- [-1169.700] (-1172.222) (-1171.910) (-1170.182) * [-1170.589] (-1168.190) (-1169.010) (-1171.409) -- 0:00:51 189000 -- (-1174.324) (-1172.779) (-1169.880) [-1169.341] * (-1173.081) (-1171.155) [-1170.932] (-1175.185) -- 0:00:51 189500 -- [-1168.947] (-1174.111) (-1174.715) (-1173.472) * [-1172.807] (-1169.475) (-1169.115) (-1172.596) -- 0:00:51 190000 -- (-1170.697) [-1175.287] (-1171.532) (-1171.835) * (-1176.920) (-1171.045) [-1168.326] (-1169.537) -- 0:00:51 Average standard deviation of split frequencies: 0.019052 190500 -- (-1168.812) (-1173.499) (-1173.563) [-1168.884] * (-1169.593) (-1171.142) [-1167.836] (-1172.781) -- 0:00:50 191000 -- (-1171.988) [-1170.261] (-1172.973) (-1169.629) * (-1169.525) [-1168.739] (-1169.294) (-1171.283) -- 0:00:50 191500 -- (-1168.207) [-1168.771] (-1171.913) (-1168.087) * (-1171.434) [-1169.973] (-1170.333) (-1173.217) -- 0:00:50 192000 -- (-1168.814) (-1170.033) [-1168.734] (-1168.833) * (-1173.207) (-1170.272) [-1168.182] (-1172.383) -- 0:00:50 192500 -- (-1169.578) [-1172.376] (-1170.766) (-1171.480) * (-1170.262) (-1168.219) [-1168.247] (-1170.646) -- 0:00:50 193000 -- [-1169.429] (-1169.788) (-1168.541) (-1173.051) * (-1170.003) (-1168.476) (-1168.923) [-1172.050] -- 0:00:50 193500 -- (-1169.359) [-1170.435] (-1169.133) (-1172.924) * (-1169.057) [-1169.400] (-1169.583) (-1170.070) -- 0:00:50 194000 -- (-1169.189) [-1169.222] (-1170.283) (-1172.288) * (-1169.935) (-1174.256) [-1172.223] (-1170.109) -- 0:00:49 194500 -- (-1168.483) (-1169.374) [-1169.513] (-1170.011) * [-1169.685] (-1169.363) (-1172.243) (-1172.419) -- 0:00:49 195000 -- (-1168.491) [-1168.903] (-1169.313) (-1173.047) * (-1169.402) (-1169.983) (-1171.933) [-1171.867] -- 0:00:49 Average standard deviation of split frequencies: 0.018439 195500 -- (-1168.225) [-1170.868] (-1169.524) (-1168.619) * [-1169.212] (-1169.777) (-1169.587) (-1170.091) -- 0:00:49 196000 -- [-1169.204] (-1169.087) (-1169.067) (-1171.548) * (-1171.467) (-1176.488) (-1171.427) [-1170.616] -- 0:00:49 196500 -- [-1167.956] (-1168.486) (-1169.474) (-1170.860) * (-1172.201) (-1169.088) (-1170.952) [-1169.193] -- 0:00:49 197000 -- [-1168.536] (-1173.787) (-1169.280) (-1169.479) * [-1170.943] (-1169.481) (-1171.587) (-1169.343) -- 0:00:48 197500 -- [-1168.430] (-1172.479) (-1174.731) (-1173.586) * (-1170.627) (-1169.319) (-1169.080) [-1168.963] -- 0:00:48 198000 -- (-1168.431) (-1172.499) (-1172.794) [-1169.922] * (-1171.279) (-1169.246) (-1169.030) [-1169.042] -- 0:00:48 198500 -- (-1168.379) (-1169.107) (-1169.946) [-1169.542] * (-1168.616) [-1168.618] (-1170.179) (-1168.673) -- 0:00:48 199000 -- (-1174.169) (-1169.101) [-1170.507] (-1170.858) * [-1168.851] (-1169.043) (-1173.037) (-1171.546) -- 0:00:48 199500 -- (-1170.977) (-1171.561) (-1171.142) [-1169.766] * (-1169.710) (-1170.491) (-1171.778) [-1168.470] -- 0:00:52 200000 -- (-1170.026) [-1169.072] (-1169.693) (-1171.280) * (-1169.545) (-1171.460) (-1169.941) [-1168.492] -- 0:00:51 Average standard deviation of split frequencies: 0.018402 200500 -- (-1171.547) [-1169.876] (-1169.998) (-1168.437) * (-1170.880) [-1171.457] (-1170.217) (-1172.953) -- 0:00:51 201000 -- (-1170.848) (-1169.190) (-1169.286) [-1169.449] * (-1170.223) (-1168.514) [-1169.224] (-1173.325) -- 0:00:51 201500 -- (-1170.177) [-1172.571] (-1169.328) (-1172.184) * (-1169.345) (-1170.779) (-1169.581) [-1170.921] -- 0:00:51 202000 -- (-1168.871) (-1173.049) (-1173.463) [-1169.827] * (-1171.834) (-1169.815) (-1170.542) [-1169.982] -- 0:00:51 202500 -- (-1171.904) [-1171.734] (-1170.445) (-1170.680) * (-1168.574) [-1167.828] (-1170.999) (-1169.965) -- 0:00:51 203000 -- [-1171.529] (-1167.846) (-1173.756) (-1176.251) * (-1173.807) (-1168.379) [-1172.037] (-1170.584) -- 0:00:51 203500 -- [-1170.053] (-1168.110) (-1169.230) (-1170.114) * (-1172.426) (-1172.033) [-1171.494] (-1170.576) -- 0:00:50 204000 -- (-1170.452) (-1169.207) (-1170.367) [-1168.372] * [-1173.695] (-1170.718) (-1171.422) (-1172.065) -- 0:00:50 204500 -- (-1168.353) [-1168.452] (-1170.963) (-1168.870) * (-1168.813) (-1169.654) (-1168.724) [-1168.988] -- 0:00:50 205000 -- (-1167.738) (-1169.873) (-1174.234) [-1168.879] * (-1170.445) [-1169.281] (-1169.355) (-1171.664) -- 0:00:50 Average standard deviation of split frequencies: 0.017926 205500 -- [-1168.559] (-1168.502) (-1173.812) (-1168.878) * [-1168.325] (-1171.992) (-1168.101) (-1170.164) -- 0:00:50 206000 -- (-1169.017) [-1168.214] (-1170.535) (-1169.347) * [-1168.905] (-1170.408) (-1168.003) (-1169.663) -- 0:00:50 206500 -- [-1173.393] (-1168.557) (-1169.649) (-1170.873) * (-1168.608) (-1173.392) [-1168.289] (-1169.460) -- 0:00:49 207000 -- (-1172.487) [-1169.468] (-1170.952) (-1171.308) * (-1173.462) (-1168.746) [-1169.889] (-1170.358) -- 0:00:49 207500 -- [-1173.400] (-1170.630) (-1169.172) (-1168.875) * [-1168.156] (-1170.292) (-1172.474) (-1169.085) -- 0:00:49 208000 -- (-1170.915) (-1170.448) [-1169.730] (-1168.851) * (-1170.475) (-1170.400) (-1171.774) [-1172.987] -- 0:00:49 208500 -- (-1169.245) (-1170.219) [-1169.479] (-1169.605) * (-1173.787) [-1170.342] (-1169.788) (-1173.261) -- 0:00:49 209000 -- (-1172.798) [-1171.918] (-1168.792) (-1169.863) * (-1172.258) [-1170.188] (-1170.150) (-1168.963) -- 0:00:49 209500 -- [-1169.397] (-1171.155) (-1169.841) (-1172.374) * [-1174.200] (-1169.839) (-1169.053) (-1169.499) -- 0:00:49 210000 -- (-1169.219) (-1172.261) [-1172.119] (-1169.124) * [-1169.954] (-1169.961) (-1169.934) (-1171.603) -- 0:00:48 Average standard deviation of split frequencies: 0.017313 210500 -- [-1168.975] (-1169.096) (-1171.107) (-1170.640) * [-1170.278] (-1169.050) (-1170.861) (-1172.709) -- 0:00:48 211000 -- [-1168.852] (-1169.449) (-1171.383) (-1171.522) * (-1168.657) [-1168.409] (-1170.107) (-1169.051) -- 0:00:48 211500 -- (-1170.231) (-1169.445) [-1171.915] (-1169.246) * (-1171.307) (-1171.382) (-1168.598) [-1169.789] -- 0:00:48 212000 -- [-1168.596] (-1169.445) (-1169.043) (-1169.907) * (-1170.452) (-1169.956) [-1168.887] (-1168.854) -- 0:00:48 212500 -- (-1169.277) (-1168.978) (-1174.038) [-1168.426] * (-1168.716) [-1168.148] (-1169.346) (-1170.012) -- 0:00:48 213000 -- (-1170.422) [-1168.191] (-1172.012) (-1171.109) * (-1171.917) [-1173.741] (-1172.656) (-1170.067) -- 0:00:48 213500 -- (-1171.249) (-1168.165) [-1171.083] (-1170.551) * (-1170.850) (-1172.172) (-1173.261) [-1173.586] -- 0:00:47 214000 -- (-1168.662) (-1170.215) (-1170.936) [-1170.948] * [-1168.485] (-1169.084) (-1169.628) (-1173.461) -- 0:00:47 214500 -- (-1170.720) (-1169.795) (-1171.900) [-1169.391] * [-1169.296] (-1168.415) (-1170.184) (-1170.531) -- 0:00:47 215000 -- (-1169.473) (-1171.731) [-1172.770] (-1168.473) * [-1169.123] (-1169.483) (-1173.431) (-1172.282) -- 0:00:47 Average standard deviation of split frequencies: 0.018493 215500 -- [-1169.480] (-1170.821) (-1171.756) (-1168.117) * (-1172.570) (-1172.087) (-1170.009) [-1169.268] -- 0:00:50 216000 -- (-1169.392) (-1170.124) [-1171.067] (-1170.963) * [-1170.609] (-1171.981) (-1170.294) (-1169.072) -- 0:00:50 216500 -- (-1170.386) (-1168.593) [-1169.726] (-1171.674) * (-1170.679) (-1168.843) [-1171.155] (-1170.786) -- 0:00:50 217000 -- (-1170.872) (-1171.874) (-1170.138) [-1170.556] * [-1171.517] (-1168.843) (-1171.556) (-1169.329) -- 0:00:50 217500 -- [-1169.946] (-1170.179) (-1172.643) (-1170.162) * [-1171.311] (-1169.525) (-1170.522) (-1169.003) -- 0:00:50 218000 -- [-1170.052] (-1168.928) (-1170.237) (-1169.605) * (-1174.604) (-1172.826) (-1175.188) [-1169.593] -- 0:00:50 218500 -- (-1169.762) (-1169.541) (-1169.520) [-1169.557] * (-1170.660) (-1169.359) (-1174.054) [-1168.469] -- 0:00:50 219000 -- (-1169.415) [-1169.539] (-1168.670) (-1171.587) * (-1172.491) (-1169.093) (-1173.408) [-1170.754] -- 0:00:49 219500 -- [-1170.616] (-1168.575) (-1169.986) (-1168.137) * (-1171.845) (-1170.658) (-1172.902) [-1172.504] -- 0:00:49 220000 -- (-1169.467) (-1169.561) (-1169.468) [-1168.909] * (-1172.055) (-1169.958) (-1171.850) [-1169.983] -- 0:00:49 Average standard deviation of split frequencies: 0.019583 220500 -- (-1169.457) (-1171.970) [-1170.125] (-1169.062) * (-1171.517) [-1168.089] (-1172.090) (-1174.099) -- 0:00:49 221000 -- (-1168.449) [-1169.937] (-1168.877) (-1170.351) * [-1170.693] (-1168.211) (-1170.037) (-1174.205) -- 0:00:49 221500 -- (-1169.378) (-1171.894) [-1169.843] (-1169.959) * [-1169.060] (-1168.147) (-1169.975) (-1172.169) -- 0:00:49 222000 -- (-1170.978) (-1169.955) [-1168.902] (-1170.808) * (-1169.764) (-1169.045) [-1169.937] (-1176.466) -- 0:00:49 222500 -- (-1168.098) (-1169.955) (-1169.657) [-1172.051] * [-1170.607] (-1168.704) (-1170.805) (-1169.034) -- 0:00:48 223000 -- (-1169.033) (-1171.349) (-1169.003) [-1168.087] * (-1170.263) (-1170.193) (-1172.343) [-1169.908] -- 0:00:48 223500 -- (-1172.582) (-1168.892) [-1169.132] (-1168.440) * (-1169.964) [-1171.225] (-1169.888) (-1168.681) -- 0:00:48 224000 -- (-1170.670) (-1168.179) (-1173.878) [-1168.946] * (-1174.354) (-1170.559) (-1171.463) [-1168.635] -- 0:00:48 224500 -- (-1171.194) (-1168.991) (-1178.287) [-1170.633] * [-1174.038] (-1170.084) (-1168.654) (-1170.922) -- 0:00:48 225000 -- (-1169.752) [-1170.775] (-1171.016) (-1169.815) * (-1170.939) (-1173.427) (-1169.388) [-1172.357] -- 0:00:48 Average standard deviation of split frequencies: 0.019816 225500 -- [-1168.253] (-1171.796) (-1172.096) (-1171.445) * (-1170.760) [-1168.955] (-1168.025) (-1170.007) -- 0:00:48 226000 -- (-1172.941) (-1172.734) (-1173.184) [-1170.241] * (-1169.399) (-1168.950) [-1168.087] (-1169.670) -- 0:00:47 226500 -- [-1172.317] (-1170.737) (-1176.846) (-1170.349) * (-1170.554) (-1171.433) (-1168.086) [-1169.506] -- 0:00:47 227000 -- (-1168.588) [-1167.860] (-1168.588) (-1173.381) * (-1170.595) [-1169.716] (-1167.892) (-1171.023) -- 0:00:47 227500 -- [-1168.850] (-1169.277) (-1171.493) (-1173.701) * (-1169.620) (-1171.286) (-1174.640) [-1169.613] -- 0:00:47 228000 -- [-1168.976] (-1171.111) (-1170.393) (-1167.749) * [-1168.898] (-1168.866) (-1173.115) (-1167.895) -- 0:00:47 228500 -- (-1171.808) (-1171.159) [-1171.059] (-1168.201) * [-1169.480] (-1169.071) (-1167.770) (-1168.234) -- 0:00:47 229000 -- [-1172.553] (-1170.618) (-1171.632) (-1169.318) * (-1170.415) (-1168.608) (-1173.922) [-1168.458] -- 0:00:47 229500 -- (-1170.126) [-1169.479] (-1169.278) (-1167.950) * (-1168.753) (-1169.647) (-1170.198) [-1168.183] -- 0:00:47 230000 -- [-1171.012] (-1170.281) (-1169.159) (-1169.146) * (-1168.774) [-1169.110] (-1170.253) (-1170.784) -- 0:00:46 Average standard deviation of split frequencies: 0.019721 230500 -- (-1170.351) (-1169.104) [-1168.900] (-1168.417) * (-1168.562) (-1171.556) (-1172.450) [-1170.274] -- 0:00:46 231000 -- [-1174.739] (-1169.775) (-1169.185) (-1170.757) * (-1169.824) (-1171.459) [-1172.161] (-1168.102) -- 0:00:46 231500 -- (-1168.799) (-1170.670) (-1168.300) [-1171.563] * (-1169.140) (-1171.513) [-1170.801] (-1169.088) -- 0:00:49 232000 -- (-1170.511) [-1169.144] (-1171.104) (-1170.866) * [-1169.307] (-1171.686) (-1174.489) (-1169.287) -- 0:00:49 232500 -- (-1172.581) (-1169.824) (-1170.203) [-1171.719] * (-1169.408) [-1170.001] (-1171.101) (-1174.107) -- 0:00:49 233000 -- (-1172.933) (-1171.708) (-1170.223) [-1172.489] * (-1171.349) (-1171.483) (-1168.871) [-1169.216] -- 0:00:49 233500 -- [-1170.725] (-1171.875) (-1170.031) (-1169.839) * [-1170.495] (-1169.537) (-1168.817) (-1171.106) -- 0:00:49 234000 -- [-1169.786] (-1170.722) (-1168.860) (-1169.453) * [-1170.302] (-1172.462) (-1169.943) (-1169.694) -- 0:00:49 234500 -- (-1169.659) (-1170.333) (-1169.524) [-1169.794] * [-1168.969] (-1169.427) (-1170.641) (-1170.469) -- 0:00:48 235000 -- (-1168.922) (-1177.041) [-1168.757] (-1169.724) * (-1169.436) [-1168.976] (-1171.335) (-1170.592) -- 0:00:48 Average standard deviation of split frequencies: 0.019575 235500 -- (-1169.256) (-1171.239) (-1168.766) [-1168.956] * (-1170.308) (-1173.208) (-1171.534) [-1170.181] -- 0:00:48 236000 -- (-1176.536) [-1169.622] (-1168.778) (-1171.733) * (-1169.366) (-1173.122) (-1168.974) [-1169.985] -- 0:00:48 236500 -- (-1170.770) [-1169.353] (-1171.275) (-1172.288) * (-1171.990) [-1169.032] (-1175.052) (-1175.396) -- 0:00:48 237000 -- (-1171.048) (-1169.987) (-1169.392) [-1169.236] * [-1171.115] (-1169.032) (-1172.840) (-1177.813) -- 0:00:48 237500 -- (-1170.184) [-1169.651] (-1171.047) (-1168.408) * (-1169.793) (-1169.024) (-1174.602) [-1170.780] -- 0:00:48 238000 -- [-1168.423] (-1172.540) (-1170.113) (-1167.951) * (-1168.892) (-1170.650) (-1167.641) [-1170.790] -- 0:00:48 238500 -- [-1167.706] (-1173.257) (-1172.293) (-1169.104) * (-1168.459) [-1170.280] (-1168.889) (-1174.187) -- 0:00:47 239000 -- (-1170.961) (-1169.352) (-1168.208) [-1167.962] * (-1170.654) [-1169.982] (-1172.434) (-1171.852) -- 0:00:47 239500 -- (-1172.316) (-1168.962) (-1168.262) [-1167.924] * (-1168.279) [-1169.706] (-1169.974) (-1174.455) -- 0:00:47 240000 -- (-1170.399) (-1174.459) (-1173.923) [-1171.311] * (-1169.001) (-1169.644) [-1168.116] (-1174.600) -- 0:00:47 Average standard deviation of split frequencies: 0.018804 240500 -- [-1170.284] (-1170.753) (-1171.815) (-1168.811) * (-1168.245) (-1170.978) [-1169.034] (-1171.807) -- 0:00:47 241000 -- (-1169.276) (-1170.156) [-1168.547] (-1168.635) * (-1169.501) (-1170.007) (-1170.307) [-1168.725] -- 0:00:47 241500 -- (-1169.218) (-1169.869) (-1171.666) [-1167.786] * (-1170.161) [-1169.468] (-1170.040) (-1168.838) -- 0:00:47 242000 -- [-1168.445] (-1168.534) (-1169.099) (-1169.402) * (-1171.870) (-1173.838) (-1169.349) [-1173.781] -- 0:00:46 242500 -- [-1168.740] (-1168.534) (-1170.404) (-1168.158) * (-1174.742) [-1170.785] (-1170.709) (-1170.958) -- 0:00:46 243000 -- (-1168.650) [-1168.550] (-1170.763) (-1167.866) * (-1173.009) (-1171.754) [-1173.946] (-1168.538) -- 0:00:46 243500 -- [-1169.944] (-1169.796) (-1170.809) (-1167.872) * (-1171.836) [-1169.503] (-1174.708) (-1168.041) -- 0:00:46 244000 -- [-1170.198] (-1171.046) (-1171.156) (-1168.346) * (-1171.783) [-1170.514] (-1171.474) (-1169.213) -- 0:00:46 244500 -- (-1168.297) (-1169.705) (-1173.563) [-1167.822] * (-1169.437) [-1169.467] (-1172.670) (-1168.429) -- 0:00:46 245000 -- (-1169.310) (-1169.067) (-1170.914) [-1170.125] * (-1168.948) (-1176.118) [-1175.025] (-1169.007) -- 0:00:46 Average standard deviation of split frequencies: 0.019546 245500 -- (-1170.264) (-1168.733) (-1171.309) [-1169.423] * (-1177.250) [-1169.969] (-1174.286) (-1168.266) -- 0:00:46 246000 -- (-1170.904) (-1167.994) [-1168.322] (-1171.295) * [-1171.095] (-1168.647) (-1173.739) (-1170.374) -- 0:00:45 246500 -- (-1168.552) (-1175.021) [-1168.023] (-1168.958) * (-1168.187) (-1169.460) [-1171.567] (-1168.993) -- 0:00:45 247000 -- (-1168.539) (-1173.568) [-1170.725] (-1169.595) * [-1171.775] (-1174.230) (-1167.895) (-1169.293) -- 0:00:45 247500 -- (-1168.751) (-1173.621) (-1170.169) [-1169.459] * (-1172.171) [-1169.701] (-1172.749) (-1168.666) -- 0:00:45 248000 -- [-1169.018] (-1171.573) (-1169.405) (-1170.503) * [-1171.542] (-1172.976) (-1171.972) (-1168.092) -- 0:00:48 248500 -- (-1168.410) (-1170.386) [-1171.493] (-1172.206) * (-1170.295) (-1170.775) (-1169.313) [-1171.427] -- 0:00:48 249000 -- [-1171.404] (-1169.449) (-1170.035) (-1169.298) * (-1170.480) (-1168.240) (-1171.249) [-1175.428] -- 0:00:48 249500 -- (-1169.751) [-1170.274] (-1178.069) (-1171.259) * (-1170.625) (-1170.907) [-1168.726] (-1168.740) -- 0:00:48 250000 -- [-1169.976] (-1168.844) (-1169.723) (-1169.218) * (-1172.558) (-1169.815) [-1168.151] (-1168.350) -- 0:00:48 Average standard deviation of split frequencies: 0.020028 250500 -- (-1169.673) (-1170.112) (-1169.243) [-1168.346] * [-1171.167] (-1171.777) (-1168.605) (-1170.441) -- 0:00:47 251000 -- (-1169.142) (-1168.159) [-1169.275] (-1167.909) * (-1169.015) (-1170.680) (-1171.024) [-1174.746] -- 0:00:47 251500 -- (-1169.176) (-1168.924) (-1168.529) [-1170.061] * (-1169.327) (-1172.097) [-1169.242] (-1170.461) -- 0:00:47 252000 -- [-1171.143] (-1170.372) (-1168.223) (-1171.092) * (-1172.507) [-1170.133] (-1169.668) (-1172.525) -- 0:00:47 252500 -- [-1168.229] (-1170.677) (-1170.217) (-1168.509) * (-1172.724) (-1169.771) (-1168.903) [-1169.329] -- 0:00:47 253000 -- (-1168.148) [-1170.786] (-1170.520) (-1174.360) * [-1169.855] (-1169.663) (-1170.836) (-1170.407) -- 0:00:47 253500 -- (-1169.491) (-1170.961) [-1168.852] (-1168.654) * (-1170.423) (-1169.560) [-1170.600] (-1170.776) -- 0:00:47 254000 -- [-1167.872] (-1170.383) (-1170.502) (-1168.879) * (-1170.398) [-1169.945] (-1175.106) (-1174.098) -- 0:00:46 254500 -- [-1168.256] (-1171.054) (-1169.520) (-1170.744) * (-1170.853) [-1168.639] (-1171.857) (-1169.852) -- 0:00:46 255000 -- (-1175.892) (-1169.160) (-1169.784) [-1168.183] * [-1169.904] (-1169.383) (-1173.272) (-1170.074) -- 0:00:46 Average standard deviation of split frequencies: 0.019519 255500 -- (-1169.950) (-1170.547) (-1170.521) [-1168.804] * (-1172.550) (-1169.512) (-1171.413) [-1168.968] -- 0:00:46 256000 -- (-1171.885) (-1170.714) [-1170.691] (-1171.156) * [-1170.389] (-1169.479) (-1170.858) (-1169.889) -- 0:00:46 256500 -- (-1170.757) (-1169.099) [-1170.296] (-1170.745) * [-1167.827] (-1169.382) (-1172.576) (-1167.989) -- 0:00:46 257000 -- (-1173.300) [-1168.607] (-1170.261) (-1169.937) * (-1168.034) [-1169.156] (-1169.725) (-1169.072) -- 0:00:46 257500 -- (-1170.792) (-1168.494) (-1170.410) [-1171.594] * (-1169.462) (-1172.954) [-1169.609] (-1169.076) -- 0:00:46 258000 -- (-1172.489) (-1168.581) [-1170.192] (-1172.490) * (-1169.833) (-1174.217) [-1170.554] (-1170.615) -- 0:00:46 258500 -- (-1171.128) (-1169.699) (-1168.774) [-1169.310] * (-1173.202) [-1172.762] (-1171.462) (-1170.858) -- 0:00:45 259000 -- (-1171.000) (-1168.512) [-1169.870] (-1169.379) * [-1171.068] (-1169.029) (-1169.503) (-1169.188) -- 0:00:45 259500 -- [-1171.200] (-1168.240) (-1170.333) (-1177.431) * [-1169.067] (-1169.449) (-1168.784) (-1171.488) -- 0:00:45 260000 -- (-1178.465) (-1168.242) (-1170.345) [-1171.968] * (-1169.271) (-1168.420) [-1168.201] (-1168.917) -- 0:00:45 Average standard deviation of split frequencies: 0.017323 260500 -- (-1178.609) (-1167.754) [-1172.670] (-1170.807) * (-1171.571) (-1169.701) [-1168.199] (-1168.507) -- 0:00:45 261000 -- (-1169.930) (-1171.220) (-1170.431) [-1171.216] * (-1169.828) (-1170.193) [-1170.488] (-1168.667) -- 0:00:45 261500 -- (-1171.857) (-1171.223) [-1171.474] (-1171.058) * (-1172.958) (-1168.763) [-1169.791] (-1168.303) -- 0:00:45 262000 -- [-1169.476] (-1168.821) (-1169.447) (-1174.742) * (-1169.131) (-1168.712) [-1169.654] (-1170.287) -- 0:00:45 262500 -- (-1168.870) (-1169.536) (-1169.836) [-1175.450] * (-1171.735) [-1168.552] (-1171.361) (-1170.076) -- 0:00:44 263000 -- (-1167.912) [-1168.597] (-1173.053) (-1169.646) * [-1169.163] (-1169.029) (-1169.385) (-1173.159) -- 0:00:44 263500 -- (-1170.122) [-1169.248] (-1171.258) (-1170.477) * (-1169.206) (-1169.267) [-1170.903] (-1170.376) -- 0:00:44 264000 -- [-1170.321] (-1168.891) (-1170.294) (-1169.493) * [-1169.857] (-1169.414) (-1172.022) (-1172.692) -- 0:00:44 264500 -- (-1168.593) [-1172.600] (-1173.002) (-1168.327) * (-1169.571) (-1170.538) (-1172.843) [-1169.751] -- 0:00:47 265000 -- (-1168.267) [-1168.023] (-1176.327) (-1170.672) * [-1170.908] (-1172.038) (-1171.818) (-1168.933) -- 0:00:47 Average standard deviation of split frequencies: 0.016481 265500 -- [-1169.758] (-1171.521) (-1170.245) (-1174.068) * (-1168.600) [-1170.458] (-1169.298) (-1168.609) -- 0:00:47 266000 -- (-1168.412) (-1171.935) [-1169.853] (-1172.212) * (-1168.553) (-1170.376) (-1169.449) [-1169.545] -- 0:00:46 266500 -- (-1168.157) (-1168.841) [-1168.683] (-1168.272) * (-1170.595) (-1167.608) (-1169.721) [-1172.302] -- 0:00:46 267000 -- (-1169.802) [-1168.986] (-1168.696) (-1168.389) * (-1168.400) [-1168.514] (-1168.243) (-1170.750) -- 0:00:46 267500 -- (-1169.640) [-1168.234] (-1169.303) (-1173.919) * (-1169.077) (-1169.190) (-1173.633) [-1171.322] -- 0:00:46 268000 -- (-1171.799) [-1171.270] (-1169.878) (-1169.537) * [-1168.469] (-1169.996) (-1170.612) (-1171.017) -- 0:00:46 268500 -- (-1168.865) (-1168.584) (-1169.686) [-1170.488] * [-1172.513] (-1172.022) (-1170.967) (-1170.364) -- 0:00:46 269000 -- (-1168.740) (-1173.140) (-1169.591) [-1172.511] * (-1172.028) (-1170.907) (-1170.913) [-1168.651] -- 0:00:46 269500 -- (-1168.124) (-1173.506) (-1170.646) [-1169.775] * [-1168.954] (-1173.089) (-1170.074) (-1170.408) -- 0:00:46 270000 -- (-1168.514) (-1171.138) (-1171.788) [-1170.230] * [-1168.800] (-1170.571) (-1172.579) (-1169.097) -- 0:00:45 Average standard deviation of split frequencies: 0.016408 270500 -- (-1169.805) (-1168.871) (-1172.716) [-1170.107] * [-1169.155] (-1170.661) (-1168.667) (-1173.984) -- 0:00:45 271000 -- (-1168.903) (-1168.188) (-1170.145) [-1168.880] * (-1169.137) [-1168.709] (-1169.275) (-1172.480) -- 0:00:45 271500 -- [-1171.157] (-1168.884) (-1172.025) (-1168.816) * (-1171.692) (-1175.206) (-1171.794) [-1170.087] -- 0:00:45 272000 -- (-1169.927) (-1168.215) [-1169.712] (-1169.211) * (-1173.563) (-1173.644) [-1174.216] (-1170.550) -- 0:00:45 272500 -- (-1172.021) (-1168.441) (-1170.331) [-1169.266] * (-1172.128) (-1169.559) (-1172.614) [-1168.982] -- 0:00:45 273000 -- (-1170.604) (-1169.313) (-1171.258) [-1168.972] * (-1171.345) [-1170.529] (-1173.657) (-1170.583) -- 0:00:45 273500 -- (-1170.845) (-1169.550) (-1172.416) [-1169.039] * (-1171.835) (-1172.228) (-1174.413) [-1171.254] -- 0:00:45 274000 -- (-1171.040) [-1170.359] (-1173.733) (-1172.116) * (-1171.652) (-1169.675) (-1169.861) [-1171.587] -- 0:00:45 274500 -- [-1169.464] (-1171.351) (-1169.592) (-1169.777) * (-1170.339) [-1171.793] (-1169.674) (-1176.840) -- 0:00:44 275000 -- (-1168.285) [-1171.798] (-1169.230) (-1169.968) * (-1170.521) [-1169.835] (-1170.666) (-1173.664) -- 0:00:44 Average standard deviation of split frequencies: 0.016416 275500 -- [-1169.051] (-1172.791) (-1169.612) (-1174.804) * (-1169.665) (-1169.220) [-1169.615] (-1172.102) -- 0:00:44 276000 -- (-1167.970) (-1171.664) [-1168.425] (-1168.810) * (-1171.053) [-1171.596] (-1172.134) (-1168.855) -- 0:00:44 276500 -- (-1168.069) [-1170.950] (-1168.636) (-1168.091) * [-1170.608] (-1171.649) (-1172.433) (-1170.447) -- 0:00:44 277000 -- [-1168.265] (-1172.259) (-1168.702) (-1168.215) * (-1170.746) (-1171.131) [-1172.269] (-1173.837) -- 0:00:44 277500 -- (-1169.329) (-1171.512) [-1168.925] (-1168.789) * [-1169.595] (-1169.575) (-1168.874) (-1172.020) -- 0:00:44 278000 -- (-1169.461) (-1171.119) [-1170.266] (-1169.277) * (-1168.333) (-1171.062) [-1170.869] (-1169.858) -- 0:00:44 278500 -- [-1168.666] (-1170.557) (-1167.747) (-1168.648) * [-1171.164] (-1172.311) (-1173.056) (-1171.713) -- 0:00:44 279000 -- (-1168.628) (-1169.203) (-1168.432) [-1168.522] * (-1168.127) (-1168.633) (-1174.394) [-1172.418] -- 0:00:43 279500 -- [-1172.254] (-1169.509) (-1168.749) (-1169.587) * (-1173.905) (-1171.769) [-1173.918] (-1168.875) -- 0:00:43 280000 -- (-1169.191) (-1169.401) [-1168.417] (-1174.349) * (-1170.975) (-1169.205) (-1172.200) [-1168.787] -- 0:00:43 Average standard deviation of split frequencies: 0.016423 280500 -- (-1169.086) (-1169.059) (-1169.263) [-1169.814] * (-1170.996) (-1173.210) (-1175.507) [-1168.548] -- 0:00:43 281000 -- [-1169.141] (-1168.629) (-1168.733) (-1169.860) * [-1173.369] (-1171.330) (-1173.308) (-1168.827) -- 0:00:46 281500 -- [-1168.505] (-1171.276) (-1169.239) (-1171.143) * (-1174.717) (-1171.093) [-1169.227] (-1172.243) -- 0:00:45 282000 -- [-1169.774] (-1170.436) (-1168.576) (-1171.642) * (-1170.396) (-1169.546) (-1170.390) [-1168.057] -- 0:00:45 282500 -- [-1169.626] (-1170.716) (-1170.151) (-1169.215) * (-1169.556) [-1168.761] (-1169.337) (-1170.719) -- 0:00:45 283000 -- (-1171.801) (-1169.982) [-1167.844] (-1173.068) * (-1169.156) [-1168.544] (-1168.366) (-1170.376) -- 0:00:45 283500 -- (-1170.407) [-1169.789] (-1168.984) (-1170.423) * [-1173.310] (-1170.951) (-1169.692) (-1170.636) -- 0:00:45 284000 -- [-1171.627] (-1171.727) (-1171.365) (-1172.444) * [-1170.841] (-1172.124) (-1169.312) (-1170.411) -- 0:00:45 284500 -- (-1176.116) (-1171.458) [-1169.434] (-1171.719) * (-1171.555) (-1168.544) [-1169.236] (-1170.979) -- 0:00:45 285000 -- [-1171.325] (-1170.088) (-1171.579) (-1172.117) * (-1170.367) [-1171.163] (-1177.040) (-1170.807) -- 0:00:45 Average standard deviation of split frequencies: 0.015355 285500 -- (-1171.401) [-1170.184] (-1169.525) (-1173.203) * (-1171.376) (-1170.662) [-1174.224] (-1173.781) -- 0:00:45 286000 -- [-1170.182] (-1170.295) (-1170.596) (-1169.488) * (-1168.497) (-1172.827) (-1173.273) [-1169.548] -- 0:00:44 286500 -- (-1168.539) (-1171.017) (-1170.598) [-1169.892] * (-1168.346) [-1176.085] (-1170.312) (-1168.503) -- 0:00:44 287000 -- (-1169.247) (-1169.731) [-1169.044] (-1169.948) * [-1168.723] (-1175.118) (-1173.832) (-1168.093) -- 0:00:44 287500 -- (-1168.035) (-1168.983) (-1169.187) [-1169.558] * (-1169.038) (-1170.887) (-1169.870) [-1173.820] -- 0:00:44 288000 -- (-1172.635) (-1168.382) [-1168.388] (-1169.404) * (-1171.224) (-1172.310) [-1169.350] (-1169.680) -- 0:00:44 288500 -- (-1170.705) [-1171.290] (-1169.732) (-1170.059) * [-1171.530] (-1168.964) (-1171.009) (-1170.534) -- 0:00:44 289000 -- [-1172.315] (-1170.591) (-1173.996) (-1168.737) * (-1169.020) (-1169.548) (-1171.188) [-1168.022] -- 0:00:44 289500 -- (-1173.125) (-1169.256) (-1171.499) [-1169.313] * (-1172.228) [-1169.012] (-1172.319) (-1169.432) -- 0:00:44 290000 -- (-1170.650) (-1169.686) (-1168.687) [-1169.126] * (-1172.095) [-1172.368] (-1170.248) (-1169.780) -- 0:00:44 Average standard deviation of split frequencies: 0.015194 290500 -- (-1169.341) [-1168.367] (-1169.491) (-1169.688) * [-1167.964] (-1172.721) (-1168.139) (-1168.225) -- 0:00:43 291000 -- [-1169.892] (-1169.713) (-1173.241) (-1176.980) * [-1168.884] (-1169.963) (-1169.607) (-1169.839) -- 0:00:43 291500 -- (-1169.151) (-1170.884) [-1171.460] (-1170.377) * (-1169.797) (-1172.349) [-1168.724] (-1169.783) -- 0:00:43 292000 -- [-1169.413] (-1169.141) (-1170.988) (-1168.610) * (-1170.544) [-1171.405] (-1170.340) (-1177.831) -- 0:00:43 292500 -- (-1170.231) [-1169.506] (-1171.082) (-1169.949) * [-1169.513] (-1170.269) (-1170.218) (-1170.729) -- 0:00:43 293000 -- (-1174.384) (-1168.376) [-1170.341] (-1168.064) * (-1170.296) (-1169.937) [-1169.809] (-1168.561) -- 0:00:43 293500 -- (-1168.889) (-1168.170) (-1169.227) [-1169.250] * [-1170.829] (-1168.907) (-1169.828) (-1169.158) -- 0:00:43 294000 -- (-1169.480) [-1171.547] (-1169.417) (-1169.289) * (-1170.115) (-1170.144) (-1170.495) [-1171.295] -- 0:00:43 294500 -- (-1172.158) (-1171.281) (-1168.239) [-1171.014] * (-1169.555) (-1168.394) (-1171.969) [-1176.972] -- 0:00:43 295000 -- (-1171.515) (-1168.461) [-1169.533] (-1168.869) * [-1176.865] (-1167.860) (-1173.214) (-1176.397) -- 0:00:43 Average standard deviation of split frequencies: 0.015004 295500 -- (-1168.901) (-1169.056) [-1168.400] (-1171.172) * [-1170.014] (-1168.921) (-1169.487) (-1171.964) -- 0:00:42 296000 -- (-1169.539) (-1170.300) [-1167.982] (-1169.980) * (-1169.470) [-1169.389] (-1168.880) (-1172.586) -- 0:00:42 296500 -- (-1172.453) (-1172.306) (-1167.982) [-1169.033] * (-1175.230) [-1167.736] (-1172.592) (-1171.479) -- 0:00:42 297000 -- (-1169.883) (-1171.574) (-1174.153) [-1169.008] * [-1169.710] (-1168.377) (-1180.624) (-1171.087) -- 0:00:44 297500 -- (-1170.424) (-1170.528) [-1172.456] (-1169.550) * (-1168.992) (-1171.245) (-1174.635) [-1171.205] -- 0:00:44 298000 -- (-1170.768) (-1169.010) [-1169.940] (-1169.025) * (-1168.144) [-1170.861] (-1170.036) (-1170.584) -- 0:00:44 298500 -- [-1169.012] (-1175.311) (-1172.399) (-1171.742) * (-1169.538) (-1171.365) (-1170.421) [-1169.569] -- 0:00:44 299000 -- [-1173.729] (-1170.013) (-1169.529) (-1169.464) * (-1168.991) (-1171.016) (-1169.694) [-1168.342] -- 0:00:44 299500 -- [-1168.588] (-1169.863) (-1168.008) (-1169.488) * (-1168.973) [-1173.656] (-1170.897) (-1170.961) -- 0:00:44 300000 -- (-1171.425) (-1171.613) (-1169.877) [-1169.277] * (-1173.310) (-1171.935) [-1168.458] (-1171.918) -- 0:00:44 Average standard deviation of split frequencies: 0.015330 300500 -- [-1170.935] (-1168.844) (-1172.059) (-1170.574) * (-1170.911) [-1170.212] (-1169.589) (-1172.910) -- 0:00:44 301000 -- (-1172.087) (-1168.386) (-1168.431) [-1169.998] * (-1169.396) (-1172.421) [-1169.820] (-1169.725) -- 0:00:44 301500 -- (-1169.662) [-1168.890] (-1172.836) (-1169.450) * (-1168.488) [-1173.996] (-1167.900) (-1173.751) -- 0:00:44 302000 -- (-1168.508) [-1168.150] (-1173.202) (-1168.942) * [-1168.583] (-1176.432) (-1167.979) (-1170.719) -- 0:00:43 302500 -- (-1168.810) (-1169.333) (-1172.974) [-1172.198] * [-1169.069] (-1178.060) (-1168.811) (-1172.674) -- 0:00:43 303000 -- [-1169.751] (-1170.494) (-1170.639) (-1171.184) * (-1174.154) (-1174.627) (-1168.860) [-1171.579] -- 0:00:43 303500 -- (-1170.913) (-1170.889) [-1170.562] (-1171.410) * (-1172.988) (-1170.145) (-1169.601) [-1171.338] -- 0:00:43 304000 -- (-1172.189) (-1171.256) [-1170.104] (-1171.949) * [-1172.123] (-1170.505) (-1171.106) (-1172.506) -- 0:00:43 304500 -- [-1169.465] (-1171.701) (-1167.950) (-1171.839) * (-1168.883) (-1172.104) [-1171.631] (-1171.949) -- 0:00:43 305000 -- (-1169.113) [-1170.252] (-1168.010) (-1169.622) * (-1171.517) [-1168.457] (-1172.061) (-1169.326) -- 0:00:43 Average standard deviation of split frequencies: 0.014432 305500 -- (-1168.756) [-1169.587] (-1168.174) (-1168.211) * (-1168.277) [-1168.564] (-1172.301) (-1170.178) -- 0:00:43 306000 -- (-1172.885) (-1170.006) (-1168.707) [-1169.133] * [-1168.412] (-1168.701) (-1171.871) (-1169.352) -- 0:00:43 306500 -- (-1170.691) (-1169.924) (-1169.895) [-1174.106] * [-1168.628] (-1169.751) (-1172.541) (-1168.180) -- 0:00:42 307000 -- (-1168.598) [-1169.206] (-1171.849) (-1183.463) * [-1170.881] (-1169.606) (-1173.005) (-1168.917) -- 0:00:42 307500 -- (-1171.296) [-1168.321] (-1169.536) (-1171.176) * [-1171.447] (-1168.470) (-1175.310) (-1169.616) -- 0:00:42 308000 -- (-1170.522) [-1169.606] (-1169.194) (-1171.201) * [-1171.749] (-1169.472) (-1172.732) (-1173.110) -- 0:00:42 308500 -- (-1170.489) (-1169.246) (-1169.124) [-1170.103] * [-1169.075] (-1169.855) (-1171.791) (-1172.663) -- 0:00:42 309000 -- (-1169.317) [-1170.453] (-1168.998) (-1168.331) * (-1169.683) [-1171.511] (-1173.484) (-1169.515) -- 0:00:42 309500 -- (-1173.158) (-1170.440) (-1172.187) [-1168.329] * (-1170.178) (-1170.079) [-1171.765] (-1169.902) -- 0:00:42 310000 -- (-1174.888) [-1170.283] (-1173.791) (-1170.461) * [-1174.771] (-1172.370) (-1175.306) (-1169.872) -- 0:00:42 Average standard deviation of split frequencies: 0.014295 310500 -- [-1170.624] (-1173.175) (-1171.337) (-1168.894) * (-1171.988) [-1172.590] (-1170.140) (-1168.791) -- 0:00:42 311000 -- [-1169.233] (-1168.189) (-1169.163) (-1168.786) * [-1169.759] (-1171.407) (-1172.376) (-1168.807) -- 0:00:42 311500 -- (-1170.432) (-1169.289) (-1169.390) [-1171.022] * (-1171.661) (-1171.220) (-1171.688) [-1169.280] -- 0:00:41 312000 -- (-1171.615) (-1169.653) [-1171.035] (-1170.767) * [-1171.247] (-1170.318) (-1174.816) (-1168.928) -- 0:00:41 312500 -- [-1169.375] (-1169.498) (-1170.484) (-1169.400) * (-1169.204) (-1170.448) (-1171.275) [-1169.108] -- 0:00:41 313000 -- (-1168.637) (-1169.172) (-1170.370) [-1170.446] * (-1169.630) [-1170.193] (-1170.570) (-1171.873) -- 0:00:43 313500 -- [-1168.661] (-1168.422) (-1170.022) (-1171.361) * [-1170.781] (-1168.573) (-1171.703) (-1171.648) -- 0:00:43 314000 -- (-1169.686) (-1168.945) [-1170.005] (-1171.334) * (-1170.588) (-1169.148) (-1172.464) [-1170.899] -- 0:00:43 314500 -- [-1171.859] (-1168.939) (-1170.216) (-1171.112) * (-1168.905) (-1169.967) [-1170.448] (-1170.466) -- 0:00:43 315000 -- (-1171.127) (-1167.852) [-1168.923] (-1170.893) * (-1168.142) [-1170.959] (-1172.049) (-1168.583) -- 0:00:43 Average standard deviation of split frequencies: 0.014503 315500 -- (-1174.400) (-1168.664) (-1168.055) [-1169.694] * [-1168.152] (-1169.552) (-1169.544) (-1171.028) -- 0:00:43 316000 -- [-1172.509] (-1168.769) (-1167.843) (-1172.232) * [-1169.095] (-1170.428) (-1171.613) (-1171.694) -- 0:00:43 316500 -- (-1174.473) (-1168.948) [-1167.967] (-1173.757) * (-1169.013) (-1170.286) (-1171.781) [-1169.858] -- 0:00:43 317000 -- (-1169.745) [-1170.818] (-1169.701) (-1168.802) * (-1172.273) (-1168.971) (-1172.426) [-1172.310] -- 0:00:43 317500 -- (-1171.358) [-1170.611] (-1170.899) (-1168.902) * (-1173.689) [-1169.033] (-1171.117) (-1173.068) -- 0:00:42 318000 -- (-1171.220) (-1169.862) (-1168.075) [-1169.173] * (-1167.694) [-1170.759] (-1171.168) (-1168.401) -- 0:00:42 318500 -- (-1170.189) (-1171.237) [-1168.594] (-1169.173) * (-1169.396) [-1170.662] (-1170.489) (-1168.762) -- 0:00:42 319000 -- (-1172.725) (-1170.304) (-1169.397) [-1169.212] * [-1170.664] (-1168.710) (-1170.276) (-1167.988) -- 0:00:42 319500 -- (-1171.716) (-1169.301) [-1169.366] (-1171.309) * (-1168.327) (-1168.584) [-1167.948] (-1167.777) -- 0:00:42 320000 -- (-1173.589) [-1172.038] (-1168.830) (-1170.557) * (-1168.265) [-1171.076] (-1171.564) (-1169.361) -- 0:00:42 Average standard deviation of split frequencies: 0.013394 320500 -- (-1169.498) [-1169.654] (-1170.167) (-1171.534) * (-1168.293) [-1168.475] (-1171.785) (-1169.508) -- 0:00:42 321000 -- (-1170.878) (-1170.992) (-1169.177) [-1170.014] * [-1170.323] (-1172.912) (-1171.261) (-1170.201) -- 0:00:42 321500 -- (-1178.430) (-1173.723) (-1171.514) [-1170.426] * (-1168.715) (-1170.759) [-1169.152] (-1169.650) -- 0:00:42 322000 -- (-1177.427) [-1172.719] (-1172.374) (-1168.604) * (-1168.383) (-1169.954) [-1171.185] (-1170.099) -- 0:00:42 322500 -- (-1168.170) (-1171.144) [-1169.720] (-1170.861) * [-1167.941] (-1169.676) (-1169.779) (-1170.234) -- 0:00:42 323000 -- (-1169.251) (-1170.907) [-1170.603] (-1170.217) * (-1168.513) (-1170.083) [-1168.484] (-1170.902) -- 0:00:41 323500 -- (-1171.476) [-1171.350] (-1168.891) (-1174.435) * (-1170.843) (-1170.551) (-1172.064) [-1169.994] -- 0:00:41 324000 -- (-1169.951) (-1175.051) (-1171.278) [-1170.842] * (-1171.339) (-1168.385) (-1171.658) [-1173.115] -- 0:00:41 324500 -- (-1168.476) [-1171.365] (-1169.402) (-1171.780) * (-1176.808) [-1169.733] (-1176.124) (-1173.602) -- 0:00:41 325000 -- (-1169.134) (-1169.758) (-1168.922) [-1170.115] * [-1170.567] (-1180.936) (-1168.069) (-1170.971) -- 0:00:41 Average standard deviation of split frequencies: 0.013336 325500 -- (-1168.582) (-1168.754) (-1169.421) [-1170.826] * (-1171.302) (-1174.922) [-1168.973] (-1170.927) -- 0:00:41 326000 -- (-1168.101) (-1168.779) [-1169.467] (-1172.332) * (-1176.175) (-1169.720) (-1168.269) [-1169.134] -- 0:00:41 326500 -- (-1169.368) (-1170.611) (-1170.593) [-1170.618] * (-1172.431) [-1168.037] (-1167.877) (-1168.179) -- 0:00:41 327000 -- (-1169.843) (-1168.889) (-1169.581) [-1170.021] * (-1171.134) [-1168.194] (-1168.223) (-1168.336) -- 0:00:41 327500 -- (-1170.630) (-1168.368) [-1169.633] (-1171.419) * [-1169.672] (-1169.126) (-1175.539) (-1169.327) -- 0:00:41 328000 -- (-1169.213) [-1169.637] (-1169.633) (-1172.742) * (-1168.980) (-1170.094) (-1168.899) [-1168.749] -- 0:00:40 328500 -- (-1172.326) (-1168.209) [-1168.366] (-1170.909) * [-1170.000] (-1168.423) (-1169.066) (-1168.463) -- 0:00:40 329000 -- (-1169.420) (-1169.703) [-1168.356] (-1170.995) * (-1169.841) [-1169.667] (-1171.686) (-1168.334) -- 0:00:42 329500 -- (-1173.052) [-1169.387] (-1174.209) (-1170.718) * (-1173.561) (-1168.413) (-1172.926) [-1169.420] -- 0:00:42 330000 -- (-1174.371) [-1169.221] (-1169.331) (-1169.607) * [-1168.682] (-1167.883) (-1169.739) (-1171.859) -- 0:00:42 Average standard deviation of split frequencies: 0.013656 330500 -- (-1176.572) [-1167.923] (-1171.533) (-1170.741) * (-1169.482) [-1170.761] (-1170.817) (-1172.244) -- 0:00:42 331000 -- (-1173.642) (-1169.124) (-1174.382) [-1168.801] * (-1169.979) (-1168.159) [-1171.297] (-1173.578) -- 0:00:42 331500 -- (-1169.254) [-1169.328] (-1168.799) (-1170.467) * (-1168.872) [-1168.944] (-1171.621) (-1169.868) -- 0:00:42 332000 -- (-1169.658) (-1170.029) (-1171.375) [-1169.993] * (-1168.536) (-1169.047) [-1171.414] (-1171.558) -- 0:00:42 332500 -- (-1169.492) (-1169.805) (-1170.274) [-1171.204] * (-1169.221) (-1169.964) (-1172.764) [-1171.886] -- 0:00:42 333000 -- (-1169.585) (-1169.726) [-1168.202] (-1170.251) * [-1174.871] (-1172.595) (-1171.034) (-1171.265) -- 0:00:42 333500 -- (-1168.600) (-1174.033) [-1168.887] (-1171.340) * (-1174.262) [-1169.019] (-1173.391) (-1171.571) -- 0:00:41 334000 -- [-1170.735] (-1168.599) (-1169.789) (-1171.311) * (-1173.704) [-1169.383] (-1170.857) (-1171.206) -- 0:00:41 334500 -- (-1169.902) [-1169.091] (-1168.984) (-1170.004) * (-1170.308) (-1171.271) [-1167.945] (-1171.531) -- 0:00:41 335000 -- (-1168.061) [-1169.547] (-1171.048) (-1171.284) * (-1174.087) (-1168.457) (-1171.080) [-1168.132] -- 0:00:41 Average standard deviation of split frequencies: 0.014186 335500 -- (-1169.177) [-1169.724] (-1172.371) (-1171.563) * [-1170.880] (-1174.080) (-1171.220) (-1171.713) -- 0:00:41 336000 -- (-1169.712) (-1167.831) (-1168.903) [-1169.232] * (-1171.645) (-1170.619) (-1172.073) [-1169.064] -- 0:00:41 336500 -- (-1168.623) (-1170.105) [-1168.174] (-1169.280) * (-1170.065) (-1169.632) [-1169.053] (-1170.307) -- 0:00:41 337000 -- (-1169.356) (-1171.277) [-1168.309] (-1169.117) * (-1169.863) (-1169.792) [-1169.698] (-1168.968) -- 0:00:41 337500 -- (-1168.455) [-1170.311] (-1170.397) (-1168.552) * (-1168.999) [-1170.326] (-1170.937) (-1168.062) -- 0:00:41 338000 -- (-1169.478) (-1170.212) [-1169.509] (-1169.996) * (-1170.105) (-1170.884) (-1169.703) [-1169.918] -- 0:00:41 338500 -- [-1172.747] (-1168.529) (-1170.996) (-1175.164) * (-1171.115) (-1173.420) (-1175.447) [-1169.786] -- 0:00:41 339000 -- (-1170.270) (-1170.785) (-1171.244) [-1171.474] * (-1170.355) [-1174.784] (-1170.388) (-1173.468) -- 0:00:40 339500 -- [-1171.023] (-1174.901) (-1170.506) (-1168.424) * (-1171.408) (-1171.327) (-1171.322) [-1170.953] -- 0:00:40 340000 -- (-1169.738) (-1174.117) [-1171.058] (-1170.148) * (-1171.178) (-1171.303) (-1172.444) [-1171.458] -- 0:00:40 Average standard deviation of split frequencies: 0.015059 340500 -- (-1170.031) (-1170.097) (-1170.127) [-1168.432] * (-1170.294) (-1170.859) [-1168.917] (-1169.352) -- 0:00:40 341000 -- (-1169.177) (-1170.895) [-1168.201] (-1169.665) * (-1170.250) (-1170.015) [-1169.007] (-1171.358) -- 0:00:40 341500 -- [-1168.617] (-1171.353) (-1175.027) (-1168.444) * [-1171.551] (-1168.214) (-1171.736) (-1170.347) -- 0:00:40 342000 -- (-1168.671) (-1171.151) [-1168.223] (-1168.931) * (-1168.383) [-1169.097] (-1168.948) (-1169.018) -- 0:00:40 342500 -- (-1168.513) (-1170.278) [-1168.865] (-1167.870) * (-1167.868) (-1169.694) (-1169.077) [-1170.233] -- 0:00:40 343000 -- (-1168.548) [-1171.562] (-1172.886) (-1169.128) * (-1168.713) [-1169.296] (-1169.909) (-1168.566) -- 0:00:40 343500 -- (-1168.619) (-1172.560) (-1173.305) [-1169.632] * (-1172.998) (-1168.324) (-1170.052) [-1169.491] -- 0:00:40 344000 -- (-1168.292) (-1171.862) [-1170.341] (-1168.606) * (-1172.652) [-1171.356] (-1178.016) (-1173.923) -- 0:00:40 344500 -- (-1168.326) [-1172.104] (-1169.680) (-1173.474) * [-1169.570] (-1171.399) (-1174.245) (-1175.728) -- 0:00:39 345000 -- (-1169.593) [-1170.408] (-1168.179) (-1169.101) * [-1168.083] (-1170.681) (-1172.210) (-1172.859) -- 0:00:41 Average standard deviation of split frequencies: 0.014827 345500 -- (-1171.774) (-1169.391) [-1170.771] (-1170.733) * (-1168.223) [-1169.897] (-1169.218) (-1169.818) -- 0:00:41 346000 -- [-1173.710] (-1169.076) (-1176.469) (-1170.264) * (-1170.268) (-1169.729) [-1168.101] (-1171.370) -- 0:00:41 346500 -- (-1170.465) [-1169.025] (-1168.765) (-1170.238) * (-1170.049) [-1169.285] (-1169.949) (-1168.554) -- 0:00:41 347000 -- [-1168.971] (-1168.982) (-1169.577) (-1172.548) * (-1171.648) [-1169.433] (-1172.066) (-1168.185) -- 0:00:41 347500 -- [-1173.026] (-1171.446) (-1175.302) (-1175.067) * (-1171.571) (-1173.415) [-1174.946] (-1169.444) -- 0:00:41 348000 -- [-1172.846] (-1169.573) (-1176.873) (-1170.311) * [-1169.295] (-1172.584) (-1168.919) (-1171.483) -- 0:00:41 348500 -- (-1171.371) (-1170.111) (-1178.260) [-1171.586] * (-1170.426) [-1170.556] (-1169.243) (-1169.897) -- 0:00:41 349000 -- (-1172.133) [-1169.088] (-1170.065) (-1171.242) * (-1168.249) (-1170.881) (-1168.170) [-1169.660] -- 0:00:41 349500 -- [-1168.938] (-1168.700) (-1171.672) (-1172.121) * (-1167.848) (-1171.602) [-1168.213] (-1169.049) -- 0:00:40 350000 -- [-1168.471] (-1173.428) (-1171.185) (-1169.930) * (-1171.970) [-1170.693] (-1170.337) (-1171.982) -- 0:00:40 Average standard deviation of split frequencies: 0.014313 350500 -- (-1169.369) (-1170.254) [-1170.865] (-1169.996) * (-1170.314) [-1170.767] (-1170.539) (-1168.943) -- 0:00:40 351000 -- (-1168.949) (-1171.772) [-1174.476] (-1169.735) * (-1171.313) [-1170.097] (-1169.165) (-1169.829) -- 0:00:40 351500 -- (-1171.278) (-1173.035) (-1175.275) [-1170.229] * (-1170.707) [-1170.750] (-1171.342) (-1168.582) -- 0:00:40 352000 -- (-1169.278) [-1168.829] (-1174.034) (-1173.870) * [-1168.797] (-1169.684) (-1169.122) (-1168.708) -- 0:00:40 352500 -- (-1170.929) [-1169.967] (-1170.809) (-1172.509) * (-1168.793) (-1169.557) (-1169.878) [-1170.681] -- 0:00:40 353000 -- (-1169.568) (-1170.109) [-1169.762] (-1170.854) * (-1169.042) (-1170.232) [-1170.415] (-1169.131) -- 0:00:40 353500 -- [-1167.674] (-1169.704) (-1168.955) (-1169.550) * (-1169.402) (-1170.289) (-1169.645) [-1169.500] -- 0:00:40 354000 -- (-1168.916) [-1170.317] (-1169.599) (-1170.138) * (-1171.894) (-1175.014) (-1169.752) [-1169.863] -- 0:00:40 354500 -- [-1169.743] (-1173.128) (-1169.473) (-1171.750) * [-1170.260] (-1173.940) (-1170.136) (-1171.737) -- 0:00:40 355000 -- (-1174.398) (-1170.593) [-1170.486] (-1170.032) * [-1169.636] (-1174.044) (-1171.536) (-1171.150) -- 0:00:39 Average standard deviation of split frequencies: 0.013787 355500 -- (-1168.772) (-1171.022) (-1171.525) [-1168.811] * [-1170.806] (-1169.165) (-1170.235) (-1173.263) -- 0:00:39 356000 -- [-1168.225] (-1174.620) (-1170.265) (-1172.181) * (-1171.897) (-1168.171) [-1171.824] (-1171.688) -- 0:00:39 356500 -- (-1172.403) (-1169.539) (-1170.602) [-1169.708] * (-1169.498) [-1169.159] (-1172.443) (-1170.959) -- 0:00:39 357000 -- (-1171.491) [-1169.134] (-1169.640) (-1173.356) * (-1174.915) [-1168.859] (-1171.903) (-1169.697) -- 0:00:39 357500 -- [-1170.804] (-1171.671) (-1168.592) (-1170.009) * (-1169.542) (-1169.061) [-1169.544] (-1172.133) -- 0:00:39 358000 -- (-1169.295) [-1171.216] (-1168.963) (-1169.354) * (-1175.191) [-1169.586] (-1169.181) (-1169.608) -- 0:00:39 358500 -- [-1170.009] (-1171.242) (-1175.864) (-1169.353) * (-1169.757) (-1168.537) (-1168.300) [-1168.186] -- 0:00:39 359000 -- (-1172.034) [-1169.799] (-1173.882) (-1168.972) * (-1171.794) (-1168.112) [-1171.572] (-1168.998) -- 0:00:39 359500 -- [-1168.987] (-1170.491) (-1174.773) (-1168.976) * [-1169.060] (-1171.235) (-1170.289) (-1170.354) -- 0:00:39 360000 -- (-1169.213) [-1169.480] (-1176.406) (-1169.542) * [-1170.072] (-1171.242) (-1167.837) (-1168.105) -- 0:00:39 Average standard deviation of split frequencies: 0.012589 360500 -- (-1169.570) (-1171.258) (-1174.019) [-1170.572] * (-1169.273) (-1172.612) (-1170.785) [-1168.220] -- 0:00:39 361000 -- (-1168.933) (-1170.518) (-1172.448) [-1171.219] * (-1168.686) [-1173.362] (-1168.202) (-1171.501) -- 0:00:40 361500 -- [-1174.573] (-1172.644) (-1170.710) (-1168.600) * [-1169.318] (-1170.818) (-1169.427) (-1169.541) -- 0:00:40 362000 -- (-1174.747) (-1168.017) [-1169.813] (-1169.571) * (-1169.720) [-1170.906] (-1169.565) (-1170.285) -- 0:00:40 362500 -- (-1170.582) [-1171.070] (-1169.443) (-1172.125) * [-1169.541] (-1169.997) (-1170.592) (-1172.887) -- 0:00:40 363000 -- (-1169.504) (-1169.993) (-1173.901) [-1169.472] * (-1173.179) (-1170.198) (-1173.493) [-1170.981] -- 0:00:40 363500 -- [-1171.601] (-1171.107) (-1172.278) (-1169.898) * (-1169.307) (-1169.812) (-1174.955) [-1170.050] -- 0:00:40 364000 -- (-1168.311) (-1174.594) (-1175.421) [-1169.103] * (-1170.064) [-1173.362] (-1169.190) (-1169.783) -- 0:00:40 364500 -- (-1169.679) [-1171.501] (-1170.925) (-1169.029) * (-1170.110) (-1172.891) [-1170.873] (-1174.898) -- 0:00:40 365000 -- (-1169.019) (-1170.154) [-1171.809] (-1168.961) * (-1169.813) (-1173.431) [-1168.891] (-1169.178) -- 0:00:40 Average standard deviation of split frequencies: 0.012300 365500 -- (-1168.866) (-1171.788) [-1172.814] (-1168.425) * [-1169.790] (-1168.803) (-1170.926) (-1168.751) -- 0:00:39 366000 -- (-1169.340) [-1169.821] (-1173.949) (-1168.098) * [-1168.979] (-1169.940) (-1172.837) (-1168.124) -- 0:00:39 366500 -- [-1171.314] (-1169.820) (-1172.362) (-1168.176) * (-1172.354) (-1169.666) (-1168.760) [-1168.168] -- 0:00:39 367000 -- (-1170.228) [-1170.563] (-1175.422) (-1173.856) * (-1168.954) (-1169.495) (-1169.178) [-1168.103] -- 0:00:39 367500 -- [-1170.521] (-1169.344) (-1174.687) (-1172.294) * (-1172.119) (-1168.807) [-1168.308] (-1171.277) -- 0:00:39 368000 -- (-1168.824) (-1169.608) (-1174.445) [-1171.049] * (-1170.209) (-1171.273) [-1168.152] (-1168.702) -- 0:00:39 368500 -- [-1169.961] (-1169.729) (-1169.998) (-1169.777) * (-1172.693) (-1169.776) (-1170.915) [-1168.950] -- 0:00:39 369000 -- (-1172.760) (-1169.038) (-1168.302) [-1170.371] * (-1170.869) (-1171.465) [-1168.777] (-1168.953) -- 0:00:39 369500 -- (-1172.739) (-1169.009) (-1168.548) [-1169.276] * (-1171.900) (-1173.204) [-1170.639] (-1169.200) -- 0:00:39 370000 -- (-1175.093) (-1169.016) (-1172.123) [-1169.652] * [-1171.260] (-1173.591) (-1171.764) (-1169.479) -- 0:00:39 Average standard deviation of split frequencies: 0.012273 370500 -- (-1178.190) [-1170.069] (-1168.098) (-1169.849) * (-1169.768) (-1170.971) (-1169.409) [-1169.518] -- 0:00:39 371000 -- (-1173.043) [-1167.989] (-1169.701) (-1174.105) * (-1169.253) (-1171.372) [-1171.378] (-1168.934) -- 0:00:38 371500 -- (-1174.804) (-1169.050) (-1168.462) [-1170.528] * (-1169.683) [-1168.771] (-1170.059) (-1182.219) -- 0:00:38 372000 -- (-1170.003) (-1169.416) [-1171.076] (-1171.096) * (-1168.701) [-1170.384] (-1169.199) (-1182.156) -- 0:00:38 372500 -- (-1169.309) [-1171.533] (-1169.919) (-1170.034) * [-1172.854] (-1171.648) (-1172.802) (-1171.990) -- 0:00:38 373000 -- (-1169.437) (-1168.723) [-1170.384] (-1170.985) * [-1170.004] (-1173.163) (-1173.039) (-1173.204) -- 0:00:38 373500 -- (-1167.960) (-1168.866) [-1173.575] (-1168.455) * (-1171.922) (-1169.471) (-1174.054) [-1171.335] -- 0:00:38 374000 -- [-1168.588] (-1170.052) (-1173.211) (-1169.991) * (-1172.706) [-1173.274] (-1168.581) (-1171.117) -- 0:00:38 374500 -- [-1168.427] (-1170.798) (-1173.793) (-1170.816) * (-1169.041) [-1168.618] (-1168.841) (-1172.287) -- 0:00:38 375000 -- (-1170.111) (-1169.731) (-1168.931) [-1170.110] * [-1170.261] (-1172.470) (-1169.372) (-1169.361) -- 0:00:38 Average standard deviation of split frequencies: 0.012207 375500 -- (-1170.037) (-1180.780) [-1168.712] (-1169.154) * (-1168.717) [-1168.477] (-1170.026) (-1173.569) -- 0:00:38 376000 -- [-1170.645] (-1170.775) (-1170.483) (-1173.040) * [-1169.293] (-1172.276) (-1170.919) (-1172.617) -- 0:00:38 376500 -- (-1168.581) [-1173.357] (-1169.408) (-1177.612) * [-1170.340] (-1169.710) (-1171.684) (-1171.418) -- 0:00:38 377000 -- (-1168.633) (-1172.995) [-1167.946] (-1172.023) * (-1170.782) (-1170.927) (-1171.714) [-1169.774] -- 0:00:39 377500 -- (-1168.595) (-1169.541) (-1170.596) [-1168.651] * (-1171.188) [-1169.983] (-1172.491) (-1168.432) -- 0:00:39 378000 -- (-1170.106) [-1170.506] (-1170.387) (-1172.317) * (-1170.162) [-1170.450] (-1172.857) (-1168.500) -- 0:00:39 378500 -- (-1170.622) (-1175.718) [-1169.886] (-1171.871) * [-1173.489] (-1169.384) (-1171.872) (-1168.832) -- 0:00:39 379000 -- [-1169.058] (-1169.475) (-1168.818) (-1171.073) * (-1173.355) (-1168.774) [-1169.882] (-1171.885) -- 0:00:39 379500 -- (-1168.955) [-1174.240] (-1169.697) (-1168.609) * (-1168.474) (-1171.190) (-1169.364) [-1167.996] -- 0:00:39 380000 -- (-1169.165) (-1169.945) (-1171.366) [-1167.923] * (-1170.337) (-1170.657) (-1169.807) [-1171.369] -- 0:00:39 Average standard deviation of split frequencies: 0.011667 380500 -- (-1172.945) [-1170.110] (-1168.343) (-1170.457) * [-1169.499] (-1171.333) (-1171.532) (-1172.659) -- 0:00:39 381000 -- (-1171.233) (-1168.351) [-1168.387] (-1169.622) * (-1171.566) (-1169.990) (-1171.108) [-1169.169] -- 0:00:38 381500 -- (-1176.432) (-1170.167) (-1167.819) [-1169.992] * (-1168.149) [-1168.021] (-1169.428) (-1170.838) -- 0:00:38 382000 -- (-1170.294) (-1171.139) [-1169.147] (-1168.016) * [-1168.262] (-1168.697) (-1169.702) (-1169.659) -- 0:00:38 382500 -- (-1169.664) (-1168.981) [-1171.507] (-1170.894) * [-1169.700] (-1171.293) (-1169.853) (-1171.574) -- 0:00:38 383000 -- (-1170.445) (-1168.653) [-1171.597] (-1169.016) * (-1174.652) [-1169.382] (-1169.239) (-1171.638) -- 0:00:38 383500 -- (-1170.409) [-1168.166] (-1171.082) (-1169.022) * [-1170.003] (-1170.437) (-1169.907) (-1171.069) -- 0:00:38 384000 -- (-1174.498) [-1169.048] (-1168.699) (-1168.491) * (-1168.726) (-1167.977) [-1170.863] (-1170.561) -- 0:00:38 384500 -- (-1173.429) [-1170.417] (-1168.723) (-1170.648) * (-1170.045) (-1170.192) [-1169.369] (-1169.581) -- 0:00:38 385000 -- [-1169.521] (-1169.894) (-1170.990) (-1170.204) * (-1169.811) (-1171.938) [-1168.964] (-1172.579) -- 0:00:38 Average standard deviation of split frequencies: 0.011313 385500 -- (-1173.738) (-1170.658) [-1170.375] (-1173.211) * (-1170.089) (-1171.826) [-1171.397] (-1173.203) -- 0:00:38 386000 -- [-1173.104] (-1171.117) (-1170.397) (-1170.917) * (-1168.770) [-1169.130] (-1170.655) (-1172.194) -- 0:00:38 386500 -- (-1170.295) [-1168.752] (-1168.149) (-1169.353) * (-1170.218) (-1170.067) [-1170.275] (-1172.059) -- 0:00:38 387000 -- (-1170.675) (-1170.945) [-1168.131] (-1169.919) * [-1170.196] (-1170.733) (-1171.863) (-1171.010) -- 0:00:38 387500 -- (-1170.804) [-1170.600] (-1168.051) (-1170.828) * [-1169.922] (-1169.364) (-1172.021) (-1170.689) -- 0:00:37 388000 -- [-1169.890] (-1170.800) (-1168.890) (-1170.294) * (-1169.800) (-1169.669) [-1172.906] (-1170.752) -- 0:00:37 388500 -- (-1171.324) (-1171.978) (-1168.235) [-1170.063] * [-1169.228] (-1176.575) (-1170.816) (-1169.820) -- 0:00:37 389000 -- (-1171.660) [-1174.718] (-1170.309) (-1170.351) * (-1169.227) [-1169.303] (-1169.417) (-1168.569) -- 0:00:37 389500 -- [-1171.055] (-1174.455) (-1170.390) (-1172.210) * (-1169.228) (-1171.441) (-1169.583) [-1168.737] -- 0:00:37 390000 -- (-1170.867) (-1175.741) (-1172.167) [-1170.572] * (-1169.152) [-1171.696] (-1170.700) (-1170.994) -- 0:00:37 Average standard deviation of split frequencies: 0.012187 390500 -- (-1170.171) (-1170.266) [-1169.863] (-1170.129) * (-1169.836) (-1171.543) (-1170.016) [-1168.916] -- 0:00:37 391000 -- (-1168.756) (-1168.716) [-1170.705] (-1169.390) * (-1169.184) [-1171.564] (-1169.363) (-1171.270) -- 0:00:37 391500 -- (-1168.414) (-1171.953) [-1174.626] (-1170.873) * [-1174.708] (-1172.945) (-1173.762) (-1174.712) -- 0:00:37 392000 -- (-1170.749) (-1170.833) (-1175.116) [-1171.525] * (-1175.271) [-1169.661] (-1175.575) (-1169.389) -- 0:00:37 392500 -- (-1169.353) (-1170.928) [-1171.325] (-1170.659) * (-1171.731) (-1171.943) (-1170.280) [-1170.575] -- 0:00:37 393000 -- (-1171.527) (-1174.398) (-1172.829) [-1172.829] * (-1171.454) (-1169.663) [-1168.272] (-1169.405) -- 0:00:38 393500 -- (-1170.459) (-1172.172) (-1169.495) [-1169.402] * (-1170.325) (-1171.370) [-1168.436] (-1169.403) -- 0:00:38 394000 -- (-1168.696) [-1173.658] (-1168.295) (-1169.327) * (-1170.334) (-1168.348) (-1170.950) [-1170.719] -- 0:00:38 394500 -- [-1169.265] (-1174.234) (-1168.393) (-1169.328) * (-1170.980) (-1169.404) [-1171.298] (-1172.618) -- 0:00:38 395000 -- (-1170.327) (-1172.775) [-1170.866] (-1168.736) * (-1170.619) (-1169.404) [-1171.357] (-1169.133) -- 0:00:38 Average standard deviation of split frequencies: 0.012440 395500 -- (-1169.141) [-1169.465] (-1169.614) (-1172.185) * (-1171.117) (-1168.984) (-1168.847) [-1169.974] -- 0:00:38 396000 -- (-1173.323) (-1168.111) (-1169.563) [-1171.807] * (-1170.837) [-1168.624] (-1170.258) (-1167.916) -- 0:00:38 396500 -- (-1169.657) (-1170.680) (-1169.404) [-1170.752] * (-1169.357) [-1168.320] (-1173.368) (-1168.102) -- 0:00:38 397000 -- (-1169.676) (-1170.169) [-1168.107] (-1169.803) * [-1168.746] (-1167.717) (-1171.923) (-1168.883) -- 0:00:37 397500 -- [-1168.919] (-1172.424) (-1173.298) (-1169.892) * (-1169.902) (-1172.076) (-1174.636) [-1168.703] -- 0:00:37 398000 -- (-1167.887) [-1168.948] (-1173.041) (-1169.460) * [-1168.958] (-1172.467) (-1171.028) (-1168.674) -- 0:00:37 398500 -- (-1167.868) (-1171.576) [-1171.377] (-1169.906) * (-1168.530) (-1173.193) (-1170.554) [-1169.330] -- 0:00:37 399000 -- (-1167.656) (-1169.476) [-1168.177] (-1175.484) * (-1168.639) (-1171.286) [-1168.544] (-1169.502) -- 0:00:37 399500 -- (-1167.767) (-1170.496) [-1169.623] (-1171.865) * (-1170.874) [-1171.519] (-1173.274) (-1167.953) -- 0:00:37 400000 -- (-1167.762) [-1171.748] (-1167.932) (-1170.412) * [-1171.267] (-1173.122) (-1168.721) (-1167.941) -- 0:00:37 Average standard deviation of split frequencies: 0.012385 400500 -- (-1168.602) (-1169.879) (-1167.888) [-1170.434] * (-1169.652) [-1171.348] (-1168.723) (-1172.684) -- 0:00:37 401000 -- [-1170.456] (-1169.428) (-1169.323) (-1167.970) * (-1169.822) (-1169.441) [-1170.063] (-1172.077) -- 0:00:37 401500 -- (-1170.619) [-1171.523] (-1172.368) (-1168.286) * (-1168.976) [-1169.732] (-1170.420) (-1178.569) -- 0:00:37 402000 -- (-1169.141) (-1168.539) (-1169.592) [-1171.775] * [-1169.675] (-1170.239) (-1170.740) (-1172.566) -- 0:00:37 402500 -- (-1171.252) (-1170.065) (-1175.952) [-1170.151] * (-1169.018) (-1169.595) (-1170.731) [-1171.974] -- 0:00:37 403000 -- (-1173.341) (-1169.943) [-1170.921] (-1171.463) * (-1168.614) (-1171.025) [-1169.055] (-1170.226) -- 0:00:37 403500 -- (-1171.566) (-1170.491) (-1169.945) [-1169.828] * (-1168.435) [-1170.648] (-1171.133) (-1170.809) -- 0:00:36 404000 -- [-1172.257] (-1168.698) (-1169.793) (-1168.930) * (-1171.499) (-1172.448) [-1169.250] (-1168.738) -- 0:00:36 404500 -- (-1170.559) [-1169.929] (-1168.708) (-1168.466) * (-1169.081) [-1170.248] (-1168.630) (-1169.097) -- 0:00:36 405000 -- [-1169.885] (-1168.593) (-1170.871) (-1168.934) * (-1169.104) (-1170.463) (-1170.667) [-1169.711] -- 0:00:36 Average standard deviation of split frequencies: 0.013120 405500 -- (-1172.247) (-1170.338) [-1168.327] (-1168.469) * (-1168.084) (-1173.055) [-1168.536] (-1169.941) -- 0:00:36 406000 -- [-1170.258] (-1171.360) (-1168.361) (-1169.705) * (-1168.056) (-1172.963) (-1169.264) [-1170.558] -- 0:00:36 406500 -- (-1170.700) (-1173.365) (-1168.143) [-1168.623] * (-1170.672) (-1170.918) (-1169.223) [-1174.099] -- 0:00:36 407000 -- (-1176.558) [-1170.869] (-1169.304) (-1172.693) * [-1169.228] (-1171.244) (-1171.314) (-1171.747) -- 0:00:36 407500 -- (-1177.316) (-1171.387) (-1169.872) [-1171.937] * (-1168.476) (-1170.937) (-1171.445) [-1170.922] -- 0:00:36 408000 -- (-1170.818) (-1176.037) [-1170.434] (-1171.545) * (-1169.599) (-1171.123) [-1168.432] (-1169.259) -- 0:00:36 408500 -- [-1170.348] (-1171.297) (-1170.610) (-1174.888) * (-1171.979) [-1168.234] (-1168.478) (-1171.359) -- 0:00:36 409000 -- (-1173.247) (-1169.466) [-1171.245] (-1172.857) * (-1173.096) (-1169.105) (-1170.497) [-1171.172] -- 0:00:37 409500 -- (-1170.947) (-1170.077) (-1168.424) [-1168.452] * (-1171.891) (-1169.669) [-1170.421] (-1168.997) -- 0:00:37 410000 -- (-1169.145) [-1170.005] (-1168.764) (-1168.407) * (-1168.683) [-1170.820] (-1171.301) (-1170.237) -- 0:00:37 Average standard deviation of split frequencies: 0.012971 410500 -- (-1169.004) (-1171.136) [-1168.806] (-1172.064) * (-1169.124) (-1169.141) [-1168.258] (-1171.573) -- 0:00:37 411000 -- (-1170.040) (-1168.682) [-1171.622] (-1170.954) * (-1169.904) (-1169.437) [-1173.737] (-1173.509) -- 0:00:37 411500 -- (-1169.675) [-1169.567] (-1175.024) (-1171.212) * (-1171.237) [-1168.471] (-1168.771) (-1170.390) -- 0:00:37 412000 -- [-1167.878] (-1172.553) (-1172.215) (-1171.661) * [-1171.297] (-1169.748) (-1170.896) (-1172.215) -- 0:00:37 412500 -- (-1170.029) [-1168.536] (-1169.688) (-1171.182) * (-1177.097) (-1169.485) (-1171.669) [-1170.978] -- 0:00:37 413000 -- [-1168.054] (-1168.983) (-1173.528) (-1170.739) * [-1167.825] (-1169.428) (-1170.550) (-1169.606) -- 0:00:36 413500 -- (-1168.263) [-1168.960] (-1169.145) (-1172.895) * (-1168.484) [-1172.149] (-1175.119) (-1171.750) -- 0:00:36 414000 -- (-1169.707) [-1170.629] (-1170.457) (-1170.845) * (-1168.484) (-1171.193) [-1169.998] (-1171.307) -- 0:00:36 414500 -- (-1169.417) [-1170.541] (-1174.113) (-1173.457) * (-1169.408) (-1168.679) (-1169.503) [-1171.162] -- 0:00:36 415000 -- (-1170.869) (-1169.711) (-1170.242) [-1169.648] * (-1170.926) (-1169.602) [-1170.161] (-1170.592) -- 0:00:36 Average standard deviation of split frequencies: 0.012883 415500 -- (-1168.021) (-1171.000) [-1169.658] (-1169.724) * (-1169.370) (-1171.000) [-1168.635] (-1172.121) -- 0:00:36 416000 -- (-1171.458) (-1172.095) [-1171.812] (-1168.291) * (-1171.563) [-1169.428] (-1168.462) (-1172.057) -- 0:00:36 416500 -- (-1171.158) [-1171.685] (-1170.666) (-1168.039) * (-1172.453) [-1168.402] (-1170.624) (-1169.351) -- 0:00:36 417000 -- (-1170.131) [-1171.376] (-1170.666) (-1168.820) * (-1169.115) (-1168.860) (-1167.759) [-1169.162] -- 0:00:36 417500 -- (-1173.895) (-1168.459) (-1173.746) [-1168.673] * (-1170.389) (-1169.597) [-1171.058] (-1169.859) -- 0:00:36 418000 -- (-1171.138) (-1168.925) (-1169.212) [-1169.980] * (-1170.413) (-1171.510) (-1172.068) [-1169.167] -- 0:00:36 418500 -- (-1173.885) (-1170.919) [-1170.310] (-1172.396) * [-1168.726] (-1175.783) (-1173.155) (-1169.915) -- 0:00:36 419000 -- (-1176.539) (-1168.942) [-1172.753] (-1168.030) * (-1168.247) (-1171.777) (-1170.484) [-1170.549] -- 0:00:36 419500 -- (-1171.066) (-1168.563) [-1167.847] (-1168.596) * [-1172.181] (-1172.564) (-1167.857) (-1169.842) -- 0:00:35 420000 -- (-1169.427) (-1170.566) [-1168.632] (-1168.596) * (-1174.776) (-1171.654) [-1172.513] (-1168.304) -- 0:00:35 Average standard deviation of split frequencies: 0.012681 420500 -- [-1169.324] (-1170.390) (-1170.351) (-1168.595) * (-1173.759) [-1171.247] (-1171.135) (-1171.499) -- 0:00:35 421000 -- [-1169.383] (-1169.782) (-1171.979) (-1169.968) * [-1172.031] (-1169.380) (-1170.720) (-1169.382) -- 0:00:35 421500 -- [-1169.685] (-1175.271) (-1170.283) (-1169.917) * (-1169.933) (-1169.655) (-1169.109) [-1171.622] -- 0:00:35 422000 -- (-1169.127) (-1169.508) [-1170.735] (-1171.438) * [-1168.836] (-1172.479) (-1170.795) (-1167.738) -- 0:00:35 422500 -- (-1169.591) (-1170.581) [-1173.477] (-1172.532) * (-1170.251) (-1170.822) [-1167.939] (-1168.659) -- 0:00:35 423000 -- (-1172.622) (-1172.959) [-1169.241] (-1173.712) * (-1171.985) (-1169.748) [-1169.901] (-1168.063) -- 0:00:35 423500 -- (-1169.630) (-1171.683) (-1169.006) [-1169.038] * (-1172.547) (-1170.064) (-1170.375) [-1167.962] -- 0:00:35 424000 -- (-1168.041) (-1169.348) [-1170.516] (-1168.708) * (-1170.220) (-1170.959) [-1170.227] (-1169.906) -- 0:00:35 424500 -- (-1168.108) (-1167.720) [-1169.683] (-1171.658) * (-1169.383) (-1168.503) [-1169.343] (-1173.637) -- 0:00:35 425000 -- [-1167.919] (-1168.556) (-1172.304) (-1171.393) * (-1172.154) (-1170.273) [-1168.117] (-1170.187) -- 0:00:35 Average standard deviation of split frequencies: 0.012988 425500 -- (-1168.173) [-1167.720] (-1170.537) (-1168.639) * [-1168.298] (-1171.617) (-1170.275) (-1169.391) -- 0:00:36 426000 -- (-1168.843) (-1168.995) (-1168.580) [-1171.375] * (-1171.476) (-1175.700) [-1171.847] (-1169.287) -- 0:00:36 426500 -- (-1168.462) (-1170.625) (-1170.030) [-1169.402] * (-1170.188) (-1176.496) (-1173.964) [-1169.119] -- 0:00:36 427000 -- (-1168.280) [-1169.970] (-1172.279) (-1170.555) * (-1169.384) (-1173.584) (-1170.157) [-1170.733] -- 0:00:36 427500 -- (-1169.232) (-1169.599) (-1172.233) [-1169.024] * (-1170.652) [-1170.624] (-1170.596) (-1172.155) -- 0:00:36 428000 -- (-1172.949) [-1168.933] (-1171.868) (-1168.564) * (-1169.595) [-1172.710] (-1170.618) (-1171.543) -- 0:00:36 428500 -- (-1170.423) [-1169.286] (-1170.033) (-1170.130) * [-1168.134] (-1170.631) (-1171.857) (-1171.542) -- 0:00:36 429000 -- [-1169.081] (-1171.148) (-1170.228) (-1168.819) * (-1170.238) (-1170.556) (-1168.918) [-1172.908] -- 0:00:35 429500 -- (-1169.697) [-1169.724] (-1169.819) (-1169.275) * (-1170.188) (-1170.831) [-1178.101] (-1170.161) -- 0:00:35 430000 -- (-1170.323) (-1173.630) (-1168.216) [-1169.806] * [-1168.420] (-1171.414) (-1178.412) (-1168.115) -- 0:00:35 Average standard deviation of split frequencies: 0.013196 430500 -- (-1171.920) (-1171.999) (-1168.623) [-1171.342] * (-1168.645) (-1170.358) (-1172.982) [-1169.273] -- 0:00:35 431000 -- (-1171.804) (-1168.255) [-1168.043] (-1173.669) * [-1168.475] (-1173.059) (-1172.222) (-1168.807) -- 0:00:35 431500 -- (-1169.308) [-1168.466] (-1169.382) (-1172.067) * (-1170.050) (-1172.787) [-1171.183] (-1169.207) -- 0:00:35 432000 -- (-1169.846) (-1169.392) [-1169.768] (-1169.942) * (-1168.851) [-1171.308] (-1171.057) (-1168.295) -- 0:00:35 432500 -- [-1172.580] (-1168.234) (-1175.578) (-1168.270) * (-1172.277) (-1172.600) [-1170.978] (-1168.654) -- 0:00:35 433000 -- (-1171.288) [-1169.758] (-1172.084) (-1168.556) * (-1169.952) (-1173.517) (-1174.023) [-1168.829] -- 0:00:35 433500 -- (-1169.713) (-1169.630) (-1174.745) [-1167.936] * (-1174.110) [-1175.610] (-1171.861) (-1172.264) -- 0:00:35 434000 -- (-1169.560) [-1169.029] (-1170.578) (-1167.887) * [-1174.394] (-1170.531) (-1170.459) (-1168.059) -- 0:00:35 434500 -- [-1172.999] (-1168.081) (-1169.293) (-1169.538) * (-1172.293) [-1168.922] (-1169.550) (-1168.336) -- 0:00:35 435000 -- (-1169.707) (-1169.723) [-1169.656] (-1169.675) * (-1172.814) (-1169.243) (-1169.464) [-1171.135] -- 0:00:35 Average standard deviation of split frequencies: 0.012804 435500 -- (-1169.892) (-1169.723) [-1171.469] (-1169.484) * [-1174.000] (-1169.171) (-1172.014) (-1170.257) -- 0:00:34 436000 -- [-1169.049] (-1170.684) (-1169.046) (-1171.700) * [-1171.342] (-1168.494) (-1171.998) (-1171.015) -- 0:00:34 436500 -- (-1171.612) (-1169.384) [-1168.709] (-1177.273) * (-1169.446) [-1171.120] (-1170.460) (-1169.788) -- 0:00:34 437000 -- [-1173.166] (-1168.167) (-1169.022) (-1170.863) * (-1169.188) (-1167.947) [-1169.535] (-1168.714) -- 0:00:34 437500 -- (-1170.732) [-1169.436] (-1171.314) (-1170.882) * (-1171.767) [-1169.063] (-1172.062) (-1170.441) -- 0:00:34 438000 -- [-1170.021] (-1169.854) (-1171.719) (-1170.739) * (-1171.266) [-1169.675] (-1173.911) (-1172.376) -- 0:00:34 438500 -- (-1169.821) (-1168.571) [-1170.624] (-1168.693) * (-1171.499) [-1169.058] (-1169.498) (-1172.944) -- 0:00:34 439000 -- (-1170.008) [-1168.748] (-1169.573) (-1168.523) * (-1170.285) (-1169.326) [-1170.305] (-1172.264) -- 0:00:34 439500 -- [-1169.540] (-1168.521) (-1171.332) (-1169.768) * [-1170.402] (-1169.446) (-1170.553) (-1171.357) -- 0:00:34 440000 -- [-1169.458] (-1171.457) (-1168.354) (-1170.489) * (-1171.739) [-1170.096] (-1170.473) (-1170.388) -- 0:00:34 Average standard deviation of split frequencies: 0.012540 440500 -- (-1171.443) (-1170.859) [-1168.397] (-1170.501) * (-1170.246) (-1172.907) [-1170.685] (-1170.425) -- 0:00:34 441000 -- (-1171.206) (-1170.698) [-1168.016] (-1169.596) * [-1168.250] (-1174.457) (-1170.520) (-1172.122) -- 0:00:34 441500 -- (-1172.499) [-1169.380] (-1168.075) (-1179.428) * [-1168.328] (-1173.912) (-1171.097) (-1169.757) -- 0:00:35 442000 -- (-1171.567) [-1169.450] (-1171.527) (-1171.765) * [-1168.690] (-1172.071) (-1170.117) (-1171.707) -- 0:00:35 442500 -- (-1168.362) [-1169.382] (-1172.008) (-1172.155) * (-1169.211) (-1169.738) [-1169.661] (-1174.823) -- 0:00:35 443000 -- (-1169.003) [-1168.623] (-1172.101) (-1171.711) * [-1170.448] (-1167.974) (-1169.302) (-1173.860) -- 0:00:35 443500 -- (-1169.769) (-1169.929) [-1168.376] (-1171.337) * (-1170.579) [-1168.204] (-1169.001) (-1175.516) -- 0:00:35 444000 -- (-1170.215) (-1169.483) [-1168.760] (-1171.108) * (-1170.409) [-1169.079] (-1169.331) (-1172.527) -- 0:00:35 444500 -- (-1173.786) (-1168.432) [-1168.646] (-1170.265) * (-1172.693) (-1172.969) [-1168.274] (-1170.109) -- 0:00:34 445000 -- (-1171.115) [-1168.550] (-1168.514) (-1168.913) * (-1173.665) (-1171.976) (-1168.950) [-1170.476] -- 0:00:34 Average standard deviation of split frequencies: 0.013184 445500 -- (-1170.689) [-1169.367] (-1168.474) (-1171.875) * (-1169.956) [-1172.505] (-1171.199) (-1172.430) -- 0:00:34 446000 -- (-1169.504) [-1169.468] (-1171.072) (-1171.045) * (-1172.010) (-1169.427) (-1172.533) [-1168.794] -- 0:00:34 446500 -- (-1170.207) (-1174.204) (-1169.732) [-1170.882] * [-1169.261] (-1169.147) (-1171.501) (-1171.122) -- 0:00:34 447000 -- (-1172.094) (-1171.405) (-1170.587) [-1171.493] * (-1168.812) (-1172.156) (-1171.642) [-1170.295] -- 0:00:34 447500 -- (-1173.541) (-1171.727) (-1171.523) [-1172.128] * (-1169.997) [-1172.460] (-1173.689) (-1172.850) -- 0:00:34 448000 -- (-1174.349) [-1170.304] (-1174.300) (-1174.101) * (-1169.614) (-1171.378) [-1168.532] (-1173.697) -- 0:00:34 448500 -- (-1174.318) (-1171.165) [-1173.917] (-1171.321) * (-1168.172) [-1171.193] (-1169.004) (-1168.276) -- 0:00:34 449000 -- (-1170.613) [-1169.713] (-1171.810) (-1170.445) * (-1167.809) (-1169.850) (-1169.029) [-1168.096] -- 0:00:34 449500 -- (-1169.072) [-1175.044] (-1171.004) (-1171.356) * (-1168.422) (-1170.078) [-1169.281] (-1168.610) -- 0:00:34 450000 -- (-1171.404) [-1173.148] (-1171.132) (-1172.145) * (-1170.897) [-1172.104] (-1168.840) (-1169.266) -- 0:00:34 Average standard deviation of split frequencies: 0.012814 450500 -- (-1170.798) (-1168.159) (-1169.138) [-1170.392] * (-1171.149) (-1172.182) (-1169.790) [-1170.000] -- 0:00:34 451000 -- (-1169.910) (-1170.050) (-1168.235) [-1168.473] * (-1169.994) (-1171.845) (-1174.337) [-1168.919] -- 0:00:34 451500 -- (-1168.209) [-1169.258] (-1170.588) (-1170.290) * (-1169.995) (-1171.193) (-1174.813) [-1170.207] -- 0:00:34 452000 -- (-1170.448) (-1168.998) [-1168.311] (-1174.333) * [-1172.780] (-1170.317) (-1175.233) (-1171.506) -- 0:00:33 452500 -- (-1169.254) [-1168.510] (-1171.047) (-1172.197) * (-1170.333) (-1175.120) (-1171.018) [-1168.983] -- 0:00:33 453000 -- (-1167.795) (-1169.863) (-1169.310) [-1169.782] * (-1172.703) (-1170.718) (-1170.802) [-1171.432] -- 0:00:33 453500 -- (-1168.141) (-1171.838) (-1168.119) [-1168.293] * (-1171.152) (-1169.144) [-1170.953] (-1172.387) -- 0:00:33 454000 -- (-1170.412) [-1171.931] (-1170.871) (-1169.535) * (-1176.530) (-1169.158) (-1169.494) [-1172.446] -- 0:00:33 454500 -- (-1170.379) [-1169.749] (-1171.111) (-1170.390) * (-1172.192) [-1169.156] (-1179.116) (-1169.109) -- 0:00:33 455000 -- (-1171.830) (-1169.269) (-1174.825) [-1170.864] * (-1172.442) (-1169.008) (-1175.800) [-1169.148] -- 0:00:33 Average standard deviation of split frequencies: 0.012677 455500 -- (-1171.524) [-1169.320] (-1174.817) (-1171.013) * (-1170.100) (-1169.175) [-1169.184] (-1169.183) -- 0:00:33 456000 -- (-1169.995) (-1171.572) [-1169.473] (-1169.067) * (-1173.311) [-1170.170] (-1175.220) (-1172.156) -- 0:00:33 456500 -- [-1169.195] (-1170.086) (-1169.658) (-1171.229) * (-1170.949) [-1170.293] (-1168.748) (-1169.188) -- 0:00:33 457000 -- (-1168.426) (-1170.077) (-1169.176) [-1170.606] * (-1169.613) [-1171.038] (-1170.356) (-1170.672) -- 0:00:33 457500 -- (-1170.538) (-1172.265) [-1167.685] (-1171.937) * (-1169.986) (-1170.381) [-1168.181] (-1170.163) -- 0:00:33 458000 -- (-1175.638) (-1171.518) [-1169.504] (-1173.168) * (-1170.696) [-1170.086] (-1169.510) (-1169.330) -- 0:00:34 458500 -- (-1168.993) (-1170.723) [-1169.493] (-1169.901) * (-1170.743) [-1168.599] (-1167.910) (-1171.711) -- 0:00:34 459000 -- (-1171.037) (-1168.757) (-1169.497) [-1170.222] * (-1172.902) (-1168.345) (-1172.575) [-1171.129] -- 0:00:34 459500 -- [-1171.902] (-1169.977) (-1168.969) (-1168.277) * [-1169.102] (-1169.623) (-1169.666) (-1170.579) -- 0:00:34 460000 -- [-1169.842] (-1171.321) (-1168.191) (-1171.796) * (-1171.446) [-1169.205] (-1169.748) (-1170.335) -- 0:00:34 Average standard deviation of split frequencies: 0.012564 460500 -- (-1174.281) (-1174.372) [-1168.678] (-1168.278) * (-1169.674) (-1174.265) (-1169.449) [-1174.006] -- 0:00:33 461000 -- (-1174.809) [-1168.430] (-1168.231) (-1167.816) * (-1169.571) (-1168.840) [-1170.401] (-1171.645) -- 0:00:33 461500 -- (-1173.789) (-1169.428) (-1168.680) [-1169.853] * (-1170.235) (-1169.510) [-1171.170] (-1169.172) -- 0:00:33 462000 -- (-1168.786) (-1168.066) (-1169.420) [-1170.456] * (-1172.686) (-1173.591) (-1169.154) [-1169.535] -- 0:00:33 462500 -- [-1169.208] (-1171.074) (-1168.667) (-1170.245) * (-1171.866) [-1169.778] (-1172.588) (-1170.548) -- 0:00:33 463000 -- (-1177.762) [-1173.200] (-1170.119) (-1171.571) * (-1174.437) [-1170.084] (-1170.043) (-1169.273) -- 0:00:33 463500 -- (-1173.733) [-1167.984] (-1168.761) (-1169.783) * (-1172.596) (-1168.229) (-1168.628) [-1174.552] -- 0:00:33 464000 -- (-1170.773) (-1168.495) (-1171.267) [-1173.144] * (-1170.698) (-1169.376) [-1167.908] (-1173.426) -- 0:00:33 464500 -- [-1169.871] (-1169.026) (-1168.717) (-1173.509) * (-1170.065) [-1170.641] (-1168.386) (-1170.662) -- 0:00:33 465000 -- (-1167.971) (-1170.797) (-1170.953) [-1169.278] * [-1172.903] (-1169.975) (-1170.838) (-1169.067) -- 0:00:33 Average standard deviation of split frequencies: 0.012778 465500 -- (-1173.802) (-1172.010) [-1175.962] (-1170.738) * (-1170.066) (-1169.769) (-1170.916) [-1168.660] -- 0:00:33 466000 -- [-1169.898] (-1168.625) (-1171.147) (-1169.010) * (-1171.125) (-1170.716) [-1170.749] (-1168.316) -- 0:00:33 466500 -- [-1169.285] (-1168.340) (-1169.771) (-1168.673) * (-1170.720) (-1172.443) [-1169.445] (-1169.821) -- 0:00:33 467000 -- [-1168.513] (-1169.883) (-1169.137) (-1168.503) * (-1171.340) (-1169.676) (-1169.459) [-1169.554] -- 0:00:33 467500 -- (-1171.476) [-1167.735] (-1171.885) (-1171.586) * (-1176.067) [-1169.387] (-1170.957) (-1169.107) -- 0:00:33 468000 -- [-1172.568] (-1169.729) (-1170.894) (-1170.969) * (-1171.875) [-1168.808] (-1173.611) (-1171.519) -- 0:00:32 468500 -- (-1168.917) [-1168.972] (-1174.139) (-1169.980) * (-1178.317) (-1168.549) [-1169.874] (-1168.735) -- 0:00:32 469000 -- [-1169.070] (-1170.933) (-1170.492) (-1170.839) * (-1175.226) [-1168.242] (-1171.255) (-1169.054) -- 0:00:32 469500 -- (-1169.936) [-1170.229] (-1167.707) (-1169.070) * [-1170.521] (-1168.395) (-1171.463) (-1169.542) -- 0:00:32 470000 -- (-1169.312) (-1168.343) [-1167.980] (-1172.474) * (-1168.129) (-1168.372) (-1168.403) [-1169.469] -- 0:00:32 Average standard deviation of split frequencies: 0.012493 470500 -- (-1169.730) [-1170.041] (-1168.937) (-1168.533) * (-1168.716) (-1168.905) (-1168.525) [-1170.650] -- 0:00:32 471000 -- [-1168.842] (-1170.448) (-1169.297) (-1169.314) * (-1169.173) (-1171.691) [-1170.787] (-1173.708) -- 0:00:32 471500 -- (-1169.814) (-1168.608) (-1169.729) [-1172.385] * (-1169.113) (-1169.185) [-1170.504] (-1171.324) -- 0:00:32 472000 -- (-1169.004) [-1168.986] (-1172.519) (-1169.740) * [-1168.427] (-1172.176) (-1170.208) (-1171.121) -- 0:00:32 472500 -- (-1169.216) [-1168.681] (-1169.792) (-1170.165) * (-1168.035) [-1170.583] (-1169.985) (-1171.665) -- 0:00:32 473000 -- [-1170.124] (-1169.160) (-1170.184) (-1169.593) * [-1169.177] (-1170.342) (-1168.579) (-1171.399) -- 0:00:32 473500 -- (-1168.159) (-1170.626) [-1172.955] (-1172.501) * (-1171.814) [-1169.737] (-1169.925) (-1170.494) -- 0:00:32 474000 -- [-1170.069] (-1169.256) (-1171.857) (-1173.463) * (-1169.502) (-1170.237) (-1173.162) [-1170.786] -- 0:00:33 474500 -- (-1168.805) [-1169.296] (-1171.421) (-1169.591) * (-1172.025) (-1171.483) (-1171.550) [-1169.581] -- 0:00:33 475000 -- (-1169.762) [-1170.122] (-1171.651) (-1168.856) * (-1172.303) (-1169.631) (-1172.040) [-1170.696] -- 0:00:33 Average standard deviation of split frequencies: 0.011780 475500 -- [-1169.643] (-1170.246) (-1170.090) (-1168.178) * [-1172.670] (-1168.442) (-1168.200) (-1176.953) -- 0:00:33 476000 -- [-1168.967] (-1172.170) (-1169.817) (-1168.325) * (-1169.283) [-1169.505] (-1171.575) (-1171.104) -- 0:00:33 476500 -- (-1169.383) [-1169.295] (-1173.725) (-1171.165) * (-1168.557) (-1169.539) (-1173.043) [-1171.801] -- 0:00:32 477000 -- (-1169.312) [-1169.250] (-1172.119) (-1174.249) * (-1172.879) (-1169.374) [-1172.973] (-1173.666) -- 0:00:32 477500 -- (-1169.317) (-1169.278) (-1170.931) [-1169.698] * [-1172.180] (-1171.156) (-1170.945) (-1171.004) -- 0:00:32 478000 -- (-1171.963) (-1170.600) (-1168.677) [-1167.990] * (-1173.291) (-1176.660) [-1169.740] (-1173.138) -- 0:00:32 478500 -- (-1172.183) [-1170.355] (-1170.956) (-1169.572) * (-1169.764) (-1178.287) [-1170.731] (-1170.797) -- 0:00:32 479000 -- (-1169.249) (-1172.892) (-1170.957) [-1168.906] * [-1169.778] (-1172.800) (-1169.595) (-1170.992) -- 0:00:32 479500 -- [-1170.827] (-1170.293) (-1171.300) (-1170.848) * (-1168.438) (-1170.492) [-1169.532] (-1170.946) -- 0:00:32 480000 -- (-1170.861) (-1170.536) [-1172.488] (-1174.376) * (-1168.487) [-1168.103] (-1169.883) (-1170.722) -- 0:00:32 Average standard deviation of split frequencies: 0.012388 480500 -- [-1171.022] (-1176.015) (-1172.663) (-1172.603) * [-1172.429] (-1169.526) (-1169.472) (-1173.183) -- 0:00:32 481000 -- [-1169.980] (-1169.990) (-1170.534) (-1170.669) * (-1168.577) (-1173.517) [-1170.966] (-1173.533) -- 0:00:32 481500 -- (-1175.270) [-1170.112] (-1171.119) (-1170.476) * (-1171.701) [-1174.149] (-1168.917) (-1168.399) -- 0:00:32 482000 -- [-1170.736] (-1170.861) (-1174.358) (-1176.310) * (-1177.770) (-1171.598) (-1170.465) [-1168.345] -- 0:00:32 482500 -- (-1172.191) [-1168.728] (-1169.574) (-1170.057) * (-1173.453) (-1168.643) (-1170.401) [-1169.677] -- 0:00:32 483000 -- [-1170.434] (-1168.975) (-1169.234) (-1171.663) * (-1173.283) (-1171.805) (-1168.571) [-1169.591] -- 0:00:32 483500 -- (-1172.606) (-1169.986) (-1171.544) [-1169.348] * [-1168.727] (-1168.147) (-1168.811) (-1172.984) -- 0:00:32 484000 -- [-1170.504] (-1169.611) (-1171.036) (-1169.310) * (-1168.921) (-1172.125) [-1169.671] (-1170.811) -- 0:00:31 484500 -- [-1171.143] (-1169.697) (-1171.208) (-1170.235) * (-1168.540) [-1168.290] (-1171.281) (-1168.851) -- 0:00:31 485000 -- (-1171.677) (-1172.371) (-1168.010) [-1168.729] * (-1170.953) (-1169.018) (-1170.806) [-1174.840] -- 0:00:31 Average standard deviation of split frequencies: 0.012405 485500 -- (-1172.815) (-1171.789) (-1173.087) [-1169.910] * [-1170.768] (-1169.013) (-1170.429) (-1171.477) -- 0:00:31 486000 -- (-1170.524) (-1168.640) [-1170.934] (-1170.129) * [-1170.371] (-1169.859) (-1170.115) (-1178.755) -- 0:00:31 486500 -- (-1170.125) (-1171.500) (-1172.164) [-1168.499] * (-1169.722) (-1168.386) [-1170.736] (-1169.435) -- 0:00:31 487000 -- (-1169.559) (-1172.102) [-1170.056] (-1169.014) * (-1171.609) [-1168.932] (-1168.829) (-1169.958) -- 0:00:31 487500 -- (-1169.086) (-1172.460) [-1170.755] (-1169.481) * [-1171.217] (-1171.593) (-1171.155) (-1168.331) -- 0:00:31 488000 -- [-1170.401] (-1173.162) (-1168.919) (-1168.982) * [-1169.580] (-1169.029) (-1176.471) (-1169.930) -- 0:00:31 488500 -- (-1171.699) (-1168.827) [-1168.891] (-1168.027) * (-1171.137) (-1168.704) [-1167.948] (-1168.115) -- 0:00:31 489000 -- (-1169.426) (-1169.741) (-1168.745) [-1169.308] * (-1169.732) (-1170.640) [-1168.546] (-1168.357) -- 0:00:31 489500 -- (-1174.997) [-1172.680] (-1168.466) (-1169.363) * [-1169.163] (-1169.742) (-1168.122) (-1169.674) -- 0:00:31 490000 -- (-1170.521) (-1170.103) (-1171.473) [-1169.151] * (-1169.163) (-1170.305) [-1168.944] (-1171.798) -- 0:00:32 Average standard deviation of split frequencies: 0.012063 490500 -- (-1170.293) (-1169.709) [-1169.820] (-1168.891) * (-1168.525) (-1168.443) (-1169.902) [-1170.121] -- 0:00:32 491000 -- (-1170.530) (-1168.388) [-1168.880] (-1169.236) * (-1169.166) [-1169.261] (-1170.846) (-1172.109) -- 0:00:32 491500 -- (-1171.055) (-1171.558) (-1172.117) [-1170.198] * (-1168.766) (-1169.205) [-1170.025] (-1170.459) -- 0:00:32 492000 -- (-1174.141) [-1167.925] (-1177.316) (-1170.192) * [-1168.501] (-1168.880) (-1168.254) (-1168.782) -- 0:00:32 492500 -- (-1172.593) [-1170.585] (-1175.982) (-1168.810) * (-1168.973) [-1170.065] (-1168.795) (-1172.812) -- 0:00:31 493000 -- (-1172.714) [-1169.439] (-1173.258) (-1168.365) * (-1173.377) [-1167.977] (-1168.836) (-1169.814) -- 0:00:31 493500 -- (-1168.524) (-1170.785) [-1169.996] (-1168.076) * (-1173.722) (-1168.789) [-1173.052] (-1170.259) -- 0:00:31 494000 -- [-1171.800] (-1169.063) (-1171.234) (-1169.065) * [-1172.437] (-1171.168) (-1171.701) (-1173.988) -- 0:00:31 494500 -- (-1172.231) [-1168.732] (-1176.346) (-1169.107) * [-1174.196] (-1169.509) (-1169.501) (-1173.249) -- 0:00:31 495000 -- [-1168.911] (-1168.358) (-1170.457) (-1170.871) * (-1173.772) [-1169.620] (-1169.092) (-1170.534) -- 0:00:31 Average standard deviation of split frequencies: 0.012039 495500 -- [-1168.848] (-1170.324) (-1169.287) (-1168.355) * (-1174.432) (-1171.968) [-1168.364] (-1170.947) -- 0:00:31 496000 -- (-1171.365) [-1168.751] (-1171.914) (-1169.310) * (-1168.751) [-1170.300] (-1169.515) (-1170.658) -- 0:00:31 496500 -- [-1170.473] (-1169.288) (-1171.055) (-1169.354) * (-1168.289) (-1173.513) (-1172.133) [-1168.770] -- 0:00:31 497000 -- [-1170.587] (-1173.185) (-1169.226) (-1167.795) * [-1168.215] (-1174.450) (-1169.407) (-1172.534) -- 0:00:31 497500 -- (-1171.649) [-1173.111] (-1171.134) (-1170.778) * (-1169.384) [-1170.432] (-1169.090) (-1172.093) -- 0:00:31 498000 -- (-1173.212) (-1167.781) (-1172.546) [-1170.904] * [-1169.950] (-1170.031) (-1169.518) (-1177.155) -- 0:00:31 498500 -- (-1169.906) [-1168.737] (-1169.955) (-1170.597) * (-1170.670) [-1169.482] (-1171.200) (-1171.067) -- 0:00:31 499000 -- [-1170.035] (-1170.303) (-1168.064) (-1171.466) * (-1170.342) (-1174.538) [-1170.078] (-1170.307) -- 0:00:31 499500 -- [-1168.763] (-1168.542) (-1168.077) (-1175.637) * [-1170.623] (-1170.000) (-1169.869) (-1170.837) -- 0:00:31 500000 -- (-1169.229) (-1168.563) [-1167.708] (-1172.503) * (-1168.461) (-1170.903) [-1169.770] (-1169.003) -- 0:00:31 Average standard deviation of split frequencies: 0.011979 500500 -- (-1170.213) (-1168.236) [-1169.347] (-1168.809) * [-1170.689] (-1170.607) (-1170.465) (-1169.421) -- 0:00:30 501000 -- (-1169.839) (-1168.240) [-1171.036] (-1170.236) * (-1172.728) (-1169.202) [-1169.826] (-1171.596) -- 0:00:30 501500 -- (-1169.781) (-1168.887) [-1170.071] (-1173.958) * (-1172.086) (-1172.393) (-1169.538) [-1170.877] -- 0:00:30 502000 -- [-1170.773] (-1168.903) (-1169.894) (-1173.696) * (-1170.245) (-1168.452) (-1171.600) [-1169.664] -- 0:00:30 502500 -- (-1169.645) (-1168.653) (-1170.041) [-1170.544] * [-1170.424] (-1171.209) (-1171.737) (-1170.848) -- 0:00:30 503000 -- (-1171.788) [-1171.009] (-1168.666) (-1170.084) * (-1170.958) [-1170.674] (-1171.712) (-1170.259) -- 0:00:30 503500 -- [-1170.869] (-1170.452) (-1171.501) (-1168.856) * [-1169.758] (-1168.002) (-1169.824) (-1170.257) -- 0:00:30 504000 -- [-1172.794] (-1171.376) (-1171.170) (-1170.018) * (-1168.405) (-1172.095) [-1169.675] (-1170.134) -- 0:00:30 504500 -- [-1171.216] (-1169.033) (-1169.550) (-1168.126) * (-1172.170) [-1171.750] (-1173.480) (-1168.668) -- 0:00:30 505000 -- [-1168.031] (-1169.320) (-1170.650) (-1169.505) * (-1169.366) (-1171.466) (-1169.051) [-1170.814] -- 0:00:30 Average standard deviation of split frequencies: 0.011594 505500 -- (-1169.794) (-1171.789) [-1172.432] (-1168.276) * [-1176.694] (-1170.758) (-1171.327) (-1169.088) -- 0:00:30 506000 -- (-1170.916) (-1171.155) (-1172.048) [-1170.004] * (-1173.842) (-1178.370) [-1168.085] (-1169.288) -- 0:00:31 506500 -- [-1170.832] (-1170.391) (-1171.155) (-1169.560) * [-1169.836] (-1169.534) (-1169.201) (-1169.076) -- 0:00:31 507000 -- (-1174.158) [-1168.479] (-1170.991) (-1169.382) * (-1171.874) [-1167.895] (-1171.242) (-1172.411) -- 0:00:31 507500 -- [-1169.045] (-1169.595) (-1168.846) (-1172.617) * (-1169.814) [-1169.510] (-1170.202) (-1174.332) -- 0:00:31 508000 -- [-1168.878] (-1169.296) (-1171.104) (-1174.204) * (-1170.036) (-1170.787) [-1168.118] (-1169.020) -- 0:00:30 508500 -- (-1169.351) (-1169.979) (-1170.112) [-1169.363] * (-1173.069) (-1170.708) (-1169.114) [-1169.085] -- 0:00:30 509000 -- (-1170.597) [-1169.355] (-1170.941) (-1170.983) * [-1172.507] (-1169.485) (-1172.738) (-1169.917) -- 0:00:30 509500 -- [-1169.776] (-1169.909) (-1169.047) (-1171.825) * (-1170.670) [-1168.346] (-1169.385) (-1170.207) -- 0:00:30 510000 -- (-1172.488) (-1169.566) (-1174.018) [-1169.435] * (-1168.520) (-1168.961) (-1168.354) [-1171.946] -- 0:00:30 Average standard deviation of split frequencies: 0.012243 510500 -- [-1169.621] (-1170.210) (-1172.957) (-1171.812) * (-1171.740) (-1167.882) [-1168.928] (-1169.936) -- 0:00:30 511000 -- (-1168.649) (-1171.089) [-1179.163] (-1169.942) * [-1170.952] (-1171.222) (-1172.337) (-1170.225) -- 0:00:30 511500 -- [-1168.093] (-1171.047) (-1177.059) (-1171.671) * (-1172.433) (-1170.614) (-1171.081) [-1169.737] -- 0:00:30 512000 -- (-1168.296) [-1170.715] (-1171.581) (-1168.571) * (-1169.565) (-1171.561) (-1168.490) [-1173.086] -- 0:00:30 512500 -- (-1168.095) (-1169.614) [-1168.560] (-1168.810) * (-1171.915) (-1173.121) (-1170.499) [-1167.872] -- 0:00:30 513000 -- (-1170.588) (-1171.186) (-1169.143) [-1169.936] * [-1167.968] (-1171.232) (-1167.967) (-1177.082) -- 0:00:30 513500 -- [-1170.900] (-1171.034) (-1169.310) (-1169.637) * [-1170.937] (-1174.659) (-1168.662) (-1171.138) -- 0:00:30 514000 -- (-1171.368) [-1169.225] (-1174.233) (-1171.491) * (-1170.659) (-1172.349) (-1170.156) [-1169.995] -- 0:00:30 514500 -- (-1168.847) [-1169.258] (-1168.641) (-1175.281) * (-1172.125) (-1171.402) (-1168.907) [-1170.285] -- 0:00:30 515000 -- [-1174.612] (-1168.652) (-1172.488) (-1172.885) * (-1170.324) (-1173.286) (-1170.059) [-1168.898] -- 0:00:30 Average standard deviation of split frequencies: 0.011724 515500 -- (-1169.527) (-1169.360) (-1168.999) [-1170.270] * [-1169.129] (-1169.334) (-1169.834) (-1168.281) -- 0:00:30 516000 -- (-1168.379) (-1168.667) (-1171.073) [-1171.190] * [-1169.512] (-1169.062) (-1169.274) (-1172.049) -- 0:00:30 516500 -- (-1168.377) (-1168.708) (-1171.477) [-1170.343] * [-1170.442] (-1171.747) (-1169.025) (-1170.186) -- 0:00:29 517000 -- [-1169.476] (-1168.851) (-1169.705) (-1169.846) * (-1169.501) (-1171.447) (-1171.135) [-1171.840] -- 0:00:29 517500 -- [-1169.206] (-1172.891) (-1168.155) (-1172.483) * (-1168.246) [-1168.859] (-1169.519) (-1171.875) -- 0:00:29 518000 -- (-1168.107) (-1169.322) [-1171.013] (-1171.677) * (-1169.545) [-1169.869] (-1171.047) (-1172.475) -- 0:00:29 518500 -- (-1168.741) (-1168.624) (-1170.243) [-1168.398] * (-1169.649) [-1169.928] (-1170.758) (-1176.095) -- 0:00:29 519000 -- (-1169.341) (-1168.982) [-1173.475] (-1168.606) * (-1169.251) (-1169.409) (-1169.351) [-1171.391] -- 0:00:29 519500 -- [-1172.660] (-1168.735) (-1174.317) (-1170.373) * (-1169.529) [-1170.953] (-1169.455) (-1168.632) -- 0:00:29 520000 -- [-1168.476] (-1170.448) (-1169.822) (-1170.076) * (-1169.262) (-1169.556) [-1170.145] (-1168.438) -- 0:00:29 Average standard deviation of split frequencies: 0.011418 520500 -- (-1169.136) [-1168.090] (-1169.281) (-1170.477) * [-1169.241] (-1170.115) (-1167.985) (-1170.505) -- 0:00:29 521000 -- (-1169.385) (-1171.719) (-1169.880) [-1169.783] * [-1169.531] (-1169.265) (-1167.864) (-1170.102) -- 0:00:29 521500 -- (-1168.173) (-1171.873) (-1169.557) [-1169.559] * (-1168.868) (-1169.222) [-1170.963] (-1169.684) -- 0:00:29 522000 -- (-1170.491) (-1168.766) [-1169.939] (-1169.647) * (-1171.368) (-1172.285) [-1169.935] (-1171.447) -- 0:00:30 522500 -- (-1172.523) (-1169.349) (-1174.224) [-1169.173] * (-1172.983) (-1170.504) [-1170.480] (-1171.800) -- 0:00:30 523000 -- (-1172.078) [-1170.172] (-1168.383) (-1169.241) * (-1170.542) (-1172.370) (-1170.947) [-1168.670] -- 0:00:30 523500 -- [-1169.842] (-1168.957) (-1168.772) (-1169.131) * [-1167.939] (-1174.245) (-1177.588) (-1170.632) -- 0:00:30 524000 -- [-1168.724] (-1169.145) (-1168.002) (-1170.189) * [-1168.596] (-1172.092) (-1171.496) (-1169.252) -- 0:00:29 524500 -- (-1170.408) [-1168.593] (-1171.236) (-1170.823) * (-1168.438) (-1172.196) [-1168.574] (-1173.220) -- 0:00:29 525000 -- (-1170.170) [-1168.242] (-1171.654) (-1169.023) * (-1168.517) (-1172.473) [-1169.625] (-1169.670) -- 0:00:29 Average standard deviation of split frequencies: 0.011551 525500 -- [-1170.369] (-1168.023) (-1171.280) (-1171.311) * (-1168.943) [-1168.850] (-1174.597) (-1170.055) -- 0:00:29 526000 -- (-1169.573) [-1168.374] (-1172.816) (-1171.547) * (-1171.879) [-1171.174] (-1174.542) (-1168.538) -- 0:00:29 526500 -- [-1170.769] (-1171.835) (-1170.892) (-1168.372) * [-1169.347] (-1173.656) (-1168.762) (-1170.303) -- 0:00:29 527000 -- (-1170.696) (-1173.790) [-1168.638] (-1170.519) * (-1171.952) (-1169.817) (-1171.007) [-1170.579] -- 0:00:29 527500 -- [-1169.481] (-1169.638) (-1173.951) (-1171.165) * (-1175.410) [-1170.870] (-1170.554