>C1
VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
>C2
VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
>C3
VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
>C4
VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
>C5
VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
>C6
VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=291
C1 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
C2 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
C3 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
C4 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
C5 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
C6 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
**************************************************
C1 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
C2 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
C3 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
C4 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
C5 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
C6 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
**************************************************
C1 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
C2 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
C3 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
C4 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
C5 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
C6 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
**************************************************
C1 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
C2 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
C3 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
C4 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
C5 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
C6 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
**************************************************
C1 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
C2 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
C3 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
C4 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
C5 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
C6 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
**************************************************
C1 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
C2 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
C3 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
C4 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
C5 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
C6 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
*****************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 291 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 291 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8730]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8730]--->[8730]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.494 Mb, Max= 30.841 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
C2 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
C3 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
C4 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
C5 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
C6 VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
**************************************************
C1 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
C2 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
C3 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
C4 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
C5 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
C6 GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
**************************************************
C1 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
C2 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
C3 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
C4 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
C5 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
C6 EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
**************************************************
C1 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
C2 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
C3 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
C4 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
C5 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
C6 FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
**************************************************
C1 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
C2 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
C3 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
C4 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
C5 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
C6 HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
**************************************************
C1 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
C2 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
C3 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
C4 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
C5 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
C6 AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
*****************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT
C2 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT
C3 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT
C4 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT
C5 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT
C6 GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT
**************************************************
C1 CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA
C2 CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA
C3 CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA
C4 CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA
C5 CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA
C6 CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA
**************************************************
C1 CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG
C2 CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG
C3 CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG
C4 CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG
C5 CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG
C6 CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG
**************************************************
C1 GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG
C2 GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG
C3 GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG
C4 GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG
C5 GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG
C6 GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG
**************************************************
C1 CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC
C2 CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC
C3 CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC
C4 CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC
C5 CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC
C6 CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC
**************************************************
C1 TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA
C2 TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA
C3 TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA
C4 TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA
C5 TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA
C6 TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA
**************************************************
C1 GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG
C2 GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG
C3 GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG
C4 GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG
C5 GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG
C6 GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG
**************************************************
C1 CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG
C2 CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG
C3 CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG
C4 CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG
C5 CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG
C6 CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG
**************************************************
C1 CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC
C2 CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC
C3 CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC
C4 CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC
C5 CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC
C6 CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC
**************************************************
C1 TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT
C2 TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT
C3 TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT
C4 TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT
C5 TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT
C6 TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT
**************************************************
C1 TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC
C2 TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC
C3 TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC
C4 TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC
C5 TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC
C6 TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC
**************************************************
C1 GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC
C2 GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC
C3 GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC
C4 GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC
C5 GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC
C6 GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC
**************************************************
C1 CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG
C2 CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG
C3 CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG
C4 CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG
C5 CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG
C6 CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG
**************************************************
C1 GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG
C2 GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG
C3 GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG
C4 GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG
C5 GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG
C6 GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG
**************************************************
C1 GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG
C2 GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG
C3 GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG
C4 GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG
C5 GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG
C6 GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG
**************************************************
C1 GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC
C2 GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC
C3 GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC
C4 GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC
C5 GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC
C6 GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC
**************************************************
C1 CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA
C2 CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA
C3 CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA
C4 CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA
C5 CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA
C6 CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA
**************************************************
C1 CGCGCACGGTGAGGGGACTCGCA
C2 CGCGCACGGTGAGGGGACTCGCA
C3 CGCGCACGGTGAGGGGACTCGCA
C4 CGCGCACGGTGAGGGGACTCGCA
C5 CGCGCACGGTGAGGGGACTCGCA
C6 CGCGCACGGTGAGGGGACTCGCA
***********************
>C1
GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT
CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA
CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG
GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG
CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC
TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA
GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG
CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG
CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC
TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT
TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC
GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC
CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG
GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG
GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG
GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC
CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA
CGCGCACGGTGAGGGGACTCGCA
>C2
GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT
CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA
CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG
GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG
CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC
TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA
GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG
CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG
CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC
TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT
TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC
GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC
CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG
GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG
GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG
GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC
CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA
CGCGCACGGTGAGGGGACTCGCA
>C3
GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT
CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA
CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG
GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG
CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC
TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA
GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG
CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG
CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC
TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT
TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC
GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC
CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG
GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG
GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG
GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC
CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA
CGCGCACGGTGAGGGGACTCGCA
>C4
GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT
CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA
CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG
GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG
CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC
TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA
GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG
CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG
CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC
TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT
TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC
GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC
CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG
GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG
GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG
GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC
CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA
CGCGCACGGTGAGGGGACTCGCA
>C5
GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT
CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA
CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG
GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG
CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC
TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA
GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG
CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG
CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC
TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT
TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC
GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC
CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG
GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG
GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG
GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC
CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA
CGCGCACGGTGAGGGGACTCGCA
>C6
GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGAT
CATGGCGATCGTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGA
CCTTCAGTGACGAGGCTGCTCGTGCTGCAGCGCACCGGGCCGTTGCGGAG
GGCGCCGATGTCATCGATGTCGGCGGCGTTAAAGCAGGGCCTGGTCAGGG
CGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTCATCGAATGGC
TACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA
GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAG
CTGGGGTGGAGCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCG
CGGGCCTGGTGTGTTCGCACACCGGTGGCGCGCTGCCCCGCACGCGTCCC
TTTCGGGTGAGTTACGGTACGACGACCCGCGGTGTGGTGGACGATGTGAT
TCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCCGGGGTAACCC
GCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC
CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTG
GCCCGTGCTCATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGG
GCGTGGGTTTGACGGAACGGCTAGAGGGTACGTTGGCGGCCACTGCGTTG
GCGGCGGCAGCTGGCGTCCGCATGTTTCGGGTGCACGAGGTCGTAGCGAC
CAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACGCGTCCCCCAA
CGCGCACGGTGAGGGGACTCGCA
>C1
VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
>C2
VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
>C3
VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
>C4
VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
>C5
VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
>C6
VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAE
GADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRA
EVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRP
FRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTF
HGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATAL
AAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 873 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579788907
Setting output file names to "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 83703708
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0506668054
Seed = 404798614
Swapseed = 1579788907
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1953.815734 -- -24.965149
Chain 2 -- -1953.815847 -- -24.965149
Chain 3 -- -1953.815847 -- -24.965149
Chain 4 -- -1953.815550 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1953.815847 -- -24.965149
Chain 2 -- -1953.815734 -- -24.965149
Chain 3 -- -1953.815847 -- -24.965149
Chain 4 -- -1953.815734 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1953.816] (-1953.816) (-1953.816) (-1953.816) * [-1953.816] (-1953.816) (-1953.816) (-1953.816)
500 -- (-1202.148) (-1202.700) [-1176.301] (-1189.532) * [-1179.984] (-1201.190) (-1220.206) (-1195.121) -- 0:00:00
1000 -- (-1180.208) (-1195.451) (-1191.789) [-1181.238] * [-1173.693] (-1204.976) (-1179.942) (-1178.430) -- 0:00:00
1500 -- (-1173.130) (-1174.654) (-1175.763) [-1177.372] * (-1177.536) (-1198.578) [-1177.131] (-1180.081) -- 0:00:00
2000 -- (-1179.788) (-1178.982) (-1179.658) [-1175.822] * (-1182.820) (-1185.865) (-1181.486) [-1173.303] -- 0:00:00
2500 -- [-1177.220] (-1184.004) (-1185.576) (-1179.445) * [-1173.956] (-1183.462) (-1180.378) (-1174.399) -- 0:00:00
3000 -- [-1174.705] (-1177.783) (-1182.966) (-1180.716) * (-1186.809) [-1174.241] (-1178.239) (-1179.206) -- 0:00:00
3500 -- (-1183.527) [-1186.183] (-1182.058) (-1176.908) * (-1184.002) (-1179.613) (-1185.161) [-1179.877] -- 0:00:00
4000 -- [-1176.721] (-1177.424) (-1178.151) (-1178.353) * (-1183.005) [-1177.470] (-1180.689) (-1184.744) -- 0:00:00
4500 -- (-1179.267) (-1179.092) [-1175.456] (-1182.258) * [-1180.498] (-1178.331) (-1190.116) (-1177.948) -- 0:00:00
5000 -- [-1183.196] (-1175.910) (-1181.474) (-1178.705) * [-1181.622] (-1180.332) (-1179.373) (-1192.104) -- 0:00:00
Average standard deviation of split frequencies: 0.122975
5500 -- (-1172.399) (-1181.574) [-1179.203] (-1172.691) * (-1179.672) (-1177.702) (-1178.243) [-1178.042] -- 0:00:00
6000 -- [-1173.942] (-1190.969) (-1181.633) (-1174.896) * (-1178.343) [-1175.704] (-1174.319) (-1181.623) -- 0:00:00
6500 -- (-1183.727) (-1183.151) [-1178.532] (-1177.217) * (-1183.292) (-1178.483) (-1189.384) [-1173.246] -- 0:00:00
7000 -- [-1184.826] (-1177.751) (-1182.374) (-1180.989) * [-1175.676] (-1179.115) (-1179.368) (-1184.829) -- 0:00:00
7500 -- (-1178.574) (-1175.365) [-1177.777] (-1179.903) * [-1173.545] (-1181.677) (-1182.925) (-1179.615) -- 0:00:00
8000 -- (-1176.540) (-1183.847) [-1175.902] (-1178.046) * (-1179.269) [-1178.356] (-1181.698) (-1185.988) -- 0:00:00
8500 -- (-1176.457) (-1182.240) (-1180.374) [-1175.428] * [-1173.807] (-1181.921) (-1178.123) (-1172.892) -- 0:00:00
9000 -- (-1175.917) [-1176.204] (-1184.907) (-1177.901) * [-1179.328] (-1184.273) (-1186.985) (-1177.756) -- 0:00:00
9500 -- [-1177.800] (-1182.108) (-1177.256) (-1185.305) * (-1180.719) (-1183.790) (-1181.642) [-1180.833] -- 0:00:00
10000 -- (-1185.247) [-1181.085] (-1176.553) (-1182.589) * (-1179.794) (-1174.527) [-1184.543] (-1180.103) -- 0:00:00
Average standard deviation of split frequencies: 0.072920
10500 -- [-1175.903] (-1179.086) (-1179.116) (-1178.350) * (-1181.028) (-1184.807) (-1177.597) [-1182.113] -- 0:00:00
11000 -- [-1177.883] (-1179.170) (-1176.413) (-1183.027) * (-1184.100) (-1175.641) (-1181.807) [-1181.553] -- 0:01:29
11500 -- (-1182.205) (-1179.356) [-1177.186] (-1182.840) * (-1179.490) [-1173.626] (-1182.384) (-1174.860) -- 0:01:25
12000 -- (-1177.718) (-1188.704) (-1178.664) [-1177.389] * (-1178.990) [-1181.502] (-1177.220) (-1180.381) -- 0:01:22
12500 -- (-1184.604) (-1179.184) [-1174.029] (-1182.030) * (-1181.311) [-1175.862] (-1174.895) (-1184.611) -- 0:01:19
13000 -- (-1173.120) (-1176.759) [-1174.964] (-1177.360) * [-1175.701] (-1183.778) (-1178.452) (-1187.772) -- 0:01:15
13500 -- (-1172.209) (-1169.464) (-1176.893) [-1181.165] * (-1176.846) (-1181.232) [-1175.206] (-1182.152) -- 0:01:13
14000 -- (-1169.485) (-1172.843) (-1179.889) [-1179.442] * [-1173.811] (-1179.110) (-1189.913) (-1186.376) -- 0:01:10
14500 -- [-1170.699] (-1172.260) (-1186.185) (-1186.662) * [-1187.410] (-1178.754) (-1179.404) (-1178.540) -- 0:01:07
15000 -- [-1177.477] (-1172.233) (-1177.747) (-1176.108) * [-1176.644] (-1179.683) (-1178.927) (-1188.625) -- 0:01:05
Average standard deviation of split frequencies: 0.067764
15500 -- (-1171.977) [-1169.077] (-1179.001) (-1180.761) * (-1179.974) (-1176.128) [-1178.416] (-1182.281) -- 0:01:03
16000 -- (-1170.208) (-1169.508) (-1176.357) [-1176.759] * (-1177.550) (-1181.383) [-1180.701] (-1187.910) -- 0:01:01
16500 -- (-1170.046) (-1170.313) (-1187.509) [-1180.178] * [-1189.261] (-1177.390) (-1177.640) (-1179.118) -- 0:00:59
17000 -- (-1170.086) (-1168.564) (-1182.053) [-1176.546] * (-1179.241) (-1177.430) (-1186.015) [-1174.874] -- 0:00:57
17500 -- (-1172.360) (-1168.431) [-1182.227] (-1180.467) * (-1185.486) (-1179.060) (-1174.394) [-1171.155] -- 0:00:56
18000 -- [-1171.997] (-1170.870) (-1183.468) (-1180.046) * (-1183.387) [-1178.005] (-1176.772) (-1174.416) -- 0:00:54
18500 -- (-1173.383) (-1167.981) [-1174.934] (-1180.610) * (-1173.541) (-1175.127) (-1178.885) [-1175.097] -- 0:00:53
19000 -- [-1172.935] (-1171.510) (-1178.747) (-1176.303) * (-1177.005) (-1173.534) (-1177.862) [-1169.253] -- 0:00:51
19500 -- (-1168.701) (-1171.502) (-1188.051) [-1174.685] * (-1177.024) (-1182.241) (-1184.819) [-1169.212] -- 0:00:50
20000 -- (-1169.812) (-1168.286) (-1177.844) [-1173.183] * (-1184.893) (-1175.387) (-1180.884) [-1168.723] -- 0:00:49
Average standard deviation of split frequencies: 0.051841
20500 -- (-1169.763) (-1169.206) (-1182.117) [-1181.565] * (-1184.230) [-1179.279] (-1184.089) (-1170.764) -- 0:00:47
21000 -- (-1170.546) [-1168.985] (-1176.482) (-1179.280) * [-1183.323] (-1179.782) (-1176.631) (-1170.096) -- 0:00:46
21500 -- (-1168.946) [-1171.050] (-1177.897) (-1180.288) * (-1175.522) (-1187.838) (-1175.857) [-1169.057] -- 0:00:45
22000 -- (-1171.520) (-1171.350) (-1176.635) [-1181.810] * (-1179.645) (-1179.192) [-1174.086] (-1168.683) -- 0:00:44
22500 -- (-1170.474) [-1168.772] (-1177.432) (-1183.552) * (-1190.268) (-1182.854) (-1180.718) [-1170.618] -- 0:00:43
23000 -- (-1170.449) (-1169.852) (-1180.623) [-1178.108] * [-1178.216] (-1184.126) (-1182.075) (-1169.862) -- 0:00:42
23500 -- (-1170.185) [-1170.529] (-1186.194) (-1177.770) * (-1185.609) (-1179.362) [-1180.891] (-1169.485) -- 0:00:41
24000 -- (-1168.145) (-1168.645) (-1176.332) [-1174.294] * (-1180.602) (-1182.565) (-1182.106) [-1170.919] -- 0:00:40
24500 -- (-1170.976) (-1170.399) [-1180.082] (-1179.861) * [-1173.715] (-1180.467) (-1189.540) (-1170.404) -- 0:00:39
25000 -- (-1171.018) (-1171.258) [-1178.491] (-1174.975) * (-1170.310) (-1183.818) (-1185.814) [-1172.884] -- 0:00:39
Average standard deviation of split frequencies: 0.059338
25500 -- [-1170.158] (-1170.870) (-1180.421) (-1177.430) * (-1170.387) (-1183.767) (-1181.260) [-1172.314] -- 0:00:38
26000 -- (-1169.194) (-1170.297) [-1177.633] (-1172.583) * (-1169.902) (-1183.448) (-1188.682) [-1172.792] -- 0:01:14
26500 -- (-1168.725) (-1171.611) (-1176.674) [-1172.898] * (-1172.238) (-1175.043) [-1173.953] (-1171.504) -- 0:01:13
27000 -- (-1169.443) (-1170.812) [-1179.400] (-1177.926) * (-1169.826) (-1187.993) [-1175.416] (-1170.946) -- 0:01:12
27500 -- [-1168.256] (-1170.785) (-1180.251) (-1181.202) * (-1168.716) [-1180.876] (-1173.565) (-1169.638) -- 0:01:10
28000 -- [-1168.448] (-1169.152) (-1180.919) (-1178.561) * (-1170.958) [-1175.281] (-1178.783) (-1168.756) -- 0:01:09
28500 -- (-1169.157) [-1169.066] (-1177.737) (-1188.408) * (-1168.976) (-1177.691) (-1177.211) [-1169.973] -- 0:01:08
29000 -- (-1172.549) (-1168.860) (-1177.576) [-1179.468] * (-1169.553) (-1194.600) [-1178.630] (-1169.103) -- 0:01:06
29500 -- (-1168.485) [-1168.131] (-1175.564) (-1180.992) * (-1168.785) (-1183.587) [-1178.055] (-1169.723) -- 0:01:05
30000 -- (-1168.239) (-1168.646) [-1176.571] (-1184.159) * [-1168.872] (-1179.290) (-1182.153) (-1168.944) -- 0:01:04
Average standard deviation of split frequencies: 0.052264
30500 -- [-1169.780] (-1174.341) (-1176.847) (-1180.818) * (-1171.759) [-1179.252] (-1174.900) (-1169.062) -- 0:01:03
31000 -- (-1168.428) [-1171.310] (-1175.521) (-1181.839) * (-1168.522) (-1184.938) (-1177.145) [-1169.440] -- 0:01:02
31500 -- [-1168.753] (-1173.076) (-1185.474) (-1177.639) * (-1170.592) (-1174.086) (-1178.052) [-1169.810] -- 0:01:01
32000 -- [-1168.909] (-1169.644) (-1186.885) (-1176.643) * (-1169.856) [-1176.611] (-1183.755) (-1169.868) -- 0:01:00
32500 -- [-1169.609] (-1170.402) (-1183.606) (-1176.693) * (-1174.609) (-1176.627) [-1178.131] (-1172.279) -- 0:00:59
33000 -- [-1172.316] (-1170.132) (-1185.061) (-1183.979) * (-1170.104) (-1177.503) (-1180.063) [-1168.931] -- 0:00:58
33500 -- (-1172.341) (-1169.518) (-1180.214) [-1178.228] * [-1168.345] (-1184.567) (-1185.401) (-1169.247) -- 0:00:57
34000 -- (-1168.988) (-1171.312) (-1178.542) [-1183.372] * (-1169.352) (-1183.616) (-1182.106) [-1173.345] -- 0:00:56
34500 -- (-1169.110) (-1170.222) (-1183.011) [-1176.049] * (-1169.506) (-1183.142) [-1184.896] (-1169.256) -- 0:00:55
35000 -- (-1170.140) (-1169.586) [-1175.256] (-1174.480) * [-1167.975] (-1180.385) (-1175.541) (-1168.682) -- 0:00:55
Average standard deviation of split frequencies: 0.039284
35500 -- [-1169.805] (-1170.132) (-1171.963) (-1181.551) * [-1168.566] (-1182.239) (-1179.677) (-1169.410) -- 0:00:54
36000 -- (-1172.908) (-1171.841) (-1169.309) [-1180.325] * (-1169.250) [-1182.875] (-1180.752) (-1168.429) -- 0:00:53
36500 -- (-1173.691) (-1172.424) [-1169.903] (-1180.926) * (-1169.449) [-1179.031] (-1184.109) (-1170.287) -- 0:00:52
37000 -- [-1169.803] (-1168.767) (-1170.312) (-1181.050) * [-1171.964] (-1187.403) (-1177.393) (-1169.457) -- 0:00:52
37500 -- [-1170.632] (-1170.408) (-1170.733) (-1187.466) * [-1174.724] (-1177.194) (-1176.884) (-1170.067) -- 0:00:51
38000 -- (-1170.297) (-1170.305) [-1168.699] (-1180.232) * (-1170.370) (-1181.671) [-1174.533] (-1171.494) -- 0:00:50
38500 -- [-1169.788] (-1169.299) (-1171.112) (-1180.455) * (-1167.992) (-1178.028) (-1178.760) [-1168.933] -- 0:00:49
39000 -- [-1169.707] (-1169.269) (-1174.512) (-1183.556) * [-1170.036] (-1179.592) (-1176.960) (-1170.693) -- 0:00:49
39500 -- (-1174.487) (-1169.303) (-1173.449) [-1179.535] * (-1171.148) [-1182.005] (-1178.405) (-1169.401) -- 0:00:48
40000 -- (-1174.661) [-1168.564] (-1171.712) (-1180.318) * (-1169.660) [-1181.746] (-1182.071) (-1169.725) -- 0:00:48
Average standard deviation of split frequencies: 0.048024
40500 -- (-1169.272) (-1169.171) (-1172.463) [-1174.644] * (-1169.269) [-1181.143] (-1170.091) (-1169.472) -- 0:00:47
41000 -- (-1171.149) [-1169.279] (-1169.146) (-1179.534) * (-1168.419) (-1175.922) (-1170.496) [-1169.209] -- 0:00:46
41500 -- (-1171.595) (-1169.540) [-1169.695] (-1183.003) * [-1168.579] (-1177.798) (-1171.553) (-1170.432) -- 0:01:09
42000 -- (-1171.260) [-1171.677] (-1171.552) (-1176.024) * (-1170.936) (-1178.335) (-1173.175) [-1168.919] -- 0:01:08
42500 -- (-1171.783) [-1168.675] (-1170.066) (-1174.882) * [-1169.205] (-1185.036) (-1172.250) (-1169.895) -- 0:01:07
43000 -- (-1169.702) (-1170.141) [-1169.288] (-1178.919) * (-1168.473) (-1179.167) [-1168.236] (-1172.694) -- 0:01:06
43500 -- (-1171.300) (-1169.808) (-1168.387) [-1180.228] * (-1170.213) (-1179.765) [-1169.760] (-1171.999) -- 0:01:05
44000 -- (-1175.924) [-1170.074] (-1168.859) (-1181.603) * (-1170.861) (-1188.393) (-1170.401) [-1171.049] -- 0:01:05
44500 -- (-1172.277) (-1168.947) [-1169.006] (-1178.144) * [-1168.868] (-1181.237) (-1168.866) (-1169.001) -- 0:01:04
45000 -- [-1172.563] (-1174.537) (-1170.976) (-1178.037) * [-1171.090] (-1178.858) (-1170.764) (-1168.876) -- 0:01:03
Average standard deviation of split frequencies: 0.042456
45500 -- (-1169.787) (-1171.032) (-1172.366) [-1179.625] * [-1170.087] (-1176.692) (-1174.079) (-1168.747) -- 0:01:02
46000 -- (-1170.138) [-1168.500] (-1170.337) (-1179.630) * [-1170.959] (-1181.903) (-1170.986) (-1169.230) -- 0:01:02
46500 -- (-1170.214) (-1168.496) (-1168.581) [-1181.483] * (-1170.193) [-1174.482] (-1170.744) (-1169.393) -- 0:01:01
47000 -- (-1170.213) (-1168.420) [-1168.299] (-1181.397) * (-1171.631) [-1175.939] (-1173.423) (-1169.377) -- 0:01:00
47500 -- (-1168.753) (-1169.387) [-1169.212] (-1178.604) * (-1169.671) (-1181.064) (-1172.297) [-1171.056] -- 0:01:00
48000 -- (-1169.127) (-1170.437) [-1169.066] (-1182.191) * [-1170.583] (-1174.300) (-1170.381) (-1171.799) -- 0:00:59
48500 -- [-1169.713] (-1169.280) (-1170.310) (-1177.911) * [-1174.735] (-1182.099) (-1172.998) (-1170.915) -- 0:00:58
49000 -- [-1168.933] (-1168.004) (-1170.291) (-1182.315) * (-1176.380) [-1178.894] (-1172.775) (-1173.595) -- 0:00:58
49500 -- (-1171.061) (-1173.626) (-1170.285) [-1181.762] * (-1169.753) (-1180.693) [-1168.009] (-1171.631) -- 0:00:57
50000 -- (-1172.834) [-1169.970] (-1170.552) (-1184.305) * (-1168.947) (-1179.549) [-1169.393] (-1169.478) -- 0:00:57
Average standard deviation of split frequencies: 0.041868
50500 -- (-1168.327) (-1172.671) (-1168.388) [-1176.572] * [-1168.427] (-1185.985) (-1171.792) (-1172.520) -- 0:00:56
51000 -- (-1169.364) [-1178.029] (-1167.937) (-1185.402) * (-1169.136) (-1176.430) (-1172.040) [-1170.814] -- 0:00:55
51500 -- [-1169.842] (-1171.542) (-1169.309) (-1192.865) * (-1168.952) (-1183.712) (-1171.462) [-1173.073] -- 0:00:55
52000 -- (-1168.726) [-1170.273] (-1172.190) (-1177.372) * [-1169.280] (-1179.389) (-1169.908) (-1169.291) -- 0:00:54
52500 -- (-1168.570) (-1170.440) [-1168.344] (-1176.673) * [-1169.219] (-1182.336) (-1167.801) (-1170.361) -- 0:00:54
53000 -- (-1170.365) (-1170.937) [-1169.163] (-1181.651) * (-1168.622) (-1178.704) (-1170.997) [-1168.746] -- 0:00:53
53500 -- (-1171.325) (-1172.190) (-1169.939) [-1178.250] * [-1169.720] (-1175.029) (-1168.917) (-1168.784) -- 0:00:53
54000 -- (-1171.626) [-1169.191] (-1170.384) (-1186.719) * [-1168.999] (-1183.070) (-1171.102) (-1173.271) -- 0:00:52
54500 -- (-1171.864) [-1170.525] (-1168.058) (-1182.290) * (-1170.951) [-1175.965] (-1171.230) (-1169.759) -- 0:00:52
55000 -- [-1171.103] (-1170.772) (-1174.025) (-1181.503) * [-1169.125] (-1179.145) (-1170.029) (-1169.246) -- 0:00:51
Average standard deviation of split frequencies: 0.038988
55500 -- (-1168.543) (-1169.433) (-1171.840) [-1178.581] * [-1169.884] (-1186.007) (-1171.064) (-1170.593) -- 0:00:51
56000 -- (-1169.489) (-1168.729) (-1171.703) [-1173.538] * (-1169.937) (-1185.968) [-1170.557] (-1171.054) -- 0:01:07
56500 -- (-1172.193) (-1171.370) [-1168.623] (-1173.905) * (-1168.668) (-1188.871) (-1171.182) [-1168.417] -- 0:01:06
57000 -- (-1174.325) (-1169.732) (-1171.656) [-1176.787] * (-1168.131) (-1181.394) [-1173.731] (-1169.679) -- 0:01:06
57500 -- (-1171.600) (-1169.602) [-1174.741] (-1183.674) * [-1168.152] (-1186.065) (-1173.552) (-1171.364) -- 0:01:05
58000 -- [-1171.870] (-1169.502) (-1169.878) (-1184.777) * [-1169.676] (-1177.105) (-1171.756) (-1171.487) -- 0:01:04
58500 -- (-1169.015) [-1167.980] (-1170.748) (-1181.210) * (-1168.936) (-1179.465) (-1168.271) [-1171.091] -- 0:01:04
59000 -- (-1169.050) (-1169.239) (-1172.414) [-1175.780] * (-1170.660) (-1192.263) (-1169.610) [-1169.348] -- 0:01:03
59500 -- (-1170.087) (-1172.303) (-1171.726) [-1175.820] * (-1169.213) [-1168.702] (-1170.809) (-1168.945) -- 0:01:03
60000 -- (-1168.888) [-1170.585] (-1170.139) (-1175.136) * (-1168.937) (-1173.737) [-1171.978] (-1171.148) -- 0:01:02
Average standard deviation of split frequencies: 0.036567
60500 -- (-1170.220) (-1171.483) (-1172.640) [-1174.026] * (-1168.567) [-1171.094] (-1171.937) (-1172.082) -- 0:01:02
61000 -- [-1168.808] (-1169.099) (-1175.313) (-1185.080) * (-1168.596) (-1170.148) (-1171.426) [-1170.410] -- 0:01:01
61500 -- [-1168.335] (-1170.028) (-1170.992) (-1178.624) * [-1168.659] (-1171.356) (-1169.168) (-1172.009) -- 0:01:01
62000 -- (-1170.235) [-1170.179] (-1170.881) (-1180.011) * (-1168.561) (-1171.149) [-1171.582] (-1172.678) -- 0:01:00
62500 -- (-1172.144) (-1169.515) [-1170.490] (-1179.577) * (-1169.025) (-1169.137) [-1170.706] (-1174.452) -- 0:01:00
63000 -- (-1168.725) (-1170.667) [-1171.913] (-1180.478) * (-1168.513) (-1171.058) [-1169.142] (-1173.216) -- 0:00:59
63500 -- (-1169.629) (-1170.969) [-1170.839] (-1175.883) * (-1169.976) (-1170.756) [-1168.209] (-1171.614) -- 0:00:58
64000 -- (-1169.543) (-1176.166) (-1169.365) [-1178.578] * (-1170.392) (-1170.905) [-1168.662] (-1169.935) -- 0:00:58
64500 -- (-1168.777) [-1171.331] (-1168.219) (-1177.634) * (-1172.927) [-1171.866] (-1168.900) (-1168.858) -- 0:00:58
65000 -- (-1168.489) (-1168.907) [-1168.301] (-1179.356) * [-1169.066] (-1168.507) (-1171.979) (-1170.541) -- 0:00:57
Average standard deviation of split frequencies: 0.029364
65500 -- (-1169.289) (-1171.464) [-1167.894] (-1185.504) * (-1169.996) (-1170.970) (-1167.622) [-1169.957] -- 0:00:57
66000 -- (-1170.272) (-1171.361) [-1169.957] (-1181.155) * (-1172.787) [-1168.360] (-1168.055) (-1171.986) -- 0:00:56
66500 -- [-1170.637] (-1169.090) (-1169.061) (-1187.287) * (-1168.396) [-1168.419] (-1170.618) (-1171.782) -- 0:00:56
67000 -- [-1172.931] (-1168.850) (-1168.294) (-1171.667) * (-1169.709) (-1168.533) [-1168.506] (-1169.735) -- 0:00:55
67500 -- (-1171.635) (-1169.041) (-1168.307) [-1176.463] * (-1169.831) (-1168.313) (-1169.945) [-1168.737] -- 0:00:55
68000 -- (-1168.429) (-1174.921) [-1170.578] (-1177.692) * (-1170.315) (-1170.032) [-1168.949] (-1168.871) -- 0:00:54
68500 -- (-1170.206) (-1171.622) [-1170.338] (-1185.570) * (-1173.861) (-1168.728) (-1169.547) [-1169.531] -- 0:00:54
69000 -- (-1174.329) [-1171.415] (-1169.043) (-1181.979) * (-1172.671) (-1168.507) (-1170.019) [-1170.029] -- 0:00:53
69500 -- [-1169.836] (-1169.470) (-1171.754) (-1185.346) * [-1173.480] (-1170.320) (-1171.351) (-1168.712) -- 0:00:53
70000 -- (-1170.442) [-1168.463] (-1170.310) (-1174.076) * (-1172.347) (-1168.159) [-1169.148] (-1170.455) -- 0:00:53
Average standard deviation of split frequencies: 0.024460
70500 -- (-1174.936) (-1168.467) [-1169.255] (-1174.247) * (-1172.387) [-1171.891] (-1170.681) (-1169.876) -- 0:00:52
71000 -- (-1171.353) [-1168.358] (-1171.675) (-1182.731) * [-1174.019] (-1171.367) (-1169.525) (-1171.426) -- 0:01:05
71500 -- (-1169.366) (-1171.756) (-1171.871) [-1177.733] * [-1171.107] (-1172.276) (-1167.970) (-1169.902) -- 0:01:04
72000 -- [-1170.220] (-1172.435) (-1170.271) (-1173.373) * (-1168.010) (-1170.372) (-1169.544) [-1169.807] -- 0:01:04
72500 -- (-1172.330) (-1169.099) [-1170.540] (-1183.332) * (-1170.856) [-1170.172] (-1171.432) (-1168.846) -- 0:01:03
73000 -- [-1169.758] (-1170.215) (-1170.916) (-1177.459) * (-1170.598) (-1172.980) [-1171.486] (-1168.932) -- 0:01:03
73500 -- [-1170.725] (-1172.294) (-1168.682) (-1186.455) * [-1170.598] (-1172.384) (-1169.488) (-1170.964) -- 0:01:03
74000 -- (-1168.634) (-1170.877) [-1169.302] (-1182.439) * [-1172.253] (-1169.302) (-1169.505) (-1174.890) -- 0:01:02
74500 -- [-1168.456] (-1170.989) (-1168.528) (-1181.980) * [-1170.624] (-1169.549) (-1170.364) (-1174.984) -- 0:01:02
75000 -- (-1172.670) (-1170.639) [-1168.575] (-1188.483) * (-1169.391) (-1170.494) (-1169.588) [-1174.414] -- 0:01:01
Average standard deviation of split frequencies: 0.024466
75500 -- (-1169.774) (-1170.107) (-1170.451) [-1174.783] * (-1169.104) (-1170.759) [-1169.635] (-1173.887) -- 0:01:01
76000 -- [-1170.043] (-1170.857) (-1170.645) (-1184.696) * (-1169.433) [-1172.416] (-1171.256) (-1171.411) -- 0:01:00
76500 -- [-1171.723] (-1173.586) (-1172.564) (-1170.278) * (-1171.123) [-1168.582] (-1169.272) (-1171.835) -- 0:01:00
77000 -- [-1170.240] (-1170.532) (-1172.026) (-1170.942) * [-1174.060] (-1169.439) (-1170.708) (-1170.310) -- 0:00:59
77500 -- [-1170.668] (-1169.970) (-1171.347) (-1170.880) * (-1169.990) (-1169.570) [-1168.806] (-1170.882) -- 0:00:59
78000 -- (-1168.944) (-1169.532) (-1171.794) [-1171.518] * (-1172.810) (-1170.324) [-1168.726] (-1169.943) -- 0:00:59
78500 -- (-1169.065) (-1171.471) [-1171.104] (-1170.443) * (-1171.736) (-1168.922) [-1172.392] (-1169.325) -- 0:00:58
79000 -- [-1170.908] (-1170.566) (-1170.139) (-1169.684) * [-1172.194] (-1168.817) (-1171.880) (-1170.579) -- 0:00:58
79500 -- [-1170.492] (-1171.199) (-1169.529) (-1168.990) * [-1169.924] (-1168.404) (-1173.024) (-1168.503) -- 0:00:57
80000 -- (-1170.639) (-1175.920) [-1169.614] (-1170.507) * [-1168.516] (-1169.279) (-1169.308) (-1171.341) -- 0:00:57
Average standard deviation of split frequencies: 0.022401
80500 -- (-1170.685) (-1172.277) (-1168.783) [-1170.187] * [-1168.022] (-1168.204) (-1169.358) (-1172.412) -- 0:00:57
81000 -- (-1170.508) (-1169.823) [-1170.173] (-1170.843) * (-1169.171) [-1169.362] (-1168.597) (-1168.193) -- 0:00:56
81500 -- (-1168.286) [-1172.112] (-1170.025) (-1173.039) * (-1169.242) (-1169.793) (-1169.123) [-1168.112] -- 0:00:56
82000 -- (-1167.885) (-1169.652) (-1169.670) [-1170.679] * (-1167.841) (-1169.946) (-1170.431) [-1169.153] -- 0:00:55
82500 -- [-1169.021] (-1170.618) (-1169.352) (-1168.671) * (-1168.453) [-1169.946] (-1173.423) (-1172.755) -- 0:00:55
83000 -- [-1169.595] (-1169.930) (-1169.640) (-1171.484) * [-1167.948] (-1170.271) (-1168.536) (-1170.535) -- 0:00:55
83500 -- (-1168.635) [-1169.475] (-1174.897) (-1169.031) * (-1168.245) (-1169.608) (-1167.900) [-1168.486] -- 0:00:54
84000 -- (-1171.383) (-1168.570) (-1172.284) [-1173.546] * [-1169.864] (-1173.457) (-1167.900) (-1168.776) -- 0:00:54
84500 -- [-1168.661] (-1168.075) (-1170.908) (-1174.142) * (-1169.905) (-1169.825) [-1169.753] (-1170.826) -- 0:00:54
85000 -- (-1172.813) [-1168.259] (-1171.942) (-1169.404) * (-1170.099) (-1171.101) [-1170.617] (-1168.893) -- 0:00:53
Average standard deviation of split frequencies: 0.019906
85500 -- [-1168.901] (-1170.229) (-1170.823) (-1167.859) * (-1170.741) (-1168.377) (-1172.020) [-1168.142] -- 0:00:53
86000 -- (-1173.439) (-1169.297) (-1170.565) [-1169.118] * (-1170.162) [-1168.740] (-1171.485) (-1169.956) -- 0:00:53
86500 -- (-1167.757) [-1171.875] (-1170.344) (-1171.151) * (-1168.929) (-1168.407) [-1174.757] (-1171.355) -- 0:00:52
87000 -- (-1168.731) [-1168.552] (-1171.298) (-1170.275) * (-1167.991) (-1174.440) (-1173.804) [-1168.596] -- 0:01:02
87500 -- (-1168.648) (-1169.243) (-1168.921) [-1172.863] * (-1167.800) (-1170.301) [-1171.224] (-1171.588) -- 0:01:02
88000 -- (-1170.039) (-1169.005) [-1169.012] (-1168.414) * (-1170.621) (-1168.544) (-1171.225) [-1168.077] -- 0:01:02
88500 -- (-1168.353) (-1169.598) (-1168.332) [-1170.453] * [-1171.128] (-1169.640) (-1171.185) (-1169.072) -- 0:01:01
89000 -- [-1169.159] (-1172.515) (-1169.757) (-1169.159) * (-1167.631) (-1169.203) (-1171.159) [-1169.195] -- 0:01:01
89500 -- [-1168.176] (-1174.139) (-1170.639) (-1168.248) * [-1170.214] (-1169.661) (-1173.076) (-1169.130) -- 0:01:01
90000 -- (-1168.531) (-1170.551) [-1171.981] (-1168.238) * [-1169.710] (-1168.345) (-1171.625) (-1169.029) -- 0:01:00
Average standard deviation of split frequencies: 0.020220
90500 -- (-1170.985) [-1170.231] (-1170.727) (-1168.325) * (-1170.808) (-1175.185) [-1171.104] (-1169.294) -- 0:01:00
91000 -- [-1168.526] (-1172.810) (-1174.238) (-1168.274) * (-1168.682) (-1175.198) [-1168.904] (-1168.210) -- 0:00:59
91500 -- [-1169.846] (-1171.898) (-1170.410) (-1169.850) * [-1168.937] (-1169.888) (-1171.334) (-1170.680) -- 0:00:59
92000 -- [-1176.542] (-1175.520) (-1171.611) (-1170.639) * [-1169.018] (-1168.207) (-1169.953) (-1170.546) -- 0:00:59
92500 -- [-1173.984] (-1177.566) (-1169.387) (-1173.288) * (-1174.158) (-1169.244) (-1173.819) [-1172.663] -- 0:00:58
93000 -- (-1170.308) (-1172.609) [-1171.064] (-1169.853) * (-1180.012) [-1175.878] (-1168.477) (-1171.288) -- 0:00:58
93500 -- (-1171.674) (-1168.991) [-1169.929] (-1168.858) * (-1170.882) [-1170.802] (-1168.875) (-1170.989) -- 0:00:58
94000 -- (-1171.782) (-1169.570) (-1168.056) [-1168.140] * (-1167.725) [-1172.796] (-1170.631) (-1170.963) -- 0:00:57
94500 -- [-1168.611] (-1169.570) (-1174.874) (-1168.628) * (-1168.483) (-1170.976) (-1171.616) [-1170.998] -- 0:00:57
95000 -- (-1171.400) (-1169.357) [-1169.400] (-1169.803) * (-1168.302) (-1171.674) [-1171.655] (-1171.904) -- 0:00:57
Average standard deviation of split frequencies: 0.022097
95500 -- (-1174.317) (-1168.123) (-1168.810) [-1170.298] * (-1168.495) (-1172.162) (-1175.101) [-1172.505] -- 0:00:56
96000 -- (-1172.542) (-1168.537) [-1168.965] (-1170.168) * [-1169.646] (-1171.700) (-1172.151) (-1170.666) -- 0:00:56
96500 -- (-1173.865) (-1168.784) (-1168.625) [-1171.629] * (-1168.120) (-1171.185) [-1171.401] (-1170.482) -- 0:00:56
97000 -- (-1174.505) [-1168.619] (-1172.115) (-1173.207) * [-1171.481] (-1172.504) (-1171.509) (-1170.102) -- 0:00:55
97500 -- (-1173.564) [-1168.888] (-1170.130) (-1175.456) * (-1173.518) (-1170.641) [-1168.478] (-1169.590) -- 0:00:55
98000 -- (-1170.971) (-1173.021) [-1172.973] (-1175.914) * (-1174.964) [-1168.643] (-1170.942) (-1169.856) -- 0:00:55
98500 -- (-1170.167) (-1171.282) [-1169.003] (-1170.843) * (-1177.759) (-1170.571) [-1169.276] (-1174.526) -- 0:00:54
99000 -- (-1170.550) (-1171.049) (-1173.769) [-1169.797] * (-1172.828) [-1174.080] (-1169.593) (-1172.442) -- 0:00:54
99500 -- (-1172.082) [-1172.416] (-1168.677) (-1169.049) * (-1169.082) (-1172.253) (-1169.446) [-1174.140] -- 0:00:54
100000 -- (-1169.187) [-1170.023] (-1170.148) (-1174.193) * (-1169.175) [-1168.452] (-1170.179) (-1172.640) -- 0:00:54
Average standard deviation of split frequencies: 0.023674
100500 -- [-1169.403] (-1171.315) (-1169.995) (-1168.737) * (-1169.850) (-1170.692) [-1173.735] (-1170.113) -- 0:00:53
101000 -- (-1168.085) [-1172.559] (-1170.567) (-1169.189) * [-1169.696] (-1169.905) (-1171.167) (-1170.897) -- 0:00:53
101500 -- [-1171.371] (-1171.945) (-1169.882) (-1170.300) * (-1174.496) [-1169.262] (-1169.673) (-1170.886) -- 0:00:53
102000 -- [-1170.537] (-1170.202) (-1171.345) (-1171.586) * (-1174.142) (-1171.196) (-1172.110) [-1170.739] -- 0:00:52
102500 -- (-1169.050) [-1171.504] (-1169.072) (-1169.795) * (-1174.069) (-1173.479) (-1168.354) [-1170.517] -- 0:00:52
103000 -- (-1168.312) (-1168.168) [-1169.755] (-1171.263) * [-1172.377] (-1172.641) (-1168.199) (-1172.606) -- 0:01:00
103500 -- (-1172.145) (-1170.671) (-1170.318) [-1167.720] * (-1173.096) (-1169.795) [-1168.675] (-1168.144) -- 0:01:00
104000 -- (-1171.550) [-1168.537] (-1173.963) (-1170.950) * (-1174.288) [-1168.712] (-1169.613) (-1167.751) -- 0:01:00
104500 -- (-1169.284) (-1168.008) [-1169.119] (-1168.496) * (-1172.323) (-1169.519) [-1169.656] (-1170.259) -- 0:00:59
105000 -- (-1171.499) (-1168.305) (-1167.788) [-1168.057] * (-1170.213) (-1168.465) [-1171.217] (-1170.711) -- 0:00:59
Average standard deviation of split frequencies: 0.020260
105500 -- (-1169.498) (-1169.144) (-1168.722) [-1168.443] * (-1170.864) (-1168.994) [-1171.307] (-1169.301) -- 0:00:59
106000 -- (-1169.796) (-1168.556) [-1170.475] (-1169.315) * (-1171.785) (-1168.067) [-1168.243] (-1171.374) -- 0:00:59
106500 -- (-1169.857) (-1170.140) [-1170.032] (-1168.952) * (-1171.134) (-1169.740) (-1170.058) [-1170.781] -- 0:00:58
107000 -- [-1171.721] (-1170.173) (-1168.372) (-1169.618) * (-1169.776) (-1169.965) [-1172.534] (-1171.228) -- 0:00:58
107500 -- [-1169.187] (-1169.628) (-1177.010) (-1169.316) * (-1173.138) [-1169.760] (-1175.149) (-1171.645) -- 0:00:58
108000 -- (-1176.986) [-1169.935] (-1168.871) (-1170.108) * [-1169.819] (-1170.010) (-1176.817) (-1168.037) -- 0:00:57
108500 -- [-1172.701] (-1170.476) (-1168.481) (-1169.852) * (-1168.052) [-1170.013] (-1171.813) (-1171.200) -- 0:00:57
109000 -- (-1176.874) (-1169.483) (-1170.827) [-1170.782] * (-1170.102) [-1168.791] (-1171.500) (-1168.046) -- 0:00:57
109500 -- [-1171.046] (-1169.483) (-1170.635) (-1173.049) * (-1170.605) [-1171.453] (-1170.270) (-1168.027) -- 0:00:56
110000 -- (-1169.993) [-1168.446] (-1171.497) (-1169.549) * (-1169.001) (-1169.158) (-1167.686) [-1169.420] -- 0:00:56
Average standard deviation of split frequencies: 0.019879
110500 -- (-1172.244) (-1171.574) [-1170.178] (-1170.549) * (-1168.241) (-1169.574) [-1168.467] (-1170.113) -- 0:00:56
111000 -- (-1171.831) (-1170.929) [-1170.668] (-1169.004) * [-1167.883] (-1169.091) (-1168.142) (-1173.605) -- 0:00:56
111500 -- (-1168.002) (-1171.819) (-1170.691) [-1169.270] * (-1169.357) (-1169.091) (-1168.728) [-1170.540] -- 0:00:55
112000 -- [-1168.668] (-1173.409) (-1168.767) (-1170.761) * (-1168.426) (-1170.054) [-1169.579] (-1168.187) -- 0:00:55
112500 -- (-1170.722) (-1181.503) (-1169.331) [-1169.388] * (-1168.058) [-1168.467] (-1169.735) (-1168.238) -- 0:00:55
113000 -- (-1168.204) (-1171.137) [-1169.358] (-1173.004) * (-1168.847) [-1168.410] (-1168.231) (-1167.974) -- 0:00:54
113500 -- [-1168.035] (-1169.490) (-1169.079) (-1170.672) * (-1169.803) [-1170.517] (-1171.735) (-1168.721) -- 0:00:54
114000 -- [-1170.883] (-1169.861) (-1172.931) (-1168.188) * [-1169.393] (-1169.361) (-1170.119) (-1171.102) -- 0:00:54
114500 -- (-1168.980) (-1172.919) [-1170.050] (-1169.415) * (-1169.176) (-1170.580) (-1171.081) [-1171.547] -- 0:00:54
115000 -- (-1173.601) [-1171.880] (-1168.941) (-1168.414) * [-1168.492] (-1171.540) (-1171.243) (-1175.420) -- 0:00:53
Average standard deviation of split frequencies: 0.019642
115500 -- [-1171.666] (-1169.926) (-1169.075) (-1169.686) * [-1167.868] (-1171.521) (-1169.402) (-1174.612) -- 0:00:53
116000 -- (-1169.870) (-1169.449) [-1168.855] (-1171.802) * (-1170.270) (-1171.140) (-1171.085) [-1170.803] -- 0:00:53
116500 -- (-1169.397) (-1168.105) (-1168.150) [-1168.574] * [-1171.151] (-1172.118) (-1171.003) (-1170.639) -- 0:00:53
117000 -- (-1170.044) [-1168.533] (-1168.833) (-1168.762) * (-1169.139) (-1171.866) [-1171.727] (-1168.475) -- 0:00:52
117500 -- [-1171.186] (-1171.378) (-1172.151) (-1169.653) * [-1167.863] (-1170.683) (-1169.133) (-1170.076) -- 0:00:52
118000 -- (-1170.155) [-1170.332] (-1172.337) (-1173.215) * (-1169.170) (-1168.565) (-1169.571) [-1169.682] -- 0:00:52
118500 -- (-1168.688) (-1171.628) (-1169.894) [-1168.656] * (-1169.978) (-1169.487) (-1168.609) [-1169.906] -- 0:00:52
119000 -- [-1171.072] (-1171.733) (-1170.436) (-1169.023) * (-1172.447) [-1169.760] (-1171.231) (-1170.201) -- 0:00:59
119500 -- (-1168.673) [-1169.558] (-1170.681) (-1168.526) * (-1171.334) [-1168.757] (-1171.372) (-1173.564) -- 0:00:58
120000 -- [-1168.201] (-1170.932) (-1170.606) (-1168.676) * (-1169.037) [-1170.883] (-1174.164) (-1169.622) -- 0:00:58
Average standard deviation of split frequencies: 0.016278
120500 -- (-1169.766) (-1173.011) (-1170.784) [-1169.313] * (-1170.023) (-1171.120) (-1169.781) [-1170.221] -- 0:00:58
121000 -- [-1172.501] (-1169.333) (-1172.701) (-1171.672) * (-1168.572) (-1169.877) [-1168.662] (-1171.606) -- 0:00:58
121500 -- (-1170.580) [-1169.867] (-1172.640) (-1171.573) * (-1168.383) (-1171.481) [-1170.711] (-1171.249) -- 0:00:57
122000 -- (-1169.991) (-1169.544) (-1170.217) [-1171.401] * (-1168.206) (-1169.410) (-1168.477) [-1170.598] -- 0:00:57
122500 -- [-1168.836] (-1169.496) (-1172.127) (-1168.698) * [-1168.477] (-1176.253) (-1172.987) (-1169.191) -- 0:00:57
123000 -- (-1174.884) [-1169.924] (-1170.530) (-1171.262) * [-1168.516] (-1177.886) (-1171.560) (-1170.657) -- 0:00:57
123500 -- (-1170.957) [-1168.821] (-1170.680) (-1172.375) * (-1169.663) (-1175.409) (-1169.150) [-1170.757] -- 0:00:56
124000 -- (-1171.341) (-1168.377) [-1168.658] (-1169.822) * (-1170.701) [-1172.559] (-1170.062) (-1169.041) -- 0:00:56
124500 -- (-1170.793) (-1171.739) [-1168.692] (-1169.742) * (-1171.497) [-1167.941] (-1170.015) (-1168.213) -- 0:00:56
125000 -- (-1171.199) (-1170.527) (-1168.829) [-1172.145] * (-1172.509) [-1168.816] (-1170.178) (-1171.393) -- 0:00:56
Average standard deviation of split frequencies: 0.018903
125500 -- [-1171.627] (-1172.082) (-1174.820) (-1174.090) * (-1172.017) (-1170.259) (-1169.437) [-1169.666] -- 0:00:55
126000 -- (-1173.370) [-1171.043] (-1171.865) (-1177.364) * [-1168.855] (-1169.331) (-1169.637) (-1171.019) -- 0:00:55
126500 -- [-1172.081] (-1168.399) (-1169.312) (-1175.709) * (-1168.857) (-1175.808) (-1169.793) [-1173.947] -- 0:00:55
127000 -- [-1171.701] (-1177.785) (-1169.777) (-1173.004) * [-1168.496] (-1170.709) (-1170.084) (-1168.005) -- 0:00:54
127500 -- (-1171.042) (-1177.495) [-1169.427] (-1169.981) * (-1170.437) [-1170.125] (-1170.643) (-1168.734) -- 0:00:54
128000 -- [-1171.331] (-1171.770) (-1168.620) (-1168.794) * (-1168.447) (-1168.496) [-1172.157] (-1169.356) -- 0:00:54
128500 -- (-1169.485) [-1168.622] (-1169.853) (-1170.718) * [-1168.559] (-1168.980) (-1169.314) (-1169.854) -- 0:00:54
129000 -- (-1170.473) [-1168.642] (-1169.393) (-1168.380) * (-1168.300) [-1168.836] (-1169.665) (-1170.726) -- 0:00:54
129500 -- (-1173.741) (-1169.431) [-1171.353] (-1171.704) * (-1169.963) (-1168.534) [-1170.469] (-1176.615) -- 0:00:53
130000 -- [-1170.672] (-1172.155) (-1170.250) (-1170.554) * (-1170.653) [-1172.220] (-1171.915) (-1178.421) -- 0:00:53
Average standard deviation of split frequencies: 0.020644
130500 -- [-1170.941] (-1168.195) (-1170.974) (-1168.725) * (-1170.202) (-1175.574) [-1168.145] (-1174.027) -- 0:00:53
131000 -- (-1170.474) [-1168.825] (-1171.392) (-1172.434) * (-1169.006) (-1176.462) [-1168.463] (-1168.881) -- 0:00:53
131500 -- [-1169.676] (-1169.877) (-1172.399) (-1170.419) * [-1168.106] (-1172.376) (-1168.915) (-1168.427) -- 0:00:52
132000 -- (-1176.764) [-1172.506] (-1174.101) (-1169.778) * (-1170.519) (-1169.737) [-1169.182] (-1170.548) -- 0:00:52
132500 -- [-1167.843] (-1169.409) (-1169.644) (-1170.301) * [-1170.114] (-1169.977) (-1170.093) (-1169.141) -- 0:00:52
133000 -- [-1170.281] (-1170.492) (-1170.519) (-1170.737) * (-1175.480) (-1169.571) (-1171.141) [-1168.410] -- 0:00:52
133500 -- (-1168.571) (-1168.352) [-1172.329] (-1169.215) * (-1174.278) (-1168.237) (-1169.600) [-1168.427] -- 0:00:51
134000 -- [-1168.275] (-1168.751) (-1169.961) (-1168.892) * (-1171.279) [-1168.793] (-1171.532) (-1168.413) -- 0:00:51
134500 -- (-1168.914) (-1168.417) (-1170.442) [-1171.250] * (-1173.403) (-1169.753) [-1170.885] (-1168.413) -- 0:00:51
135000 -- (-1170.955) [-1169.889] (-1173.345) (-1169.701) * (-1170.010) [-1170.893] (-1170.286) (-1168.414) -- 0:00:57
Average standard deviation of split frequencies: 0.020250
135500 -- (-1168.126) [-1170.393] (-1169.908) (-1172.597) * (-1169.849) (-1169.397) [-1171.503] (-1168.662) -- 0:00:57
136000 -- [-1168.903] (-1171.669) (-1168.436) (-1170.797) * (-1170.848) (-1169.555) (-1170.971) [-1172.552] -- 0:00:57
136500 -- (-1170.848) (-1172.278) [-1168.613] (-1175.052) * (-1172.819) (-1169.614) [-1168.507] (-1170.487) -- 0:00:56
137000 -- (-1168.972) (-1170.759) [-1171.879] (-1174.096) * [-1170.482] (-1169.914) (-1168.544) (-1168.999) -- 0:00:56
137500 -- (-1168.568) (-1170.016) (-1169.679) [-1171.966] * (-1174.937) (-1170.515) [-1168.348] (-1169.642) -- 0:00:56
138000 -- (-1168.620) [-1168.849] (-1171.791) (-1173.680) * (-1170.080) (-1169.526) [-1168.430] (-1170.046) -- 0:00:56
138500 -- [-1168.512] (-1169.868) (-1177.387) (-1179.031) * [-1170.094] (-1168.926) (-1168.747) (-1170.946) -- 0:00:55
139000 -- (-1168.294) (-1172.457) (-1168.731) [-1179.265] * [-1169.845] (-1169.661) (-1173.270) (-1170.404) -- 0:00:55
139500 -- [-1170.175] (-1168.380) (-1168.727) (-1171.659) * [-1171.659] (-1169.636) (-1173.261) (-1167.846) -- 0:00:55
140000 -- (-1170.653) (-1170.571) [-1168.061] (-1168.763) * (-1168.786) [-1170.301] (-1169.081) (-1173.085) -- 0:00:55
Average standard deviation of split frequencies: 0.020293
140500 -- (-1170.586) [-1170.614] (-1168.187) (-1170.673) * (-1172.978) [-1169.016] (-1169.500) (-1170.268) -- 0:00:55
141000 -- (-1169.450) [-1170.953] (-1167.927) (-1169.903) * (-1173.100) (-1170.077) [-1168.681] (-1169.479) -- 0:00:54
141500 -- [-1172.690] (-1172.692) (-1169.720) (-1169.540) * (-1173.933) (-1170.340) [-1169.465] (-1169.574) -- 0:00:54
142000 -- (-1169.644) (-1175.581) [-1168.832] (-1169.537) * [-1171.850] (-1171.252) (-1170.340) (-1171.946) -- 0:00:54
142500 -- (-1170.079) (-1169.136) [-1169.878] (-1169.036) * [-1168.611] (-1170.566) (-1169.311) (-1169.622) -- 0:00:54
143000 -- (-1170.144) (-1169.962) [-1171.119] (-1173.313) * (-1168.651) [-1169.851] (-1170.413) (-1169.624) -- 0:00:53
143500 -- (-1172.500) (-1170.342) [-1168.227] (-1173.041) * (-1172.077) (-1172.863) [-1168.062] (-1168.829) -- 0:00:53
144000 -- (-1175.933) [-1171.647] (-1170.724) (-1169.177) * (-1168.101) [-1173.188] (-1173.264) (-1169.858) -- 0:00:53
144500 -- [-1171.199] (-1169.507) (-1168.437) (-1169.848) * [-1169.556] (-1168.295) (-1170.217) (-1169.139) -- 0:00:53
145000 -- (-1172.126) (-1172.515) (-1170.953) [-1170.382] * (-1171.441) (-1168.343) [-1169.850] (-1169.146) -- 0:00:53
Average standard deviation of split frequencies: 0.020826
145500 -- (-1175.082) (-1169.072) (-1171.180) [-1172.572] * (-1171.105) [-1168.729] (-1174.097) (-1169.283) -- 0:00:52
146000 -- (-1170.028) (-1169.125) [-1169.059] (-1169.751) * [-1168.648] (-1168.535) (-1170.602) (-1169.137) -- 0:00:52
146500 -- (-1169.391) (-1170.678) [-1169.422] (-1171.301) * (-1167.665) (-1170.618) (-1173.035) [-1172.135] -- 0:00:52
147000 -- (-1168.535) [-1168.221] (-1168.185) (-1172.780) * (-1168.862) (-1170.990) [-1168.304] (-1170.608) -- 0:00:52
147500 -- (-1169.165) (-1168.202) [-1168.961] (-1174.462) * (-1168.338) (-1171.217) (-1169.748) [-1170.385] -- 0:00:52
148000 -- [-1169.182] (-1169.491) (-1171.894) (-1169.849) * (-1168.499) (-1169.230) (-1170.869) [-1169.688] -- 0:00:51
148500 -- (-1167.916) [-1168.270] (-1172.721) (-1170.877) * (-1168.511) (-1175.411) (-1170.000) [-1169.472] -- 0:00:51
149000 -- (-1169.255) (-1168.245) (-1167.903) [-1168.907] * (-1170.349) (-1170.327) [-1169.919] (-1170.657) -- 0:00:51
149500 -- [-1168.687] (-1169.034) (-1170.469) (-1169.996) * (-1174.430) (-1172.611) [-1168.989] (-1171.445) -- 0:00:51
150000 -- (-1172.582) [-1169.438] (-1171.418) (-1171.922) * [-1168.969] (-1169.488) (-1168.682) (-1171.986) -- 0:00:51
Average standard deviation of split frequencies: 0.018077
150500 -- [-1173.568] (-1168.540) (-1174.694) (-1172.565) * (-1169.298) (-1174.036) [-1168.149] (-1172.612) -- 0:00:50
151000 -- (-1173.353) [-1170.748] (-1169.448) (-1175.037) * (-1170.615) (-1170.476) (-1168.766) [-1170.217] -- 0:00:50
151500 -- (-1173.633) [-1171.432] (-1169.877) (-1170.900) * (-1171.690) (-1170.346) (-1169.704) [-1170.358] -- 0:00:56
152000 -- (-1175.539) [-1170.524] (-1175.182) (-1168.922) * (-1170.518) (-1173.512) [-1169.415] (-1169.092) -- 0:00:55
152500 -- [-1170.698] (-1168.852) (-1170.272) (-1169.712) * (-1168.291) (-1172.152) (-1169.222) [-1168.359] -- 0:00:55
153000 -- (-1171.273) [-1170.328] (-1173.087) (-1169.387) * [-1168.461] (-1169.710) (-1168.845) (-1168.268) -- 0:00:55
153500 -- [-1170.185] (-1170.279) (-1172.778) (-1169.778) * (-1168.649) [-1169.169] (-1171.205) (-1168.338) -- 0:00:55
154000 -- (-1171.019) (-1172.995) [-1170.699] (-1171.099) * [-1170.930] (-1172.255) (-1168.719) (-1171.946) -- 0:00:54
154500 -- (-1172.661) [-1170.451] (-1171.148) (-1172.216) * (-1168.617) [-1171.766] (-1168.906) (-1169.882) -- 0:00:54
155000 -- (-1169.229) [-1170.462] (-1173.901) (-1173.640) * (-1173.310) [-1175.050] (-1168.233) (-1169.810) -- 0:00:54
Average standard deviation of split frequencies: 0.017292
155500 -- (-1170.056) [-1170.263] (-1173.608) (-1171.086) * (-1172.003) [-1170.466] (-1171.343) (-1173.235) -- 0:00:54
156000 -- [-1169.330] (-1171.522) (-1168.425) (-1171.230) * (-1171.469) (-1173.333) [-1169.637] (-1170.660) -- 0:00:54
156500 -- [-1169.248] (-1172.088) (-1169.494) (-1170.909) * (-1169.415) (-1172.903) [-1169.079] (-1170.176) -- 0:00:53
157000 -- (-1169.273) (-1169.757) [-1172.260] (-1169.108) * (-1172.407) (-1170.701) [-1169.672] (-1169.163) -- 0:00:53
157500 -- [-1170.536] (-1170.458) (-1172.063) (-1169.807) * (-1172.458) (-1169.949) (-1170.438) [-1171.660] -- 0:00:53
158000 -- (-1174.257) [-1168.950] (-1177.465) (-1170.540) * [-1170.272] (-1175.329) (-1170.693) (-1168.576) -- 0:00:53
158500 -- (-1172.557) [-1169.794] (-1173.574) (-1169.493) * (-1170.941) [-1170.262] (-1172.514) (-1170.517) -- 0:00:53
159000 -- (-1170.423) [-1169.792] (-1173.064) (-1170.453) * [-1172.188] (-1170.801) (-1171.671) (-1172.072) -- 0:00:52
159500 -- (-1173.738) (-1171.129) [-1168.555] (-1170.555) * [-1172.415] (-1169.048) (-1172.839) (-1175.990) -- 0:00:52
160000 -- (-1173.367) (-1173.244) (-1168.092) [-1171.800] * [-1169.836] (-1169.628) (-1173.124) (-1170.143) -- 0:00:52
Average standard deviation of split frequencies: 0.019457
160500 -- (-1174.924) (-1172.076) [-1168.879] (-1171.288) * (-1169.790) [-1167.945] (-1169.460) (-1169.201) -- 0:00:52
161000 -- (-1173.942) (-1172.383) (-1170.657) [-1172.655] * [-1170.677] (-1168.030) (-1172.581) (-1169.642) -- 0:00:52
161500 -- (-1174.228) (-1169.115) (-1168.886) [-1172.214] * (-1170.750) (-1173.268) [-1168.837] (-1169.135) -- 0:00:51
162000 -- (-1171.798) [-1169.816] (-1170.749) (-1169.624) * [-1171.618] (-1169.472) (-1169.062) (-1170.564) -- 0:00:51
162500 -- (-1169.364) (-1169.692) (-1169.756) [-1168.502] * (-1171.055) (-1168.587) [-1172.836] (-1170.195) -- 0:00:51
163000 -- (-1173.409) (-1173.513) (-1173.037) [-1168.265] * (-1169.537) [-1170.860] (-1170.046) (-1170.319) -- 0:00:51
163500 -- (-1171.719) (-1170.645) (-1173.126) [-1171.245] * (-1170.169) (-1171.217) [-1169.079] (-1170.953) -- 0:00:51
164000 -- (-1172.524) (-1170.093) [-1169.475] (-1170.176) * (-1170.329) (-1169.100) [-1167.851] (-1169.869) -- 0:00:50
164500 -- (-1171.121) [-1171.143] (-1172.581) (-1171.087) * (-1169.141) [-1168.485] (-1168.004) (-1169.521) -- 0:00:50
165000 -- [-1168.661] (-1177.186) (-1170.587) (-1169.081) * [-1169.601] (-1168.472) (-1172.138) (-1173.698) -- 0:00:50
Average standard deviation of split frequencies: 0.021014
165500 -- (-1171.486) (-1175.142) (-1170.243) [-1169.483] * (-1171.403) [-1168.562] (-1172.027) (-1170.801) -- 0:00:50
166000 -- [-1171.389] (-1168.082) (-1172.119) (-1171.258) * (-1169.535) (-1168.376) (-1170.126) [-1168.884] -- 0:00:50
166500 -- [-1170.267] (-1170.071) (-1171.845) (-1171.935) * (-1170.184) [-1168.554] (-1169.810) (-1170.473) -- 0:00:50
167000 -- (-1170.238) (-1173.736) (-1169.998) [-1170.656] * (-1173.063) (-1172.691) [-1170.115] (-1168.919) -- 0:00:49
167500 -- (-1171.694) (-1168.349) (-1169.790) [-1171.341] * (-1173.312) [-1170.181] (-1172.295) (-1169.486) -- 0:00:54
168000 -- (-1170.896) (-1168.999) [-1172.014] (-1169.566) * (-1168.550) (-1176.697) [-1168.235] (-1171.109) -- 0:00:54
168500 -- (-1171.983) (-1168.212) (-1170.167) [-1169.298] * (-1168.345) (-1170.983) (-1170.321) [-1168.645] -- 0:00:54
169000 -- [-1170.607] (-1168.036) (-1169.373) (-1169.865) * [-1169.562] (-1170.883) (-1171.013) (-1170.530) -- 0:00:54
169500 -- (-1169.902) (-1168.609) (-1171.907) [-1168.870] * (-1168.822) (-1171.540) (-1170.675) [-1168.852] -- 0:00:53
170000 -- (-1172.269) (-1170.675) [-1171.160] (-1169.181) * (-1169.211) (-1169.142) [-1169.391] (-1169.809) -- 0:00:53
Average standard deviation of split frequencies: 0.019181
170500 -- (-1169.770) (-1169.678) [-1169.947] (-1168.684) * [-1168.437] (-1169.177) (-1169.964) (-1169.806) -- 0:00:53
171000 -- (-1171.320) (-1169.326) (-1171.818) [-1171.886] * (-1168.381) [-1170.984] (-1172.824) (-1172.734) -- 0:00:53
171500 -- (-1170.691) (-1171.697) (-1173.910) [-1170.969] * (-1168.758) (-1168.463) (-1170.305) [-1168.572] -- 0:00:53
172000 -- (-1168.812) (-1172.785) [-1168.438] (-1174.533) * [-1169.732] (-1173.253) (-1169.239) (-1168.697) -- 0:00:52
172500 -- [-1168.995] (-1171.914) (-1169.241) (-1169.325) * (-1170.269) (-1171.672) [-1169.122] (-1168.948) -- 0:00:52
173000 -- (-1168.796) (-1169.148) (-1172.293) [-1169.218] * [-1169.578] (-1172.478) (-1171.208) (-1172.421) -- 0:00:52
173500 -- [-1168.714] (-1169.735) (-1171.002) (-1172.784) * (-1169.875) [-1172.560] (-1169.583) (-1171.223) -- 0:00:52
174000 -- [-1169.358] (-1168.175) (-1169.852) (-1173.002) * (-1169.696) (-1170.299) [-1172.961] (-1168.020) -- 0:00:52
174500 -- (-1173.230) (-1169.726) [-1170.441] (-1168.588) * (-1171.967) [-1168.668] (-1171.569) (-1168.000) -- 0:00:52
175000 -- (-1169.145) (-1169.338) (-1170.598) [-1168.642] * (-1177.872) [-1167.953] (-1174.111) (-1170.641) -- 0:00:51
Average standard deviation of split frequencies: 0.018591
175500 -- (-1169.964) [-1168.350] (-1172.626) (-1168.660) * (-1170.247) (-1168.414) [-1171.656] (-1171.876) -- 0:00:51
176000 -- [-1167.865] (-1170.164) (-1170.609) (-1168.305) * (-1172.694) [-1168.276] (-1168.516) (-1172.866) -- 0:00:51
176500 -- (-1170.621) [-1170.968] (-1169.734) (-1169.775) * (-1173.710) (-1168.071) (-1169.071) [-1170.118] -- 0:00:51
177000 -- (-1172.748) [-1170.347] (-1171.062) (-1174.229) * (-1174.759) (-1169.243) [-1170.324] (-1170.371) -- 0:00:51
177500 -- (-1171.136) [-1171.281] (-1171.743) (-1170.162) * (-1169.333) [-1170.673] (-1169.707) (-1170.991) -- 0:00:50
178000 -- (-1172.156) [-1170.836] (-1170.581) (-1169.277) * [-1168.458] (-1168.243) (-1176.737) (-1169.572) -- 0:00:50
178500 -- (-1169.860) [-1170.827] (-1170.865) (-1169.878) * [-1171.515] (-1168.055) (-1172.088) (-1169.740) -- 0:00:50
179000 -- (-1171.772) [-1169.631] (-1171.860) (-1168.536) * (-1172.147) [-1168.264] (-1169.028) (-1170.792) -- 0:00:50
179500 -- [-1168.432] (-1174.945) (-1170.553) (-1169.838) * (-1168.855) [-1168.190] (-1169.665) (-1169.540) -- 0:00:50
180000 -- (-1168.135) (-1172.932) (-1169.954) [-1168.330] * (-1169.602) [-1168.507] (-1168.395) (-1168.456) -- 0:00:50
Average standard deviation of split frequencies: 0.020567
180500 -- (-1168.628) (-1171.671) [-1170.074] (-1167.856) * (-1169.417) [-1168.897] (-1170.444) (-1169.531) -- 0:00:49
181000 -- [-1168.724] (-1171.516) (-1174.200) (-1168.749) * (-1169.247) [-1170.392] (-1168.668) (-1171.722) -- 0:00:49
181500 -- (-1168.430) (-1172.057) [-1169.163] (-1167.859) * [-1168.899] (-1168.295) (-1169.075) (-1169.514) -- 0:00:49
182000 -- (-1168.735) (-1172.213) (-1169.992) [-1169.066] * (-1170.362) (-1168.869) [-1167.966] (-1169.545) -- 0:00:49
182500 -- [-1169.631] (-1169.717) (-1171.864) (-1170.884) * [-1172.168] (-1171.285) (-1169.230) (-1171.021) -- 0:00:49
183000 -- (-1168.285) (-1169.135) [-1171.033] (-1171.914) * (-1170.067) (-1174.415) (-1168.514) [-1169.080] -- 0:00:49
183500 -- (-1168.308) [-1168.996] (-1171.173) (-1168.834) * (-1168.969) (-1172.132) (-1167.876) [-1169.073] -- 0:00:53
184000 -- (-1168.749) (-1168.077) [-1170.364] (-1168.834) * (-1169.722) [-1171.984] (-1170.820) (-1169.526) -- 0:00:53
184500 -- (-1170.375) (-1173.205) (-1171.584) [-1168.609] * (-1170.512) (-1171.786) [-1171.573] (-1170.345) -- 0:00:53
185000 -- (-1173.551) (-1170.695) [-1170.140] (-1172.358) * (-1170.225) (-1169.774) [-1172.126] (-1168.912) -- 0:00:52
Average standard deviation of split frequencies: 0.020275
185500 -- [-1169.164] (-1170.978) (-1168.863) (-1174.808) * (-1171.553) [-1169.626] (-1175.642) (-1168.270) -- 0:00:52
186000 -- (-1168.067) [-1169.226] (-1168.100) (-1168.671) * (-1172.829) [-1169.978] (-1173.683) (-1169.993) -- 0:00:52
186500 -- (-1169.429) (-1169.298) [-1168.152] (-1171.677) * (-1178.982) [-1170.284] (-1171.702) (-1172.088) -- 0:00:52
187000 -- (-1171.955) (-1173.165) (-1168.709) [-1171.435] * (-1174.542) (-1168.390) (-1169.628) [-1169.079] -- 0:00:52
187500 -- (-1171.277) [-1173.775] (-1174.482) (-1169.573) * (-1169.536) [-1171.253] (-1170.977) (-1168.955) -- 0:00:52
188000 -- [-1173.239] (-1174.111) (-1169.582) (-1168.888) * [-1170.079] (-1168.248) (-1172.473) (-1170.957) -- 0:00:51
188500 -- [-1169.700] (-1172.222) (-1171.910) (-1170.182) * [-1170.589] (-1168.190) (-1169.010) (-1171.409) -- 0:00:51
189000 -- (-1174.324) (-1172.779) (-1169.880) [-1169.341] * (-1173.081) (-1171.155) [-1170.932] (-1175.185) -- 0:00:51
189500 -- [-1168.947] (-1174.111) (-1174.715) (-1173.472) * [-1172.807] (-1169.475) (-1169.115) (-1172.596) -- 0:00:51
190000 -- (-1170.697) [-1175.287] (-1171.532) (-1171.835) * (-1176.920) (-1171.045) [-1168.326] (-1169.537) -- 0:00:51
Average standard deviation of split frequencies: 0.019052
190500 -- (-1168.812) (-1173.499) (-1173.563) [-1168.884] * (-1169.593) (-1171.142) [-1167.836] (-1172.781) -- 0:00:50
191000 -- (-1171.988) [-1170.261] (-1172.973) (-1169.629) * (-1169.525) [-1168.739] (-1169.294) (-1171.283) -- 0:00:50
191500 -- (-1168.207) [-1168.771] (-1171.913) (-1168.087) * (-1171.434) [-1169.973] (-1170.333) (-1173.217) -- 0:00:50
192000 -- (-1168.814) (-1170.033) [-1168.734] (-1168.833) * (-1173.207) (-1170.272) [-1168.182] (-1172.383) -- 0:00:50
192500 -- (-1169.578) [-1172.376] (-1170.766) (-1171.480) * (-1170.262) (-1168.219) [-1168.247] (-1170.646) -- 0:00:50
193000 -- [-1169.429] (-1169.788) (-1168.541) (-1173.051) * (-1170.003) (-1168.476) (-1168.923) [-1172.050] -- 0:00:50
193500 -- (-1169.359) [-1170.435] (-1169.133) (-1172.924) * (-1169.057) [-1169.400] (-1169.583) (-1170.070) -- 0:00:50
194000 -- (-1169.189) [-1169.222] (-1170.283) (-1172.288) * (-1169.935) (-1174.256) [-1172.223] (-1170.109) -- 0:00:49
194500 -- (-1168.483) (-1169.374) [-1169.513] (-1170.011) * [-1169.685] (-1169.363) (-1172.243) (-1172.419) -- 0:00:49
195000 -- (-1168.491) [-1168.903] (-1169.313) (-1173.047) * (-1169.402) (-1169.983) (-1171.933) [-1171.867] -- 0:00:49
Average standard deviation of split frequencies: 0.018439
195500 -- (-1168.225) [-1170.868] (-1169.524) (-1168.619) * [-1169.212] (-1169.777) (-1169.587) (-1170.091) -- 0:00:49
196000 -- [-1169.204] (-1169.087) (-1169.067) (-1171.548) * (-1171.467) (-1176.488) (-1171.427) [-1170.616] -- 0:00:49
196500 -- [-1167.956] (-1168.486) (-1169.474) (-1170.860) * (-1172.201) (-1169.088) (-1170.952) [-1169.193] -- 0:00:49
197000 -- [-1168.536] (-1173.787) (-1169.280) (-1169.479) * [-1170.943] (-1169.481) (-1171.587) (-1169.343) -- 0:00:48
197500 -- [-1168.430] (-1172.479) (-1174.731) (-1173.586) * (-1170.627) (-1169.319) (-1169.080) [-1168.963] -- 0:00:48
198000 -- (-1168.431) (-1172.499) (-1172.794) [-1169.922] * (-1171.279) (-1169.246) (-1169.030) [-1169.042] -- 0:00:48
198500 -- (-1168.379) (-1169.107) (-1169.946) [-1169.542] * (-1168.616) [-1168.618] (-1170.179) (-1168.673) -- 0:00:48
199000 -- (-1174.169) (-1169.101) [-1170.507] (-1170.858) * [-1168.851] (-1169.043) (-1173.037) (-1171.546) -- 0:00:48
199500 -- (-1170.977) (-1171.561) (-1171.142) [-1169.766] * (-1169.710) (-1170.491) (-1171.778) [-1168.470] -- 0:00:52
200000 -- (-1170.026) [-1169.072] (-1169.693) (-1171.280) * (-1169.545) (-1171.460) (-1169.941) [-1168.492] -- 0:00:51
Average standard deviation of split frequencies: 0.018402
200500 -- (-1171.547) [-1169.876] (-1169.998) (-1168.437) * (-1170.880) [-1171.457] (-1170.217) (-1172.953) -- 0:00:51
201000 -- (-1170.848) (-1169.190) (-1169.286) [-1169.449] * (-1170.223) (-1168.514) [-1169.224] (-1173.325) -- 0:00:51
201500 -- (-1170.177) [-1172.571] (-1169.328) (-1172.184) * (-1169.345) (-1170.779) (-1169.581) [-1170.921] -- 0:00:51
202000 -- (-1168.871) (-1173.049) (-1173.463) [-1169.827] * (-1171.834) (-1169.815) (-1170.542) [-1169.982] -- 0:00:51
202500 -- (-1171.904) [-1171.734] (-1170.445) (-1170.680) * (-1168.574) [-1167.828] (-1170.999) (-1169.965) -- 0:00:51
203000 -- [-1171.529] (-1167.846) (-1173.756) (-1176.251) * (-1173.807) (-1168.379) [-1172.037] (-1170.584) -- 0:00:51
203500 -- [-1170.053] (-1168.110) (-1169.230) (-1170.114) * (-1172.426) (-1172.033) [-1171.494] (-1170.576) -- 0:00:50
204000 -- (-1170.452) (-1169.207) (-1170.367) [-1168.372] * [-1173.695] (-1170.718) (-1171.422) (-1172.065) -- 0:00:50
204500 -- (-1168.353) [-1168.452] (-1170.963) (-1168.870) * (-1168.813) (-1169.654) (-1168.724) [-1168.988] -- 0:00:50
205000 -- (-1167.738) (-1169.873) (-1174.234) [-1168.879] * (-1170.445) [-1169.281] (-1169.355) (-1171.664) -- 0:00:50
Average standard deviation of split frequencies: 0.017926
205500 -- [-1168.559] (-1168.502) (-1173.812) (-1168.878) * [-1168.325] (-1171.992) (-1168.101) (-1170.164) -- 0:00:50
206000 -- (-1169.017) [-1168.214] (-1170.535) (-1169.347) * [-1168.905] (-1170.408) (-1168.003) (-1169.663) -- 0:00:50
206500 -- [-1173.393] (-1168.557) (-1169.649) (-1170.873) * (-1168.608) (-1173.392) [-1168.289] (-1169.460) -- 0:00:49
207000 -- (-1172.487) [-1169.468] (-1170.952) (-1171.308) * (-1173.462) (-1168.746) [-1169.889] (-1170.358) -- 0:00:49
207500 -- [-1173.400] (-1170.630) (-1169.172) (-1168.875) * [-1168.156] (-1170.292) (-1172.474) (-1169.085) -- 0:00:49
208000 -- (-1170.915) (-1170.448) [-1169.730] (-1168.851) * (-1170.475) (-1170.400) (-1171.774) [-1172.987] -- 0:00:49
208500 -- (-1169.245) (-1170.219) [-1169.479] (-1169.605) * (-1173.787) [-1170.342] (-1169.788) (-1173.261) -- 0:00:49
209000 -- (-1172.798) [-1171.918] (-1168.792) (-1169.863) * (-1172.258) [-1170.188] (-1170.150) (-1168.963) -- 0:00:49
209500 -- [-1169.397] (-1171.155) (-1169.841) (-1172.374) * [-1174.200] (-1169.839) (-1169.053) (-1169.499) -- 0:00:49
210000 -- (-1169.219) (-1172.261) [-1172.119] (-1169.124) * [-1169.954] (-1169.961) (-1169.934) (-1171.603) -- 0:00:48
Average standard deviation of split frequencies: 0.017313
210500 -- [-1168.975] (-1169.096) (-1171.107) (-1170.640) * [-1170.278] (-1169.050) (-1170.861) (-1172.709) -- 0:00:48
211000 -- [-1168.852] (-1169.449) (-1171.383) (-1171.522) * (-1168.657) [-1168.409] (-1170.107) (-1169.051) -- 0:00:48
211500 -- (-1170.231) (-1169.445) [-1171.915] (-1169.246) * (-1171.307) (-1171.382) (-1168.598) [-1169.789] -- 0:00:48
212000 -- [-1168.596] (-1169.445) (-1169.043) (-1169.907) * (-1170.452) (-1169.956) [-1168.887] (-1168.854) -- 0:00:48
212500 -- (-1169.277) (-1168.978) (-1174.038) [-1168.426] * (-1168.716) [-1168.148] (-1169.346) (-1170.012) -- 0:00:48
213000 -- (-1170.422) [-1168.191] (-1172.012) (-1171.109) * (-1171.917) [-1173.741] (-1172.656) (-1170.067) -- 0:00:48
213500 -- (-1171.249) (-1168.165) [-1171.083] (-1170.551) * (-1170.850) (-1172.172) (-1173.261) [-1173.586] -- 0:00:47
214000 -- (-1168.662) (-1170.215) (-1170.936) [-1170.948] * [-1168.485] (-1169.084) (-1169.628) (-1173.461) -- 0:00:47
214500 -- (-1170.720) (-1169.795) (-1171.900) [-1169.391] * [-1169.296] (-1168.415) (-1170.184) (-1170.531) -- 0:00:47
215000 -- (-1169.473) (-1171.731) [-1172.770] (-1168.473) * [-1169.123] (-1169.483) (-1173.431) (-1172.282) -- 0:00:47
Average standard deviation of split frequencies: 0.018493
215500 -- [-1169.480] (-1170.821) (-1171.756) (-1168.117) * (-1172.570) (-1172.087) (-1170.009) [-1169.268] -- 0:00:50
216000 -- (-1169.392) (-1170.124) [-1171.067] (-1170.963) * [-1170.609] (-1171.981) (-1170.294) (-1169.072) -- 0:00:50
216500 -- (-1170.386) (-1168.593) [-1169.726] (-1171.674) * (-1170.679) (-1168.843) [-1171.155] (-1170.786) -- 0:00:50
217000 -- (-1170.872) (-1171.874) (-1170.138) [-1170.556] * [-1171.517] (-1168.843) (-1171.556) (-1169.329) -- 0:00:50
217500 -- [-1169.946] (-1170.179) (-1172.643) (-1170.162) * [-1171.311] (-1169.525) (-1170.522) (-1169.003) -- 0:00:50
218000 -- [-1170.052] (-1168.928) (-1170.237) (-1169.605) * (-1174.604) (-1172.826) (-1175.188) [-1169.593] -- 0:00:50
218500 -- (-1169.762) (-1169.541) (-1169.520) [-1169.557] * (-1170.660) (-1169.359) (-1174.054) [-1168.469] -- 0:00:50
219000 -- (-1169.415) [-1169.539] (-1168.670) (-1171.587) * (-1172.491) (-1169.093) (-1173.408) [-1170.754] -- 0:00:49
219500 -- [-1170.616] (-1168.575) (-1169.986) (-1168.137) * (-1171.845) (-1170.658) (-1172.902) [-1172.504] -- 0:00:49
220000 -- (-1169.467) (-1169.561) (-1169.468) [-1168.909] * (-1172.055) (-1169.958) (-1171.850) [-1169.983] -- 0:00:49
Average standard deviation of split frequencies: 0.019583
220500 -- (-1169.457) (-1171.970) [-1170.125] (-1169.062) * (-1171.517) [-1168.089] (-1172.090) (-1174.099) -- 0:00:49
221000 -- (-1168.449) [-1169.937] (-1168.877) (-1170.351) * [-1170.693] (-1168.211) (-1170.037) (-1174.205) -- 0:00:49
221500 -- (-1169.378) (-1171.894) [-1169.843] (-1169.959) * [-1169.060] (-1168.147) (-1169.975) (-1172.169) -- 0:00:49
222000 -- (-1170.978) (-1169.955) [-1168.902] (-1170.808) * (-1169.764) (-1169.045) [-1169.937] (-1176.466) -- 0:00:49
222500 -- (-1168.098) (-1169.955) (-1169.657) [-1172.051] * [-1170.607] (-1168.704) (-1170.805) (-1169.034) -- 0:00:48
223000 -- (-1169.033) (-1171.349) (-1169.003) [-1168.087] * (-1170.263) (-1170.193) (-1172.343) [-1169.908] -- 0:00:48
223500 -- (-1172.582) (-1168.892) [-1169.132] (-1168.440) * (-1169.964) [-1171.225] (-1169.888) (-1168.681) -- 0:00:48
224000 -- (-1170.670) (-1168.179) (-1173.878) [-1168.946] * (-1174.354) (-1170.559) (-1171.463) [-1168.635] -- 0:00:48
224500 -- (-1171.194) (-1168.991) (-1178.287) [-1170.633] * [-1174.038] (-1170.084) (-1168.654) (-1170.922) -- 0:00:48
225000 -- (-1169.752) [-1170.775] (-1171.016) (-1169.815) * (-1170.939) (-1173.427) (-1169.388) [-1172.357] -- 0:00:48
Average standard deviation of split frequencies: 0.019816
225500 -- [-1168.253] (-1171.796) (-1172.096) (-1171.445) * (-1170.760) [-1168.955] (-1168.025) (-1170.007) -- 0:00:48
226000 -- (-1172.941) (-1172.734) (-1173.184) [-1170.241] * (-1169.399) (-1168.950) [-1168.087] (-1169.670) -- 0:00:47
226500 -- [-1172.317] (-1170.737) (-1176.846) (-1170.349) * (-1170.554) (-1171.433) (-1168.086) [-1169.506] -- 0:00:47
227000 -- (-1168.588) [-1167.860] (-1168.588) (-1173.381) * (-1170.595) [-1169.716] (-1167.892) (-1171.023) -- 0:00:47
227500 -- [-1168.850] (-1169.277) (-1171.493) (-1173.701) * (-1169.620) (-1171.286) (-1174.640) [-1169.613] -- 0:00:47
228000 -- [-1168.976] (-1171.111) (-1170.393) (-1167.749) * [-1168.898] (-1168.866) (-1173.115) (-1167.895) -- 0:00:47
228500 -- (-1171.808) (-1171.159) [-1171.059] (-1168.201) * [-1169.480] (-1169.071) (-1167.770) (-1168.234) -- 0:00:47
229000 -- [-1172.553] (-1170.618) (-1171.632) (-1169.318) * (-1170.415) (-1168.608) (-1173.922) [-1168.458] -- 0:00:47
229500 -- (-1170.126) [-1169.479] (-1169.278) (-1167.950) * (-1168.753) (-1169.647) (-1170.198) [-1168.183] -- 0:00:47
230000 -- [-1171.012] (-1170.281) (-1169.159) (-1169.146) * (-1168.774) [-1169.110] (-1170.253) (-1170.784) -- 0:00:46
Average standard deviation of split frequencies: 0.019721
230500 -- (-1170.351) (-1169.104) [-1168.900] (-1168.417) * (-1168.562) (-1171.556) (-1172.450) [-1170.274] -- 0:00:46
231000 -- [-1174.739] (-1169.775) (-1169.185) (-1170.757) * (-1169.824) (-1171.459) [-1172.161] (-1168.102) -- 0:00:46
231500 -- (-1168.799) (-1170.670) (-1168.300) [-1171.563] * (-1169.140) (-1171.513) [-1170.801] (-1169.088) -- 0:00:49
232000 -- (-1170.511) [-1169.144] (-1171.104) (-1170.866) * [-1169.307] (-1171.686) (-1174.489) (-1169.287) -- 0:00:49
232500 -- (-1172.581) (-1169.824) (-1170.203) [-1171.719] * (-1169.408) [-1170.001] (-1171.101) (-1174.107) -- 0:00:49
233000 -- (-1172.933) (-1171.708) (-1170.223) [-1172.489] * (-1171.349) (-1171.483) (-1168.871) [-1169.216] -- 0:00:49
233500 -- [-1170.725] (-1171.875) (-1170.031) (-1169.839) * [-1170.495] (-1169.537) (-1168.817) (-1171.106) -- 0:00:49
234000 -- [-1169.786] (-1170.722) (-1168.860) (-1169.453) * [-1170.302] (-1172.462) (-1169.943) (-1169.694) -- 0:00:49
234500 -- (-1169.659) (-1170.333) (-1169.524) [-1169.794] * [-1168.969] (-1169.427) (-1170.641) (-1170.469) -- 0:00:48
235000 -- (-1168.922) (-1177.041) [-1168.757] (-1169.724) * (-1169.436) [-1168.976] (-1171.335) (-1170.592) -- 0:00:48
Average standard deviation of split frequencies: 0.019575
235500 -- (-1169.256) (-1171.239) (-1168.766) [-1168.956] * (-1170.308) (-1173.208) (-1171.534) [-1170.181] -- 0:00:48
236000 -- (-1176.536) [-1169.622] (-1168.778) (-1171.733) * (-1169.366) (-1173.122) (-1168.974) [-1169.985] -- 0:00:48
236500 -- (-1170.770) [-1169.353] (-1171.275) (-1172.288) * (-1171.990) [-1169.032] (-1175.052) (-1175.396) -- 0:00:48
237000 -- (-1171.048) (-1169.987) (-1169.392) [-1169.236] * [-1171.115] (-1169.032) (-1172.840) (-1177.813) -- 0:00:48
237500 -- (-1170.184) [-1169.651] (-1171.047) (-1168.408) * (-1169.793) (-1169.024) (-1174.602) [-1170.780] -- 0:00:48
238000 -- [-1168.423] (-1172.540) (-1170.113) (-1167.951) * (-1168.892) (-1170.650) (-1167.641) [-1170.790] -- 0:00:48
238500 -- [-1167.706] (-1173.257) (-1172.293) (-1169.104) * (-1168.459) [-1170.280] (-1168.889) (-1174.187) -- 0:00:47
239000 -- (-1170.961) (-1169.352) (-1168.208) [-1167.962] * (-1170.654) [-1169.982] (-1172.434) (-1171.852) -- 0:00:47
239500 -- (-1172.316) (-1168.962) (-1168.262) [-1167.924] * (-1168.279) [-1169.706] (-1169.974) (-1174.455) -- 0:00:47
240000 -- (-1170.399) (-1174.459) (-1173.923) [-1171.311] * (-1169.001) (-1169.644) [-1168.116] (-1174.600) -- 0:00:47
Average standard deviation of split frequencies: 0.018804
240500 -- [-1170.284] (-1170.753) (-1171.815) (-1168.811) * (-1168.245) (-1170.978) [-1169.034] (-1171.807) -- 0:00:47
241000 -- (-1169.276) (-1170.156) [-1168.547] (-1168.635) * (-1169.501) (-1170.007) (-1170.307) [-1168.725] -- 0:00:47
241500 -- (-1169.218) (-1169.869) (-1171.666) [-1167.786] * (-1170.161) [-1169.468] (-1170.040) (-1168.838) -- 0:00:47
242000 -- [-1168.445] (-1168.534) (-1169.099) (-1169.402) * (-1171.870) (-1173.838) (-1169.349) [-1173.781] -- 0:00:46
242500 -- [-1168.740] (-1168.534) (-1170.404) (-1168.158) * (-1174.742) [-1170.785] (-1170.709) (-1170.958) -- 0:00:46
243000 -- (-1168.650) [-1168.550] (-1170.763) (-1167.866) * (-1173.009) (-1171.754) [-1173.946] (-1168.538) -- 0:00:46
243500 -- [-1169.944] (-1169.796) (-1170.809) (-1167.872) * (-1171.836) [-1169.503] (-1174.708) (-1168.041) -- 0:00:46
244000 -- [-1170.198] (-1171.046) (-1171.156) (-1168.346) * (-1171.783) [-1170.514] (-1171.474) (-1169.213) -- 0:00:46
244500 -- (-1168.297) (-1169.705) (-1173.563) [-1167.822] * (-1169.437) [-1169.467] (-1172.670) (-1168.429) -- 0:00:46
245000 -- (-1169.310) (-1169.067) (-1170.914) [-1170.125] * (-1168.948) (-1176.118) [-1175.025] (-1169.007) -- 0:00:46
Average standard deviation of split frequencies: 0.019546
245500 -- (-1170.264) (-1168.733) (-1171.309) [-1169.423] * (-1177.250) [-1169.969] (-1174.286) (-1168.266) -- 0:00:46
246000 -- (-1170.904) (-1167.994) [-1168.322] (-1171.295) * [-1171.095] (-1168.647) (-1173.739) (-1170.374) -- 0:00:45
246500 -- (-1168.552) (-1175.021) [-1168.023] (-1168.958) * (-1168.187) (-1169.460) [-1171.567] (-1168.993) -- 0:00:45
247000 -- (-1168.539) (-1173.568) [-1170.725] (-1169.595) * [-1171.775] (-1174.230) (-1167.895) (-1169.293) -- 0:00:45
247500 -- (-1168.751) (-1173.621) (-1170.169) [-1169.459] * (-1172.171) [-1169.701] (-1172.749) (-1168.666) -- 0:00:45
248000 -- [-1169.018] (-1171.573) (-1169.405) (-1170.503) * [-1171.542] (-1172.976) (-1171.972) (-1168.092) -- 0:00:48
248500 -- (-1168.410) (-1170.386) [-1171.493] (-1172.206) * (-1170.295) (-1170.775) (-1169.313) [-1171.427] -- 0:00:48
249000 -- [-1171.404] (-1169.449) (-1170.035) (-1169.298) * (-1170.480) (-1168.240) (-1171.249) [-1175.428] -- 0:00:48
249500 -- (-1169.751) [-1170.274] (-1178.069) (-1171.259) * (-1170.625) (-1170.907) [-1168.726] (-1168.740) -- 0:00:48
250000 -- [-1169.976] (-1168.844) (-1169.723) (-1169.218) * (-1172.558) (-1169.815) [-1168.151] (-1168.350) -- 0:00:48
Average standard deviation of split frequencies: 0.020028
250500 -- (-1169.673) (-1170.112) (-1169.243) [-1168.346] * [-1171.167] (-1171.777) (-1168.605) (-1170.441) -- 0:00:47
251000 -- (-1169.142) (-1168.159) [-1169.275] (-1167.909) * (-1169.015) (-1170.680) (-1171.024) [-1174.746] -- 0:00:47
251500 -- (-1169.176) (-1168.924) (-1168.529) [-1170.061] * (-1169.327) (-1172.097) [-1169.242] (-1170.461) -- 0:00:47
252000 -- [-1171.143] (-1170.372) (-1168.223) (-1171.092) * (-1172.507) [-1170.133] (-1169.668) (-1172.525) -- 0:00:47
252500 -- [-1168.229] (-1170.677) (-1170.217) (-1168.509) * (-1172.724) (-1169.771) (-1168.903) [-1169.329] -- 0:00:47
253000 -- (-1168.148) [-1170.786] (-1170.520) (-1174.360) * [-1169.855] (-1169.663) (-1170.836) (-1170.407) -- 0:00:47
253500 -- (-1169.491) (-1170.961) [-1168.852] (-1168.654) * (-1170.423) (-1169.560) [-1170.600] (-1170.776) -- 0:00:47
254000 -- [-1167.872] (-1170.383) (-1170.502) (-1168.879) * (-1170.398) [-1169.945] (-1175.106) (-1174.098) -- 0:00:46
254500 -- [-1168.256] (-1171.054) (-1169.520) (-1170.744) * (-1170.853) [-1168.639] (-1171.857) (-1169.852) -- 0:00:46
255000 -- (-1175.892) (-1169.160) (-1169.784) [-1168.183] * [-1169.904] (-1169.383) (-1173.272) (-1170.074) -- 0:00:46
Average standard deviation of split frequencies: 0.019519
255500 -- (-1169.950) (-1170.547) (-1170.521) [-1168.804] * (-1172.550) (-1169.512) (-1171.413) [-1168.968] -- 0:00:46
256000 -- (-1171.885) (-1170.714) [-1170.691] (-1171.156) * [-1170.389] (-1169.479) (-1170.858) (-1169.889) -- 0:00:46
256500 -- (-1170.757) (-1169.099) [-1170.296] (-1170.745) * [-1167.827] (-1169.382) (-1172.576) (-1167.989) -- 0:00:46
257000 -- (-1173.300) [-1168.607] (-1170.261) (-1169.937) * (-1168.034) [-1169.156] (-1169.725) (-1169.072) -- 0:00:46
257500 -- (-1170.792) (-1168.494) (-1170.410) [-1171.594] * (-1169.462) (-1172.954) [-1169.609] (-1169.076) -- 0:00:46
258000 -- (-1172.489) (-1168.581) [-1170.192] (-1172.490) * (-1169.833) (-1174.217) [-1170.554] (-1170.615) -- 0:00:46
258500 -- (-1171.128) (-1169.699) (-1168.774) [-1169.310] * (-1173.202) [-1172.762] (-1171.462) (-1170.858) -- 0:00:45
259000 -- (-1171.000) (-1168.512) [-1169.870] (-1169.379) * [-1171.068] (-1169.029) (-1169.503) (-1169.188) -- 0:00:45
259500 -- [-1171.200] (-1168.240) (-1170.333) (-1177.431) * [-1169.067] (-1169.449) (-1168.784) (-1171.488) -- 0:00:45
260000 -- (-1178.465) (-1168.242) (-1170.345) [-1171.968] * (-1169.271) (-1168.420) [-1168.201] (-1168.917) -- 0:00:45
Average standard deviation of split frequencies: 0.017323
260500 -- (-1178.609) (-1167.754) [-1172.670] (-1170.807) * (-1171.571) (-1169.701) [-1168.199] (-1168.507) -- 0:00:45
261000 -- (-1169.930) (-1171.220) (-1170.431) [-1171.216] * (-1169.828) (-1170.193) [-1170.488] (-1168.667) -- 0:00:45
261500 -- (-1171.857) (-1171.223) [-1171.474] (-1171.058) * (-1172.958) (-1168.763) [-1169.791] (-1168.303) -- 0:00:45
262000 -- [-1169.476] (-1168.821) (-1169.447) (-1174.742) * (-1169.131) (-1168.712) [-1169.654] (-1170.287) -- 0:00:45
262500 -- (-1168.870) (-1169.536) (-1169.836) [-1175.450] * (-1171.735) [-1168.552] (-1171.361) (-1170.076) -- 0:00:44
263000 -- (-1167.912) [-1168.597] (-1173.053) (-1169.646) * [-1169.163] (-1169.029) (-1169.385) (-1173.159) -- 0:00:44
263500 -- (-1170.122) [-1169.248] (-1171.258) (-1170.477) * (-1169.206) (-1169.267) [-1170.903] (-1170.376) -- 0:00:44
264000 -- [-1170.321] (-1168.891) (-1170.294) (-1169.493) * [-1169.857] (-1169.414) (-1172.022) (-1172.692) -- 0:00:44
264500 -- (-1168.593) [-1172.600] (-1173.002) (-1168.327) * (-1169.571) (-1170.538) (-1172.843) [-1169.751] -- 0:00:47
265000 -- (-1168.267) [-1168.023] (-1176.327) (-1170.672) * [-1170.908] (-1172.038) (-1171.818) (-1168.933) -- 0:00:47
Average standard deviation of split frequencies: 0.016481
265500 -- [-1169.758] (-1171.521) (-1170.245) (-1174.068) * (-1168.600) [-1170.458] (-1169.298) (-1168.609) -- 0:00:47
266000 -- (-1168.412) (-1171.935) [-1169.853] (-1172.212) * (-1168.553) (-1170.376) (-1169.449) [-1169.545] -- 0:00:46
266500 -- (-1168.157) (-1168.841) [-1168.683] (-1168.272) * (-1170.595) (-1167.608) (-1169.721) [-1172.302] -- 0:00:46
267000 -- (-1169.802) [-1168.986] (-1168.696) (-1168.389) * (-1168.400) [-1168.514] (-1168.243) (-1170.750) -- 0:00:46
267500 -- (-1169.640) [-1168.234] (-1169.303) (-1173.919) * (-1169.077) (-1169.190) (-1173.633) [-1171.322] -- 0:00:46
268000 -- (-1171.799) [-1171.270] (-1169.878) (-1169.537) * [-1168.469] (-1169.996) (-1170.612) (-1171.017) -- 0:00:46
268500 -- (-1168.865) (-1168.584) (-1169.686) [-1170.488] * [-1172.513] (-1172.022) (-1170.967) (-1170.364) -- 0:00:46
269000 -- (-1168.740) (-1173.140) (-1169.591) [-1172.511] * (-1172.028) (-1170.907) (-1170.913) [-1168.651] -- 0:00:46
269500 -- (-1168.124) (-1173.506) (-1170.646) [-1169.775] * [-1168.954] (-1173.089) (-1170.074) (-1170.408) -- 0:00:46
270000 -- (-1168.514) (-1171.138) (-1171.788) [-1170.230] * [-1168.800] (-1170.571) (-1172.579) (-1169.097) -- 0:00:45
Average standard deviation of split frequencies: 0.016408
270500 -- (-1169.805) (-1168.871) (-1172.716) [-1170.107] * [-1169.155] (-1170.661) (-1168.667) (-1173.984) -- 0:00:45
271000 -- (-1168.903) (-1168.188) (-1170.145) [-1168.880] * (-1169.137) [-1168.709] (-1169.275) (-1172.480) -- 0:00:45
271500 -- [-1171.157] (-1168.884) (-1172.025) (-1168.816) * (-1171.692) (-1175.206) (-1171.794) [-1170.087] -- 0:00:45
272000 -- (-1169.927) (-1168.215) [-1169.712] (-1169.211) * (-1173.563) (-1173.644) [-1174.216] (-1170.550) -- 0:00:45
272500 -- (-1172.021) (-1168.441) (-1170.331) [-1169.266] * (-1172.128) (-1169.559) (-1172.614) [-1168.982] -- 0:00:45
273000 -- (-1170.604) (-1169.313) (-1171.258) [-1168.972] * (-1171.345) [-1170.529] (-1173.657) (-1170.583) -- 0:00:45
273500 -- (-1170.845) (-1169.550) (-1172.416) [-1169.039] * (-1171.835) (-1172.228) (-1174.413) [-1171.254] -- 0:00:45
274000 -- (-1171.040) [-1170.359] (-1173.733) (-1172.116) * (-1171.652) (-1169.675) (-1169.861) [-1171.587] -- 0:00:45
274500 -- [-1169.464] (-1171.351) (-1169.592) (-1169.777) * (-1170.339) [-1171.793] (-1169.674) (-1176.840) -- 0:00:44
275000 -- (-1168.285) [-1171.798] (-1169.230) (-1169.968) * (-1170.521) [-1169.835] (-1170.666) (-1173.664) -- 0:00:44
Average standard deviation of split frequencies: 0.016416
275500 -- [-1169.051] (-1172.791) (-1169.612) (-1174.804) * (-1169.665) (-1169.220) [-1169.615] (-1172.102) -- 0:00:44
276000 -- (-1167.970) (-1171.664) [-1168.425] (-1168.810) * (-1171.053) [-1171.596] (-1172.134) (-1168.855) -- 0:00:44
276500 -- (-1168.069) [-1170.950] (-1168.636) (-1168.091) * [-1170.608] (-1171.649) (-1172.433) (-1170.447) -- 0:00:44
277000 -- [-1168.265] (-1172.259) (-1168.702) (-1168.215) * (-1170.746) (-1171.131) [-1172.269] (-1173.837) -- 0:00:44
277500 -- (-1169.329) (-1171.512) [-1168.925] (-1168.789) * [-1169.595] (-1169.575) (-1168.874) (-1172.020) -- 0:00:44
278000 -- (-1169.461) (-1171.119) [-1170.266] (-1169.277) * (-1168.333) (-1171.062) [-1170.869] (-1169.858) -- 0:00:44
278500 -- [-1168.666] (-1170.557) (-1167.747) (-1168.648) * [-1171.164] (-1172.311) (-1173.056) (-1171.713) -- 0:00:44
279000 -- (-1168.628) (-1169.203) (-1168.432) [-1168.522] * (-1168.127) (-1168.633) (-1174.394) [-1172.418] -- 0:00:43
279500 -- [-1172.254] (-1169.509) (-1168.749) (-1169.587) * (-1173.905) (-1171.769) [-1173.918] (-1168.875) -- 0:00:43
280000 -- (-1169.191) (-1169.401) [-1168.417] (-1174.349) * (-1170.975) (-1169.205) (-1172.200) [-1168.787] -- 0:00:43
Average standard deviation of split frequencies: 0.016423
280500 -- (-1169.086) (-1169.059) (-1169.263) [-1169.814] * (-1170.996) (-1173.210) (-1175.507) [-1168.548] -- 0:00:43
281000 -- [-1169.141] (-1168.629) (-1168.733) (-1169.860) * [-1173.369] (-1171.330) (-1173.308) (-1168.827) -- 0:00:46
281500 -- [-1168.505] (-1171.276) (-1169.239) (-1171.143) * (-1174.717) (-1171.093) [-1169.227] (-1172.243) -- 0:00:45
282000 -- [-1169.774] (-1170.436) (-1168.576) (-1171.642) * (-1170.396) (-1169.546) (-1170.390) [-1168.057] -- 0:00:45
282500 -- [-1169.626] (-1170.716) (-1170.151) (-1169.215) * (-1169.556) [-1168.761] (-1169.337) (-1170.719) -- 0:00:45
283000 -- (-1171.801) (-1169.982) [-1167.844] (-1173.068) * (-1169.156) [-1168.544] (-1168.366) (-1170.376) -- 0:00:45
283500 -- (-1170.407) [-1169.789] (-1168.984) (-1170.423) * [-1173.310] (-1170.951) (-1169.692) (-1170.636) -- 0:00:45
284000 -- [-1171.627] (-1171.727) (-1171.365) (-1172.444) * [-1170.841] (-1172.124) (-1169.312) (-1170.411) -- 0:00:45
284500 -- (-1176.116) (-1171.458) [-1169.434] (-1171.719) * (-1171.555) (-1168.544) [-1169.236] (-1170.979) -- 0:00:45
285000 -- [-1171.325] (-1170.088) (-1171.579) (-1172.117) * (-1170.367) [-1171.163] (-1177.040) (-1170.807) -- 0:00:45
Average standard deviation of split frequencies: 0.015355
285500 -- (-1171.401) [-1170.184] (-1169.525) (-1173.203) * (-1171.376) (-1170.662) [-1174.224] (-1173.781) -- 0:00:45
286000 -- [-1170.182] (-1170.295) (-1170.596) (-1169.488) * (-1168.497) (-1172.827) (-1173.273) [-1169.548] -- 0:00:44
286500 -- (-1168.539) (-1171.017) (-1170.598) [-1169.892] * (-1168.346) [-1176.085] (-1170.312) (-1168.503) -- 0:00:44
287000 -- (-1169.247) (-1169.731) [-1169.044] (-1169.948) * [-1168.723] (-1175.118) (-1173.832) (-1168.093) -- 0:00:44
287500 -- (-1168.035) (-1168.983) (-1169.187) [-1169.558] * (-1169.038) (-1170.887) (-1169.870) [-1173.820] -- 0:00:44
288000 -- (-1172.635) (-1168.382) [-1168.388] (-1169.404) * (-1171.224) (-1172.310) [-1169.350] (-1169.680) -- 0:00:44
288500 -- (-1170.705) [-1171.290] (-1169.732) (-1170.059) * [-1171.530] (-1168.964) (-1171.009) (-1170.534) -- 0:00:44
289000 -- [-1172.315] (-1170.591) (-1173.996) (-1168.737) * (-1169.020) (-1169.548) (-1171.188) [-1168.022] -- 0:00:44
289500 -- (-1173.125) (-1169.256) (-1171.499) [-1169.313] * (-1172.228) [-1169.012] (-1172.319) (-1169.432) -- 0:00:44
290000 -- (-1170.650) (-1169.686) (-1168.687) [-1169.126] * (-1172.095) [-1172.368] (-1170.248) (-1169.780) -- 0:00:44
Average standard deviation of split frequencies: 0.015194
290500 -- (-1169.341) [-1168.367] (-1169.491) (-1169.688) * [-1167.964] (-1172.721) (-1168.139) (-1168.225) -- 0:00:43
291000 -- [-1169.892] (-1169.713) (-1173.241) (-1176.980) * [-1168.884] (-1169.963) (-1169.607) (-1169.839) -- 0:00:43
291500 -- (-1169.151) (-1170.884) [-1171.460] (-1170.377) * (-1169.797) (-1172.349) [-1168.724] (-1169.783) -- 0:00:43
292000 -- [-1169.413] (-1169.141) (-1170.988) (-1168.610) * (-1170.544) [-1171.405] (-1170.340) (-1177.831) -- 0:00:43
292500 -- (-1170.231) [-1169.506] (-1171.082) (-1169.949) * [-1169.513] (-1170.269) (-1170.218) (-1170.729) -- 0:00:43
293000 -- (-1174.384) (-1168.376) [-1170.341] (-1168.064) * (-1170.296) (-1169.937) [-1169.809] (-1168.561) -- 0:00:43
293500 -- (-1168.889) (-1168.170) (-1169.227) [-1169.250] * [-1170.829] (-1168.907) (-1169.828) (-1169.158) -- 0:00:43
294000 -- (-1169.480) [-1171.547] (-1169.417) (-1169.289) * (-1170.115) (-1170.144) (-1170.495) [-1171.295] -- 0:00:43
294500 -- (-1172.158) (-1171.281) (-1168.239) [-1171.014] * (-1169.555) (-1168.394) (-1171.969) [-1176.972] -- 0:00:43
295000 -- (-1171.515) (-1168.461) [-1169.533] (-1168.869) * [-1176.865] (-1167.860) (-1173.214) (-1176.397) -- 0:00:43
Average standard deviation of split frequencies: 0.015004
295500 -- (-1168.901) (-1169.056) [-1168.400] (-1171.172) * [-1170.014] (-1168.921) (-1169.487) (-1171.964) -- 0:00:42
296000 -- (-1169.539) (-1170.300) [-1167.982] (-1169.980) * (-1169.470) [-1169.389] (-1168.880) (-1172.586) -- 0:00:42
296500 -- (-1172.453) (-1172.306) (-1167.982) [-1169.033] * (-1175.230) [-1167.736] (-1172.592) (-1171.479) -- 0:00:42
297000 -- (-1169.883) (-1171.574) (-1174.153) [-1169.008] * [-1169.710] (-1168.377) (-1180.624) (-1171.087) -- 0:00:44
297500 -- (-1170.424) (-1170.528) [-1172.456] (-1169.550) * (-1168.992) (-1171.245) (-1174.635) [-1171.205] -- 0:00:44
298000 -- (-1170.768) (-1169.010) [-1169.940] (-1169.025) * (-1168.144) [-1170.861] (-1170.036) (-1170.584) -- 0:00:44
298500 -- [-1169.012] (-1175.311) (-1172.399) (-1171.742) * (-1169.538) (-1171.365) (-1170.421) [-1169.569] -- 0:00:44
299000 -- [-1173.729] (-1170.013) (-1169.529) (-1169.464) * (-1168.991) (-1171.016) (-1169.694) [-1168.342] -- 0:00:44
299500 -- [-1168.588] (-1169.863) (-1168.008) (-1169.488) * (-1168.973) [-1173.656] (-1170.897) (-1170.961) -- 0:00:44
300000 -- (-1171.425) (-1171.613) (-1169.877) [-1169.277] * (-1173.310) (-1171.935) [-1168.458] (-1171.918) -- 0:00:44
Average standard deviation of split frequencies: 0.015330
300500 -- [-1170.935] (-1168.844) (-1172.059) (-1170.574) * (-1170.911) [-1170.212] (-1169.589) (-1172.910) -- 0:00:44
301000 -- (-1172.087) (-1168.386) (-1168.431) [-1169.998] * (-1169.396) (-1172.421) [-1169.820] (-1169.725) -- 0:00:44
301500 -- (-1169.662) [-1168.890] (-1172.836) (-1169.450) * (-1168.488) [-1173.996] (-1167.900) (-1173.751) -- 0:00:44
302000 -- (-1168.508) [-1168.150] (-1173.202) (-1168.942) * [-1168.583] (-1176.432) (-1167.979) (-1170.719) -- 0:00:43
302500 -- (-1168.810) (-1169.333) (-1172.974) [-1172.198] * [-1169.069] (-1178.060) (-1168.811) (-1172.674) -- 0:00:43
303000 -- [-1169.751] (-1170.494) (-1170.639) (-1171.184) * (-1174.154) (-1174.627) (-1168.860) [-1171.579] -- 0:00:43
303500 -- (-1170.913) (-1170.889) [-1170.562] (-1171.410) * (-1172.988) (-1170.145) (-1169.601) [-1171.338] -- 0:00:43
304000 -- (-1172.189) (-1171.256) [-1170.104] (-1171.949) * [-1172.123] (-1170.505) (-1171.106) (-1172.506) -- 0:00:43
304500 -- [-1169.465] (-1171.701) (-1167.950) (-1171.839) * (-1168.883) (-1172.104) [-1171.631] (-1171.949) -- 0:00:43
305000 -- (-1169.113) [-1170.252] (-1168.010) (-1169.622) * (-1171.517) [-1168.457] (-1172.061) (-1169.326) -- 0:00:43
Average standard deviation of split frequencies: 0.014432
305500 -- (-1168.756) [-1169.587] (-1168.174) (-1168.211) * (-1168.277) [-1168.564] (-1172.301) (-1170.178) -- 0:00:43
306000 -- (-1172.885) (-1170.006) (-1168.707) [-1169.133] * [-1168.412] (-1168.701) (-1171.871) (-1169.352) -- 0:00:43
306500 -- (-1170.691) (-1169.924) (-1169.895) [-1174.106] * [-1168.628] (-1169.751) (-1172.541) (-1168.180) -- 0:00:42
307000 -- (-1168.598) [-1169.206] (-1171.849) (-1183.463) * [-1170.881] (-1169.606) (-1173.005) (-1168.917) -- 0:00:42
307500 -- (-1171.296) [-1168.321] (-1169.536) (-1171.176) * [-1171.447] (-1168.470) (-1175.310) (-1169.616) -- 0:00:42
308000 -- (-1170.522) [-1169.606] (-1169.194) (-1171.201) * [-1171.749] (-1169.472) (-1172.732) (-1173.110) -- 0:00:42
308500 -- (-1170.489) (-1169.246) (-1169.124) [-1170.103] * [-1169.075] (-1169.855) (-1171.791) (-1172.663) -- 0:00:42
309000 -- (-1169.317) [-1170.453] (-1168.998) (-1168.331) * (-1169.683) [-1171.511] (-1173.484) (-1169.515) -- 0:00:42
309500 -- (-1173.158) (-1170.440) (-1172.187) [-1168.329] * (-1170.178) (-1170.079) [-1171.765] (-1169.902) -- 0:00:42
310000 -- (-1174.888) [-1170.283] (-1173.791) (-1170.461) * [-1174.771] (-1172.370) (-1175.306) (-1169.872) -- 0:00:42
Average standard deviation of split frequencies: 0.014295
310500 -- [-1170.624] (-1173.175) (-1171.337) (-1168.894) * (-1171.988) [-1172.590] (-1170.140) (-1168.791) -- 0:00:42
311000 -- [-1169.233] (-1168.189) (-1169.163) (-1168.786) * [-1169.759] (-1171.407) (-1172.376) (-1168.807) -- 0:00:42
311500 -- (-1170.432) (-1169.289) (-1169.390) [-1171.022] * (-1171.661) (-1171.220) (-1171.688) [-1169.280] -- 0:00:41
312000 -- (-1171.615) (-1169.653) [-1171.035] (-1170.767) * [-1171.247] (-1170.318) (-1174.816) (-1168.928) -- 0:00:41
312500 -- [-1169.375] (-1169.498) (-1170.484) (-1169.400) * (-1169.204) (-1170.448) (-1171.275) [-1169.108] -- 0:00:41
313000 -- (-1168.637) (-1169.172) (-1170.370) [-1170.446] * (-1169.630) [-1170.193] (-1170.570) (-1171.873) -- 0:00:43
313500 -- [-1168.661] (-1168.422) (-1170.022) (-1171.361) * [-1170.781] (-1168.573) (-1171.703) (-1171.648) -- 0:00:43
314000 -- (-1169.686) (-1168.945) [-1170.005] (-1171.334) * (-1170.588) (-1169.148) (-1172.464) [-1170.899] -- 0:00:43
314500 -- [-1171.859] (-1168.939) (-1170.216) (-1171.112) * (-1168.905) (-1169.967) [-1170.448] (-1170.466) -- 0:00:43
315000 -- (-1171.127) (-1167.852) [-1168.923] (-1170.893) * (-1168.142) [-1170.959] (-1172.049) (-1168.583) -- 0:00:43
Average standard deviation of split frequencies: 0.014503
315500 -- (-1174.400) (-1168.664) (-1168.055) [-1169.694] * [-1168.152] (-1169.552) (-1169.544) (-1171.028) -- 0:00:43
316000 -- [-1172.509] (-1168.769) (-1167.843) (-1172.232) * [-1169.095] (-1170.428) (-1171.613) (-1171.694) -- 0:00:43
316500 -- (-1174.473) (-1168.948) [-1167.967] (-1173.757) * (-1169.013) (-1170.286) (-1171.781) [-1169.858] -- 0:00:43
317000 -- (-1169.745) [-1170.818] (-1169.701) (-1168.802) * (-1172.273) (-1168.971) (-1172.426) [-1172.310] -- 0:00:43
317500 -- (-1171.358) [-1170.611] (-1170.899) (-1168.902) * (-1173.689) [-1169.033] (-1171.117) (-1173.068) -- 0:00:42
318000 -- (-1171.220) (-1169.862) (-1168.075) [-1169.173] * (-1167.694) [-1170.759] (-1171.168) (-1168.401) -- 0:00:42
318500 -- (-1170.189) (-1171.237) [-1168.594] (-1169.173) * (-1169.396) [-1170.662] (-1170.489) (-1168.762) -- 0:00:42
319000 -- (-1172.725) (-1170.304) (-1169.397) [-1169.212] * [-1170.664] (-1168.710) (-1170.276) (-1167.988) -- 0:00:42
319500 -- (-1171.716) (-1169.301) [-1169.366] (-1171.309) * (-1168.327) (-1168.584) [-1167.948] (-1167.777) -- 0:00:42
320000 -- (-1173.589) [-1172.038] (-1168.830) (-1170.557) * (-1168.265) [-1171.076] (-1171.564) (-1169.361) -- 0:00:42
Average standard deviation of split frequencies: 0.013394
320500 -- (-1169.498) [-1169.654] (-1170.167) (-1171.534) * (-1168.293) [-1168.475] (-1171.785) (-1169.508) -- 0:00:42
321000 -- (-1170.878) (-1170.992) (-1169.177) [-1170.014] * [-1170.323] (-1172.912) (-1171.261) (-1170.201) -- 0:00:42
321500 -- (-1178.430) (-1173.723) (-1171.514) [-1170.426] * (-1168.715) (-1170.759) [-1169.152] (-1169.650) -- 0:00:42
322000 -- (-1177.427) [-1172.719] (-1172.374) (-1168.604) * (-1168.383) (-1169.954) [-1171.185] (-1170.099) -- 0:00:42
322500 -- (-1168.170) (-1171.144) [-1169.720] (-1170.861) * [-1167.941] (-1169.676) (-1169.779) (-1170.234) -- 0:00:42
323000 -- (-1169.251) (-1170.907) [-1170.603] (-1170.217) * (-1168.513) (-1170.083) [-1168.484] (-1170.902) -- 0:00:41
323500 -- (-1171.476) [-1171.350] (-1168.891) (-1174.435) * (-1170.843) (-1170.551) (-1172.064) [-1169.994] -- 0:00:41
324000 -- (-1169.951) (-1175.051) (-1171.278) [-1170.842] * (-1171.339) (-1168.385) (-1171.658) [-1173.115] -- 0:00:41
324500 -- (-1168.476) [-1171.365] (-1169.402) (-1171.780) * (-1176.808) [-1169.733] (-1176.124) (-1173.602) -- 0:00:41
325000 -- (-1169.134) (-1169.758) (-1168.922) [-1170.115] * [-1170.567] (-1180.936) (-1168.069) (-1170.971) -- 0:00:41
Average standard deviation of split frequencies: 0.013336
325500 -- (-1168.582) (-1168.754) (-1169.421) [-1170.826] * (-1171.302) (-1174.922) [-1168.973] (-1170.927) -- 0:00:41
326000 -- (-1168.101) (-1168.779) [-1169.467] (-1172.332) * (-1176.175) (-1169.720) (-1168.269) [-1169.134] -- 0:00:41
326500 -- (-1169.368) (-1170.611) (-1170.593) [-1170.618] * (-1172.431) [-1168.037] (-1167.877) (-1168.179) -- 0:00:41
327000 -- (-1169.843) (-1168.889) (-1169.581) [-1170.021] * (-1171.134) [-1168.194] (-1168.223) (-1168.336) -- 0:00:41
327500 -- (-1170.630) (-1168.368) [-1169.633] (-1171.419) * [-1169.672] (-1169.126) (-1175.539) (-1169.327) -- 0:00:41
328000 -- (-1169.213) [-1169.637] (-1169.633) (-1172.742) * (-1168.980) (-1170.094) (-1168.899) [-1168.749] -- 0:00:40
328500 -- (-1172.326) (-1168.209) [-1168.366] (-1170.909) * [-1170.000] (-1168.423) (-1169.066) (-1168.463) -- 0:00:40
329000 -- (-1169.420) (-1169.703) [-1168.356] (-1170.995) * (-1169.841) [-1169.667] (-1171.686) (-1168.334) -- 0:00:42
329500 -- (-1173.052) [-1169.387] (-1174.209) (-1170.718) * (-1173.561) (-1168.413) (-1172.926) [-1169.420] -- 0:00:42
330000 -- (-1174.371) [-1169.221] (-1169.331) (-1169.607) * [-1168.682] (-1167.883) (-1169.739) (-1171.859) -- 0:00:42
Average standard deviation of split frequencies: 0.013656
330500 -- (-1176.572) [-1167.923] (-1171.533) (-1170.741) * (-1169.482) [-1170.761] (-1170.817) (-1172.244) -- 0:00:42
331000 -- (-1173.642) (-1169.124) (-1174.382) [-1168.801] * (-1169.979) (-1168.159) [-1171.297] (-1173.578) -- 0:00:42
331500 -- (-1169.254) [-1169.328] (-1168.799) (-1170.467) * (-1168.872) [-1168.944] (-1171.621) (-1169.868) -- 0:00:42
332000 -- (-1169.658) (-1170.029) (-1171.375) [-1169.993] * (-1168.536) (-1169.047) [-1171.414] (-1171.558) -- 0:00:42
332500 -- (-1169.492) (-1169.805) (-1170.274) [-1171.204] * (-1169.221) (-1169.964) (-1172.764) [-1171.886] -- 0:00:42
333000 -- (-1169.585) (-1169.726) [-1168.202] (-1170.251) * [-1174.871] (-1172.595) (-1171.034) (-1171.265) -- 0:00:42
333500 -- (-1168.600) (-1174.033) [-1168.887] (-1171.340) * (-1174.262) [-1169.019] (-1173.391) (-1171.571) -- 0:00:41
334000 -- [-1170.735] (-1168.599) (-1169.789) (-1171.311) * (-1173.704) [-1169.383] (-1170.857) (-1171.206) -- 0:00:41
334500 -- (-1169.902) [-1169.091] (-1168.984) (-1170.004) * (-1170.308) (-1171.271) [-1167.945] (-1171.531) -- 0:00:41
335000 -- (-1168.061) [-1169.547] (-1171.048) (-1171.284) * (-1174.087) (-1168.457) (-1171.080) [-1168.132] -- 0:00:41
Average standard deviation of split frequencies: 0.014186
335500 -- (-1169.177) [-1169.724] (-1172.371) (-1171.563) * [-1170.880] (-1174.080) (-1171.220) (-1171.713) -- 0:00:41
336000 -- (-1169.712) (-1167.831) (-1168.903) [-1169.232] * (-1171.645) (-1170.619) (-1172.073) [-1169.064] -- 0:00:41
336500 -- (-1168.623) (-1170.105) [-1168.174] (-1169.280) * (-1170.065) (-1169.632) [-1169.053] (-1170.307) -- 0:00:41
337000 -- (-1169.356) (-1171.277) [-1168.309] (-1169.117) * (-1169.863) (-1169.792) [-1169.698] (-1168.968) -- 0:00:41
337500 -- (-1168.455) [-1170.311] (-1170.397) (-1168.552) * (-1168.999) [-1170.326] (-1170.937) (-1168.062) -- 0:00:41
338000 -- (-1169.478) (-1170.212) [-1169.509] (-1169.996) * (-1170.105) (-1170.884) (-1169.703) [-1169.918] -- 0:00:41
338500 -- [-1172.747] (-1168.529) (-1170.996) (-1175.164) * (-1171.115) (-1173.420) (-1175.447) [-1169.786] -- 0:00:41
339000 -- (-1170.270) (-1170.785) (-1171.244) [-1171.474] * (-1170.355) [-1174.784] (-1170.388) (-1173.468) -- 0:00:40
339500 -- [-1171.023] (-1174.901) (-1170.506) (-1168.424) * (-1171.408) (-1171.327) (-1171.322) [-1170.953] -- 0:00:40
340000 -- (-1169.738) (-1174.117) [-1171.058] (-1170.148) * (-1171.178) (-1171.303) (-1172.444) [-1171.458] -- 0:00:40
Average standard deviation of split frequencies: 0.015059
340500 -- (-1170.031) (-1170.097) (-1170.127) [-1168.432] * (-1170.294) (-1170.859) [-1168.917] (-1169.352) -- 0:00:40
341000 -- (-1169.177) (-1170.895) [-1168.201] (-1169.665) * (-1170.250) (-1170.015) [-1169.007] (-1171.358) -- 0:00:40
341500 -- [-1168.617] (-1171.353) (-1175.027) (-1168.444) * [-1171.551] (-1168.214) (-1171.736) (-1170.347) -- 0:00:40
342000 -- (-1168.671) (-1171.151) [-1168.223] (-1168.931) * (-1168.383) [-1169.097] (-1168.948) (-1169.018) -- 0:00:40
342500 -- (-1168.513) (-1170.278) [-1168.865] (-1167.870) * (-1167.868) (-1169.694) (-1169.077) [-1170.233] -- 0:00:40
343000 -- (-1168.548) [-1171.562] (-1172.886) (-1169.128) * (-1168.713) [-1169.296] (-1169.909) (-1168.566) -- 0:00:40
343500 -- (-1168.619) (-1172.560) (-1173.305) [-1169.632] * (-1172.998) (-1168.324) (-1170.052) [-1169.491] -- 0:00:40
344000 -- (-1168.292) (-1171.862) [-1170.341] (-1168.606) * (-1172.652) [-1171.356] (-1178.016) (-1173.923) -- 0:00:40
344500 -- (-1168.326) [-1172.104] (-1169.680) (-1173.474) * [-1169.570] (-1171.399) (-1174.245) (-1175.728) -- 0:00:39
345000 -- (-1169.593) [-1170.408] (-1168.179) (-1169.101) * [-1168.083] (-1170.681) (-1172.210) (-1172.859) -- 0:00:41
Average standard deviation of split frequencies: 0.014827
345500 -- (-1171.774) (-1169.391) [-1170.771] (-1170.733) * (-1168.223) [-1169.897] (-1169.218) (-1169.818) -- 0:00:41
346000 -- [-1173.710] (-1169.076) (-1176.469) (-1170.264) * (-1170.268) (-1169.729) [-1168.101] (-1171.370) -- 0:00:41
346500 -- (-1170.465) [-1169.025] (-1168.765) (-1170.238) * (-1170.049) [-1169.285] (-1169.949) (-1168.554) -- 0:00:41
347000 -- [-1168.971] (-1168.982) (-1169.577) (-1172.548) * (-1171.648) [-1169.433] (-1172.066) (-1168.185) -- 0:00:41
347500 -- [-1173.026] (-1171.446) (-1175.302) (-1175.067) * (-1171.571) (-1173.415) [-1174.946] (-1169.444) -- 0:00:41
348000 -- [-1172.846] (-1169.573) (-1176.873) (-1170.311) * [-1169.295] (-1172.584) (-1168.919) (-1171.483) -- 0:00:41
348500 -- (-1171.371) (-1170.111) (-1178.260) [-1171.586] * (-1170.426) [-1170.556] (-1169.243) (-1169.897) -- 0:00:41
349000 -- (-1172.133) [-1169.088] (-1170.065) (-1171.242) * (-1168.249) (-1170.881) (-1168.170) [-1169.660] -- 0:00:41
349500 -- [-1168.938] (-1168.700) (-1171.672) (-1172.121) * (-1167.848) (-1171.602) [-1168.213] (-1169.049) -- 0:00:40
350000 -- [-1168.471] (-1173.428) (-1171.185) (-1169.930) * (-1171.970) [-1170.693] (-1170.337) (-1171.982) -- 0:00:40
Average standard deviation of split frequencies: 0.014313
350500 -- (-1169.369) (-1170.254) [-1170.865] (-1169.996) * (-1170.314) [-1170.767] (-1170.539) (-1168.943) -- 0:00:40
351000 -- (-1168.949) (-1171.772) [-1174.476] (-1169.735) * (-1171.313) [-1170.097] (-1169.165) (-1169.829) -- 0:00:40
351500 -- (-1171.278) (-1173.035) (-1175.275) [-1170.229] * (-1170.707) [-1170.750] (-1171.342) (-1168.582) -- 0:00:40
352000 -- (-1169.278) [-1168.829] (-1174.034) (-1173.870) * [-1168.797] (-1169.684) (-1169.122) (-1168.708) -- 0:00:40
352500 -- (-1170.929) [-1169.967] (-1170.809) (-1172.509) * (-1168.793) (-1169.557) (-1169.878) [-1170.681] -- 0:00:40
353000 -- (-1169.568) (-1170.109) [-1169.762] (-1170.854) * (-1169.042) (-1170.232) [-1170.415] (-1169.131) -- 0:00:40
353500 -- [-1167.674] (-1169.704) (-1168.955) (-1169.550) * (-1169.402) (-1170.289) (-1169.645) [-1169.500] -- 0:00:40
354000 -- (-1168.916) [-1170.317] (-1169.599) (-1170.138) * (-1171.894) (-1175.014) (-1169.752) [-1169.863] -- 0:00:40
354500 -- [-1169.743] (-1173.128) (-1169.473) (-1171.750) * [-1170.260] (-1173.940) (-1170.136) (-1171.737) -- 0:00:40
355000 -- (-1174.398) (-1170.593) [-1170.486] (-1170.032) * [-1169.636] (-1174.044) (-1171.536) (-1171.150) -- 0:00:39
Average standard deviation of split frequencies: 0.013787
355500 -- (-1168.772) (-1171.022) (-1171.525) [-1168.811] * [-1170.806] (-1169.165) (-1170.235) (-1173.263) -- 0:00:39
356000 -- [-1168.225] (-1174.620) (-1170.265) (-1172.181) * (-1171.897) (-1168.171) [-1171.824] (-1171.688) -- 0:00:39
356500 -- (-1172.403) (-1169.539) (-1170.602) [-1169.708] * (-1169.498) [-1169.159] (-1172.443) (-1170.959) -- 0:00:39
357000 -- (-1171.491) [-1169.134] (-1169.640) (-1173.356) * (-1174.915) [-1168.859] (-1171.903) (-1169.697) -- 0:00:39
357500 -- [-1170.804] (-1171.671) (-1168.592) (-1170.009) * (-1169.542) (-1169.061) [-1169.544] (-1172.133) -- 0:00:39
358000 -- (-1169.295) [-1171.216] (-1168.963) (-1169.354) * (-1175.191) [-1169.586] (-1169.181) (-1169.608) -- 0:00:39
358500 -- [-1170.009] (-1171.242) (-1175.864) (-1169.353) * (-1169.757) (-1168.537) (-1168.300) [-1168.186] -- 0:00:39
359000 -- (-1172.034) [-1169.799] (-1173.882) (-1168.972) * (-1171.794) (-1168.112) [-1171.572] (-1168.998) -- 0:00:39
359500 -- [-1168.987] (-1170.491) (-1174.773) (-1168.976) * [-1169.060] (-1171.235) (-1170.289) (-1170.354) -- 0:00:39
360000 -- (-1169.213) [-1169.480] (-1176.406) (-1169.542) * [-1170.072] (-1171.242) (-1167.837) (-1168.105) -- 0:00:39
Average standard deviation of split frequencies: 0.012589
360500 -- (-1169.570) (-1171.258) (-1174.019) [-1170.572] * (-1169.273) (-1172.612) (-1170.785) [-1168.220] -- 0:00:39
361000 -- (-1168.933) (-1170.518) (-1172.448) [-1171.219] * (-1168.686) [-1173.362] (-1168.202) (-1171.501) -- 0:00:40
361500 -- [-1174.573] (-1172.644) (-1170.710) (-1168.600) * [-1169.318] (-1170.818) (-1169.427) (-1169.541) -- 0:00:40
362000 -- (-1174.747) (-1168.017) [-1169.813] (-1169.571) * (-1169.720) [-1170.906] (-1169.565) (-1170.285) -- 0:00:40
362500 -- (-1170.582) [-1171.070] (-1169.443) (-1172.125) * [-1169.541] (-1169.997) (-1170.592) (-1172.887) -- 0:00:40
363000 -- (-1169.504) (-1169.993) (-1173.901) [-1169.472] * (-1173.179) (-1170.198) (-1173.493) [-1170.981] -- 0:00:40
363500 -- [-1171.601] (-1171.107) (-1172.278) (-1169.898) * (-1169.307) (-1169.812) (-1174.955) [-1170.050] -- 0:00:40
364000 -- (-1168.311) (-1174.594) (-1175.421) [-1169.103] * (-1170.064) [-1173.362] (-1169.190) (-1169.783) -- 0:00:40
364500 -- (-1169.679) [-1171.501] (-1170.925) (-1169.029) * (-1170.110) (-1172.891) [-1170.873] (-1174.898) -- 0:00:40
365000 -- (-1169.019) (-1170.154) [-1171.809] (-1168.961) * (-1169.813) (-1173.431) [-1168.891] (-1169.178) -- 0:00:40
Average standard deviation of split frequencies: 0.012300
365500 -- (-1168.866) (-1171.788) [-1172.814] (-1168.425) * [-1169.790] (-1168.803) (-1170.926) (-1168.751) -- 0:00:39
366000 -- (-1169.340) [-1169.821] (-1173.949) (-1168.098) * [-1168.979] (-1169.940) (-1172.837) (-1168.124) -- 0:00:39
366500 -- [-1171.314] (-1169.820) (-1172.362) (-1168.176) * (-1172.354) (-1169.666) (-1168.760) [-1168.168] -- 0:00:39
367000 -- (-1170.228) [-1170.563] (-1175.422) (-1173.856) * (-1168.954) (-1169.495) (-1169.178) [-1168.103] -- 0:00:39
367500 -- [-1170.521] (-1169.344) (-1174.687) (-1172.294) * (-1172.119) (-1168.807) [-1168.308] (-1171.277) -- 0:00:39
368000 -- (-1168.824) (-1169.608) (-1174.445) [-1171.049] * (-1170.209) (-1171.273) [-1168.152] (-1168.702) -- 0:00:39
368500 -- [-1169.961] (-1169.729) (-1169.998) (-1169.777) * (-1172.693) (-1169.776) (-1170.915) [-1168.950] -- 0:00:39
369000 -- (-1172.760) (-1169.038) (-1168.302) [-1170.371] * (-1170.869) (-1171.465) [-1168.777] (-1168.953) -- 0:00:39
369500 -- (-1172.739) (-1169.009) (-1168.548) [-1169.276] * (-1171.900) (-1173.204) [-1170.639] (-1169.200) -- 0:00:39
370000 -- (-1175.093) (-1169.016) (-1172.123) [-1169.652] * [-1171.260] (-1173.591) (-1171.764) (-1169.479) -- 0:00:39
Average standard deviation of split frequencies: 0.012273
370500 -- (-1178.190) [-1170.069] (-1168.098) (-1169.849) * (-1169.768) (-1170.971) (-1169.409) [-1169.518] -- 0:00:39
371000 -- (-1173.043) [-1167.989] (-1169.701) (-1174.105) * (-1169.253) (-1171.372) [-1171.378] (-1168.934) -- 0:00:38
371500 -- (-1174.804) (-1169.050) (-1168.462) [-1170.528] * (-1169.683) [-1168.771] (-1170.059) (-1182.219) -- 0:00:38
372000 -- (-1170.003) (-1169.416) [-1171.076] (-1171.096) * (-1168.701) [-1170.384] (-1169.199) (-1182.156) -- 0:00:38
372500 -- (-1169.309) [-1171.533] (-1169.919) (-1170.034) * [-1172.854] (-1171.648) (-1172.802) (-1171.990) -- 0:00:38
373000 -- (-1169.437) (-1168.723) [-1170.384] (-1170.985) * [-1170.004] (-1173.163) (-1173.039) (-1173.204) -- 0:00:38
373500 -- (-1167.960) (-1168.866) [-1173.575] (-1168.455) * (-1171.922) (-1169.471) (-1174.054) [-1171.335] -- 0:00:38
374000 -- [-1168.588] (-1170.052) (-1173.211) (-1169.991) * (-1172.706) [-1173.274] (-1168.581) (-1171.117) -- 0:00:38
374500 -- [-1168.427] (-1170.798) (-1173.793) (-1170.816) * (-1169.041) [-1168.618] (-1168.841) (-1172.287) -- 0:00:38
375000 -- (-1170.111) (-1169.731) (-1168.931) [-1170.110] * [-1170.261] (-1172.470) (-1169.372) (-1169.361) -- 0:00:38
Average standard deviation of split frequencies: 0.012207
375500 -- (-1170.037) (-1180.780) [-1168.712] (-1169.154) * (-1168.717) [-1168.477] (-1170.026) (-1173.569) -- 0:00:38
376000 -- [-1170.645] (-1170.775) (-1170.483) (-1173.040) * [-1169.293] (-1172.276) (-1170.919) (-1172.617) -- 0:00:38
376500 -- (-1168.581) [-1173.357] (-1169.408) (-1177.612) * [-1170.340] (-1169.710) (-1171.684) (-1171.418) -- 0:00:38
377000 -- (-1168.633) (-1172.995) [-1167.946] (-1172.023) * (-1170.782) (-1170.927) (-1171.714) [-1169.774] -- 0:00:39
377500 -- (-1168.595) (-1169.541) (-1170.596) [-1168.651] * (-1171.188) [-1169.983] (-1172.491) (-1168.432) -- 0:00:39
378000 -- (-1170.106) [-1170.506] (-1170.387) (-1172.317) * (-1170.162) [-1170.450] (-1172.857) (-1168.500) -- 0:00:39
378500 -- (-1170.622) (-1175.718) [-1169.886] (-1171.871) * [-1173.489] (-1169.384) (-1171.872) (-1168.832) -- 0:00:39
379000 -- [-1169.058] (-1169.475) (-1168.818) (-1171.073) * (-1173.355) (-1168.774) [-1169.882] (-1171.885) -- 0:00:39
379500 -- (-1168.955) [-1174.240] (-1169.697) (-1168.609) * (-1168.474) (-1171.190) (-1169.364) [-1167.996] -- 0:00:39
380000 -- (-1169.165) (-1169.945) (-1171.366) [-1167.923] * (-1170.337) (-1170.657) (-1169.807) [-1171.369] -- 0:00:39
Average standard deviation of split frequencies: 0.011667
380500 -- (-1172.945) [-1170.110] (-1168.343) (-1170.457) * [-1169.499] (-1171.333) (-1171.532) (-1172.659) -- 0:00:39
381000 -- (-1171.233) (-1168.351) [-1168.387] (-1169.622) * (-1171.566) (-1169.990) (-1171.108) [-1169.169] -- 0:00:38
381500 -- (-1176.432) (-1170.167) (-1167.819) [-1169.992] * (-1168.149) [-1168.021] (-1169.428) (-1170.838) -- 0:00:38
382000 -- (-1170.294) (-1171.139) [-1169.147] (-1168.016) * [-1168.262] (-1168.697) (-1169.702) (-1169.659) -- 0:00:38
382500 -- (-1169.664) (-1168.981) [-1171.507] (-1170.894) * [-1169.700] (-1171.293) (-1169.853) (-1171.574) -- 0:00:38
383000 -- (-1170.445) (-1168.653) [-1171.597] (-1169.016) * (-1174.652) [-1169.382] (-1169.239) (-1171.638) -- 0:00:38
383500 -- (-1170.409) [-1168.166] (-1171.082) (-1169.022) * [-1170.003] (-1170.437) (-1169.907) (-1171.069) -- 0:00:38
384000 -- (-1174.498) [-1169.048] (-1168.699) (-1168.491) * (-1168.726) (-1167.977) [-1170.863] (-1170.561) -- 0:00:38
384500 -- (-1173.429) [-1170.417] (-1168.723) (-1170.648) * (-1170.045) (-1170.192) [-1169.369] (-1169.581) -- 0:00:38
385000 -- [-1169.521] (-1169.894) (-1170.990) (-1170.204) * (-1169.811) (-1171.938) [-1168.964] (-1172.579) -- 0:00:38
Average standard deviation of split frequencies: 0.011313
385500 -- (-1173.738) (-1170.658) [-1170.375] (-1173.211) * (-1170.089) (-1171.826) [-1171.397] (-1173.203) -- 0:00:38
386000 -- [-1173.104] (-1171.117) (-1170.397) (-1170.917) * (-1168.770) [-1169.130] (-1170.655) (-1172.194) -- 0:00:38
386500 -- (-1170.295) [-1168.752] (-1168.149) (-1169.353) * (-1170.218) (-1170.067) [-1170.275] (-1172.059) -- 0:00:38
387000 -- (-1170.675) (-1170.945) [-1168.131] (-1169.919) * [-1170.196] (-1170.733) (-1171.863) (-1171.010) -- 0:00:38
387500 -- (-1170.804) [-1170.600] (-1168.051) (-1170.828) * [-1169.922] (-1169.364) (-1172.021) (-1170.689) -- 0:00:37
388000 -- [-1169.890] (-1170.800) (-1168.890) (-1170.294) * (-1169.800) (-1169.669) [-1172.906] (-1170.752) -- 0:00:37
388500 -- (-1171.324) (-1171.978) (-1168.235) [-1170.063] * [-1169.228] (-1176.575) (-1170.816) (-1169.820) -- 0:00:37
389000 -- (-1171.660) [-1174.718] (-1170.309) (-1170.351) * (-1169.227) [-1169.303] (-1169.417) (-1168.569) -- 0:00:37
389500 -- [-1171.055] (-1174.455) (-1170.390) (-1172.210) * (-1169.228) (-1171.441) (-1169.583) [-1168.737] -- 0:00:37
390000 -- (-1170.867) (-1175.741) (-1172.167) [-1170.572] * (-1169.152) [-1171.696] (-1170.700) (-1170.994) -- 0:00:37
Average standard deviation of split frequencies: 0.012187
390500 -- (-1170.171) (-1170.266) [-1169.863] (-1170.129) * (-1169.836) (-1171.543) (-1170.016) [-1168.916] -- 0:00:37
391000 -- (-1168.756) (-1168.716) [-1170.705] (-1169.390) * (-1169.184) [-1171.564] (-1169.363) (-1171.270) -- 0:00:37
391500 -- (-1168.414) (-1171.953) [-1174.626] (-1170.873) * [-1174.708] (-1172.945) (-1173.762) (-1174.712) -- 0:00:37
392000 -- (-1170.749) (-1170.833) (-1175.116) [-1171.525] * (-1175.271) [-1169.661] (-1175.575) (-1169.389) -- 0:00:37
392500 -- (-1169.353) (-1170.928) [-1171.325] (-1170.659) * (-1171.731) (-1171.943) (-1170.280) [-1170.575] -- 0:00:37
393000 -- (-1171.527) (-1174.398) (-1172.829) [-1172.829] * (-1171.454) (-1169.663) [-1168.272] (-1169.405) -- 0:00:38
393500 -- (-1170.459) (-1172.172) (-1169.495) [-1169.402] * (-1170.325) (-1171.370) [-1168.436] (-1169.403) -- 0:00:38
394000 -- (-1168.696) [-1173.658] (-1168.295) (-1169.327) * (-1170.334) (-1168.348) (-1170.950) [-1170.719] -- 0:00:38
394500 -- [-1169.265] (-1174.234) (-1168.393) (-1169.328) * (-1170.980) (-1169.404) [-1171.298] (-1172.618) -- 0:00:38
395000 -- (-1170.327) (-1172.775) [-1170.866] (-1168.736) * (-1170.619) (-1169.404) [-1171.357] (-1169.133) -- 0:00:38
Average standard deviation of split frequencies: 0.012440
395500 -- (-1169.141) [-1169.465] (-1169.614) (-1172.185) * (-1171.117) (-1168.984) (-1168.847) [-1169.974] -- 0:00:38
396000 -- (-1173.323) (-1168.111) (-1169.563) [-1171.807] * (-1170.837) [-1168.624] (-1170.258) (-1167.916) -- 0:00:38
396500 -- (-1169.657) (-1170.680) (-1169.404) [-1170.752] * (-1169.357) [-1168.320] (-1173.368) (-1168.102) -- 0:00:38
397000 -- (-1169.676) (-1170.169) [-1168.107] (-1169.803) * [-1168.746] (-1167.717) (-1171.923) (-1168.883) -- 0:00:37
397500 -- [-1168.919] (-1172.424) (-1173.298) (-1169.892) * (-1169.902) (-1172.076) (-1174.636) [-1168.703] -- 0:00:37
398000 -- (-1167.887) [-1168.948] (-1173.041) (-1169.460) * [-1168.958] (-1172.467) (-1171.028) (-1168.674) -- 0:00:37
398500 -- (-1167.868) (-1171.576) [-1171.377] (-1169.906) * (-1168.530) (-1173.193) (-1170.554) [-1169.330] -- 0:00:37
399000 -- (-1167.656) (-1169.476) [-1168.177] (-1175.484) * (-1168.639) (-1171.286) [-1168.544] (-1169.502) -- 0:00:37
399500 -- (-1167.767) (-1170.496) [-1169.623] (-1171.865) * (-1170.874) [-1171.519] (-1173.274) (-1167.953) -- 0:00:37
400000 -- (-1167.762) [-1171.748] (-1167.932) (-1170.412) * [-1171.267] (-1173.122) (-1168.721) (-1167.941) -- 0:00:37
Average standard deviation of split frequencies: 0.012385
400500 -- (-1168.602) (-1169.879) (-1167.888) [-1170.434] * (-1169.652) [-1171.348] (-1168.723) (-1172.684) -- 0:00:37
401000 -- [-1170.456] (-1169.428) (-1169.323) (-1167.970) * (-1169.822) (-1169.441) [-1170.063] (-1172.077) -- 0:00:37
401500 -- (-1170.619) [-1171.523] (-1172.368) (-1168.286) * (-1168.976) [-1169.732] (-1170.420) (-1178.569) -- 0:00:37
402000 -- (-1169.141) (-1168.539) (-1169.592) [-1171.775] * [-1169.675] (-1170.239) (-1170.740) (-1172.566) -- 0:00:37
402500 -- (-1171.252) (-1170.065) (-1175.952) [-1170.151] * (-1169.018) (-1169.595) (-1170.731) [-1171.974] -- 0:00:37
403000 -- (-1173.341) (-1169.943) [-1170.921] (-1171.463) * (-1168.614) (-1171.025) [-1169.055] (-1170.226) -- 0:00:37
403500 -- (-1171.566) (-1170.491) (-1169.945) [-1169.828] * (-1168.435) [-1170.648] (-1171.133) (-1170.809) -- 0:00:36
404000 -- [-1172.257] (-1168.698) (-1169.793) (-1168.930) * (-1171.499) (-1172.448) [-1169.250] (-1168.738) -- 0:00:36
404500 -- (-1170.559) [-1169.929] (-1168.708) (-1168.466) * (-1169.081) [-1170.248] (-1168.630) (-1169.097) -- 0:00:36
405000 -- [-1169.885] (-1168.593) (-1170.871) (-1168.934) * (-1169.104) (-1170.463) (-1170.667) [-1169.711] -- 0:00:36
Average standard deviation of split frequencies: 0.013120
405500 -- (-1172.247) (-1170.338) [-1168.327] (-1168.469) * (-1168.084) (-1173.055) [-1168.536] (-1169.941) -- 0:00:36
406000 -- [-1170.258] (-1171.360) (-1168.361) (-1169.705) * (-1168.056) (-1172.963) (-1169.264) [-1170.558] -- 0:00:36
406500 -- (-1170.700) (-1173.365) (-1168.143) [-1168.623] * (-1170.672) (-1170.918) (-1169.223) [-1174.099] -- 0:00:36
407000 -- (-1176.558) [-1170.869] (-1169.304) (-1172.693) * [-1169.228] (-1171.244) (-1171.314) (-1171.747) -- 0:00:36
407500 -- (-1177.316) (-1171.387) (-1169.872) [-1171.937] * (-1168.476) (-1170.937) (-1171.445) [-1170.922] -- 0:00:36
408000 -- (-1170.818) (-1176.037) [-1170.434] (-1171.545) * (-1169.599) (-1171.123) [-1168.432] (-1169.259) -- 0:00:36
408500 -- [-1170.348] (-1171.297) (-1170.610) (-1174.888) * (-1171.979) [-1168.234] (-1168.478) (-1171.359) -- 0:00:36
409000 -- (-1173.247) (-1169.466) [-1171.245] (-1172.857) * (-1173.096) (-1169.105) (-1170.497) [-1171.172] -- 0:00:37
409500 -- (-1170.947) (-1170.077) (-1168.424) [-1168.452] * (-1171.891) (-1169.669) [-1170.421] (-1168.997) -- 0:00:37
410000 -- (-1169.145) [-1170.005] (-1168.764) (-1168.407) * (-1168.683) [-1170.820] (-1171.301) (-1170.237) -- 0:00:37
Average standard deviation of split frequencies: 0.012971
410500 -- (-1169.004) (-1171.136) [-1168.806] (-1172.064) * (-1169.124) (-1169.141) [-1168.258] (-1171.573) -- 0:00:37
411000 -- (-1170.040) (-1168.682) [-1171.622] (-1170.954) * (-1169.904) (-1169.437) [-1173.737] (-1173.509) -- 0:00:37
411500 -- (-1169.675) [-1169.567] (-1175.024) (-1171.212) * (-1171.237) [-1168.471] (-1168.771) (-1170.390) -- 0:00:37
412000 -- [-1167.878] (-1172.553) (-1172.215) (-1171.661) * [-1171.297] (-1169.748) (-1170.896) (-1172.215) -- 0:00:37
412500 -- (-1170.029) [-1168.536] (-1169.688) (-1171.182) * (-1177.097) (-1169.485) (-1171.669) [-1170.978] -- 0:00:37
413000 -- [-1168.054] (-1168.983) (-1173.528) (-1170.739) * [-1167.825] (-1169.428) (-1170.550) (-1169.606) -- 0:00:36
413500 -- (-1168.263) [-1168.960] (-1169.145) (-1172.895) * (-1168.484) [-1172.149] (-1175.119) (-1171.750) -- 0:00:36
414000 -- (-1169.707) [-1170.629] (-1170.457) (-1170.845) * (-1168.484) (-1171.193) [-1169.998] (-1171.307) -- 0:00:36
414500 -- (-1169.417) [-1170.541] (-1174.113) (-1173.457) * (-1169.408) (-1168.679) (-1169.503) [-1171.162] -- 0:00:36
415000 -- (-1170.869) (-1169.711) (-1170.242) [-1169.648] * (-1170.926) (-1169.602) [-1170.161] (-1170.592) -- 0:00:36
Average standard deviation of split frequencies: 0.012883
415500 -- (-1168.021) (-1171.000) [-1169.658] (-1169.724) * (-1169.370) (-1171.000) [-1168.635] (-1172.121) -- 0:00:36
416000 -- (-1171.458) (-1172.095) [-1171.812] (-1168.291) * (-1171.563) [-1169.428] (-1168.462) (-1172.057) -- 0:00:36
416500 -- (-1171.158) [-1171.685] (-1170.666) (-1168.039) * (-1172.453) [-1168.402] (-1170.624) (-1169.351) -- 0:00:36
417000 -- (-1170.131) [-1171.376] (-1170.666) (-1168.820) * (-1169.115) (-1168.860) (-1167.759) [-1169.162] -- 0:00:36
417500 -- (-1173.895) (-1168.459) (-1173.746) [-1168.673] * (-1170.389) (-1169.597) [-1171.058] (-1169.859) -- 0:00:36
418000 -- (-1171.138) (-1168.925) (-1169.212) [-1169.980] * (-1170.413) (-1171.510) (-1172.068) [-1169.167] -- 0:00:36
418500 -- (-1173.885) (-1170.919) [-1170.310] (-1172.396) * [-1168.726] (-1175.783) (-1173.155) (-1169.915) -- 0:00:36
419000 -- (-1176.539) (-1168.942) [-1172.753] (-1168.030) * (-1168.247) (-1171.777) (-1170.484) [-1170.549] -- 0:00:36
419500 -- (-1171.066) (-1168.563) [-1167.847] (-1168.596) * [-1172.181] (-1172.564) (-1167.857) (-1169.842) -- 0:00:35
420000 -- (-1169.427) (-1170.566) [-1168.632] (-1168.596) * (-1174.776) (-1171.654) [-1172.513] (-1168.304) -- 0:00:35
Average standard deviation of split frequencies: 0.012681
420500 -- [-1169.324] (-1170.390) (-1170.351) (-1168.595) * (-1173.759) [-1171.247] (-1171.135) (-1171.499) -- 0:00:35
421000 -- [-1169.383] (-1169.782) (-1171.979) (-1169.968) * [-1172.031] (-1169.380) (-1170.720) (-1169.382) -- 0:00:35
421500 -- [-1169.685] (-1175.271) (-1170.283) (-1169.917) * (-1169.933) (-1169.655) (-1169.109) [-1171.622] -- 0:00:35
422000 -- (-1169.127) (-1169.508) [-1170.735] (-1171.438) * [-1168.836] (-1172.479) (-1170.795) (-1167.738) -- 0:00:35
422500 -- (-1169.591) (-1170.581) [-1173.477] (-1172.532) * (-1170.251) (-1170.822) [-1167.939] (-1168.659) -- 0:00:35
423000 -- (-1172.622) (-1172.959) [-1169.241] (-1173.712) * (-1171.985) (-1169.748) [-1169.901] (-1168.063) -- 0:00:35
423500 -- (-1169.630) (-1171.683) (-1169.006) [-1169.038] * (-1172.547) (-1170.064) (-1170.375) [-1167.962] -- 0:00:35
424000 -- (-1168.041) (-1169.348) [-1170.516] (-1168.708) * (-1170.220) (-1170.959) [-1170.227] (-1169.906) -- 0:00:35
424500 -- (-1168.108) (-1167.720) [-1169.683] (-1171.658) * (-1169.383) (-1168.503) [-1169.343] (-1173.637) -- 0:00:35
425000 -- [-1167.919] (-1168.556) (-1172.304) (-1171.393) * (-1172.154) (-1170.273) [-1168.117] (-1170.187) -- 0:00:35
Average standard deviation of split frequencies: 0.012988
425500 -- (-1168.173) [-1167.720] (-1170.537) (-1168.639) * [-1168.298] (-1171.617) (-1170.275) (-1169.391) -- 0:00:36
426000 -- (-1168.843) (-1168.995) (-1168.580) [-1171.375] * (-1171.476) (-1175.700) [-1171.847] (-1169.287) -- 0:00:36
426500 -- (-1168.462) (-1170.625) (-1170.030) [-1169.402] * (-1170.188) (-1176.496) (-1173.964) [-1169.119] -- 0:00:36
427000 -- (-1168.280) [-1169.970] (-1172.279) (-1170.555) * (-1169.384) (-1173.584) (-1170.157) [-1170.733] -- 0:00:36
427500 -- (-1169.232) (-1169.599) (-1172.233) [-1169.024] * (-1170.652) [-1170.624] (-1170.596) (-1172.155) -- 0:00:36
428000 -- (-1172.949) [-1168.933] (-1171.868) (-1168.564) * (-1169.595) [-1172.710] (-1170.618) (-1171.543) -- 0:00:36
428500 -- (-1170.423) [-1169.286] (-1170.033) (-1170.130) * [-1168.134] (-1170.631) (-1171.857) (-1171.542) -- 0:00:36
429000 -- [-1169.081] (-1171.148) (-1170.228) (-1168.819) * (-1170.238) (-1170.556) (-1168.918) [-1172.908] -- 0:00:35
429500 -- (-1169.697) [-1169.724] (-1169.819) (-1169.275) * (-1170.188) (-1170.831) [-1178.101] (-1170.161) -- 0:00:35
430000 -- (-1170.323) (-1173.630) (-1168.216) [-1169.806] * [-1168.420] (-1171.414) (-1178.412) (-1168.115) -- 0:00:35
Average standard deviation of split frequencies: 0.013196
430500 -- (-1171.920) (-1171.999) (-1168.623) [-1171.342] * (-1168.645) (-1170.358) (-1172.982) [-1169.273] -- 0:00:35
431000 -- (-1171.804) (-1168.255) [-1168.043] (-1173.669) * [-1168.475] (-1173.059) (-1172.222) (-1168.807) -- 0:00:35
431500 -- (-1169.308) [-1168.466] (-1169.382) (-1172.067) * (-1170.050) (-1172.787) [-1171.183] (-1169.207) -- 0:00:35
432000 -- (-1169.846) (-1169.392) [-1169.768] (-1169.942) * (-1168.851) [-1171.308] (-1171.057) (-1168.295) -- 0:00:35
432500 -- [-1172.580] (-1168.234) (-1175.578) (-1168.270) * (-1172.277) (-1172.600) [-1170.978] (-1168.654) -- 0:00:35
433000 -- (-1171.288) [-1169.758] (-1172.084) (-1168.556) * (-1169.952) (-1173.517) (-1174.023) [-1168.829] -- 0:00:35
433500 -- (-1169.713) (-1169.630) (-1174.745) [-1167.936] * (-1174.110) [-1175.610] (-1171.861) (-1172.264) -- 0:00:35
434000 -- (-1169.560) [-1169.029] (-1170.578) (-1167.887) * [-1174.394] (-1170.531) (-1170.459) (-1168.059) -- 0:00:35
434500 -- [-1172.999] (-1168.081) (-1169.293) (-1169.538) * (-1172.293) [-1168.922] (-1169.550) (-1168.336) -- 0:00:35
435000 -- (-1169.707) (-1169.723) [-1169.656] (-1169.675) * (-1172.814) (-1169.243) (-1169.464) [-1171.135] -- 0:00:35
Average standard deviation of split frequencies: 0.012804
435500 -- (-1169.892) (-1169.723) [-1171.469] (-1169.484) * [-1174.000] (-1169.171) (-1172.014) (-1170.257) -- 0:00:34
436000 -- [-1169.049] (-1170.684) (-1169.046) (-1171.700) * [-1171.342] (-1168.494) (-1171.998) (-1171.015) -- 0:00:34
436500 -- (-1171.612) (-1169.384) [-1168.709] (-1177.273) * (-1169.446) [-1171.120] (-1170.460) (-1169.788) -- 0:00:34
437000 -- [-1173.166] (-1168.167) (-1169.022) (-1170.863) * (-1169.188) (-1167.947) [-1169.535] (-1168.714) -- 0:00:34
437500 -- (-1170.732) [-1169.436] (-1171.314) (-1170.882) * (-1171.767) [-1169.063] (-1172.062) (-1170.441) -- 0:00:34
438000 -- [-1170.021] (-1169.854) (-1171.719) (-1170.739) * (-1171.266) [-1169.675] (-1173.911) (-1172.376) -- 0:00:34
438500 -- (-1169.821) (-1168.571) [-1170.624] (-1168.693) * (-1171.499) [-1169.058] (-1169.498) (-1172.944) -- 0:00:34
439000 -- (-1170.008) [-1168.748] (-1169.573) (-1168.523) * (-1170.285) (-1169.326) [-1170.305] (-1172.264) -- 0:00:34
439500 -- [-1169.540] (-1168.521) (-1171.332) (-1169.768) * [-1170.402] (-1169.446) (-1170.553) (-1171.357) -- 0:00:34
440000 -- [-1169.458] (-1171.457) (-1168.354) (-1170.489) * (-1171.739) [-1170.096] (-1170.473) (-1170.388) -- 0:00:34
Average standard deviation of split frequencies: 0.012540
440500 -- (-1171.443) (-1170.859) [-1168.397] (-1170.501) * (-1170.246) (-1172.907) [-1170.685] (-1170.425) -- 0:00:34
441000 -- (-1171.206) (-1170.698) [-1168.016] (-1169.596) * [-1168.250] (-1174.457) (-1170.520) (-1172.122) -- 0:00:34
441500 -- (-1172.499) [-1169.380] (-1168.075) (-1179.428) * [-1168.328] (-1173.912) (-1171.097) (-1169.757) -- 0:00:35
442000 -- (-1171.567) [-1169.450] (-1171.527) (-1171.765) * [-1168.690] (-1172.071) (-1170.117) (-1171.707) -- 0:00:35
442500 -- (-1168.362) [-1169.382] (-1172.008) (-1172.155) * (-1169.211) (-1169.738) [-1169.661] (-1174.823) -- 0:00:35
443000 -- (-1169.003) [-1168.623] (-1172.101) (-1171.711) * [-1170.448] (-1167.974) (-1169.302) (-1173.860) -- 0:00:35
443500 -- (-1169.769) (-1169.929) [-1168.376] (-1171.337) * (-1170.579) [-1168.204] (-1169.001) (-1175.516) -- 0:00:35
444000 -- (-1170.215) (-1169.483) [-1168.760] (-1171.108) * (-1170.409) [-1169.079] (-1169.331) (-1172.527) -- 0:00:35
444500 -- (-1173.786) (-1168.432) [-1168.646] (-1170.265) * (-1172.693) (-1172.969) [-1168.274] (-1170.109) -- 0:00:34
445000 -- (-1171.115) [-1168.550] (-1168.514) (-1168.913) * (-1173.665) (-1171.976) (-1168.950) [-1170.476] -- 0:00:34
Average standard deviation of split frequencies: 0.013184
445500 -- (-1170.689) [-1169.367] (-1168.474) (-1171.875) * (-1169.956) [-1172.505] (-1171.199) (-1172.430) -- 0:00:34
446000 -- (-1169.504) [-1169.468] (-1171.072) (-1171.045) * (-1172.010) (-1169.427) (-1172.533) [-1168.794] -- 0:00:34
446500 -- (-1170.207) (-1174.204) (-1169.732) [-1170.882] * [-1169.261] (-1169.147) (-1171.501) (-1171.122) -- 0:00:34
447000 -- (-1172.094) (-1171.405) (-1170.587) [-1171.493] * (-1168.812) (-1172.156) (-1171.642) [-1170.295] -- 0:00:34
447500 -- (-1173.541) (-1171.727) (-1171.523) [-1172.128] * (-1169.997) [-1172.460] (-1173.689) (-1172.850) -- 0:00:34
448000 -- (-1174.349) [-1170.304] (-1174.300) (-1174.101) * (-1169.614) (-1171.378) [-1168.532] (-1173.697) -- 0:00:34
448500 -- (-1174.318) (-1171.165) [-1173.917] (-1171.321) * (-1168.172) [-1171.193] (-1169.004) (-1168.276) -- 0:00:34
449000 -- (-1170.613) [-1169.713] (-1171.810) (-1170.445) * (-1167.809) (-1169.850) (-1169.029) [-1168.096] -- 0:00:34
449500 -- (-1169.072) [-1175.044] (-1171.004) (-1171.356) * (-1168.422) (-1170.078) [-1169.281] (-1168.610) -- 0:00:34
450000 -- (-1171.404) [-1173.148] (-1171.132) (-1172.145) * (-1170.897) [-1172.104] (-1168.840) (-1169.266) -- 0:00:34
Average standard deviation of split frequencies: 0.012814
450500 -- (-1170.798) (-1168.159) (-1169.138) [-1170.392] * (-1171.149) (-1172.182) (-1169.790) [-1170.000] -- 0:00:34
451000 -- (-1169.910) (-1170.050) (-1168.235) [-1168.473] * (-1169.994) (-1171.845) (-1174.337) [-1168.919] -- 0:00:34
451500 -- (-1168.209) [-1169.258] (-1170.588) (-1170.290) * (-1169.995) (-1171.193) (-1174.813) [-1170.207] -- 0:00:34
452000 -- (-1170.448) (-1168.998) [-1168.311] (-1174.333) * [-1172.780] (-1170.317) (-1175.233) (-1171.506) -- 0:00:33
452500 -- (-1169.254) [-1168.510] (-1171.047) (-1172.197) * (-1170.333) (-1175.120) (-1171.018) [-1168.983] -- 0:00:33
453000 -- (-1167.795) (-1169.863) (-1169.310) [-1169.782] * (-1172.703) (-1170.718) (-1170.802) [-1171.432] -- 0:00:33
453500 -- (-1168.141) (-1171.838) (-1168.119) [-1168.293] * (-1171.152) (-1169.144) [-1170.953] (-1172.387) -- 0:00:33
454000 -- (-1170.412) [-1171.931] (-1170.871) (-1169.535) * (-1176.530) (-1169.158) (-1169.494) [-1172.446] -- 0:00:33
454500 -- (-1170.379) [-1169.749] (-1171.111) (-1170.390) * (-1172.192) [-1169.156] (-1179.116) (-1169.109) -- 0:00:33
455000 -- (-1171.830) (-1169.269) (-1174.825) [-1170.864] * (-1172.442) (-1169.008) (-1175.800) [-1169.148] -- 0:00:33
Average standard deviation of split frequencies: 0.012677
455500 -- (-1171.524) [-1169.320] (-1174.817) (-1171.013) * (-1170.100) (-1169.175) [-1169.184] (-1169.183) -- 0:00:33
456000 -- (-1169.995) (-1171.572) [-1169.473] (-1169.067) * (-1173.311) [-1170.170] (-1175.220) (-1172.156) -- 0:00:33
456500 -- [-1169.195] (-1170.086) (-1169.658) (-1171.229) * (-1170.949) [-1170.293] (-1168.748) (-1169.188) -- 0:00:33
457000 -- (-1168.426) (-1170.077) (-1169.176) [-1170.606] * (-1169.613) [-1171.038] (-1170.356) (-1170.672) -- 0:00:33
457500 -- (-1170.538) (-1172.265) [-1167.685] (-1171.937) * (-1169.986) (-1170.381) [-1168.181] (-1170.163) -- 0:00:33
458000 -- (-1175.638) (-1171.518) [-1169.504] (-1173.168) * (-1170.696) [-1170.086] (-1169.510) (-1169.330) -- 0:00:34
458500 -- (-1168.993) (-1170.723) [-1169.493] (-1169.901) * (-1170.743) [-1168.599] (-1167.910) (-1171.711) -- 0:00:34
459000 -- (-1171.037) (-1168.757) (-1169.497) [-1170.222] * (-1172.902) (-1168.345) (-1172.575) [-1171.129] -- 0:00:34
459500 -- [-1171.902] (-1169.977) (-1168.969) (-1168.277) * [-1169.102] (-1169.623) (-1169.666) (-1170.579) -- 0:00:34
460000 -- [-1169.842] (-1171.321) (-1168.191) (-1171.796) * (-1171.446) [-1169.205] (-1169.748) (-1170.335) -- 0:00:34
Average standard deviation of split frequencies: 0.012564
460500 -- (-1174.281) (-1174.372) [-1168.678] (-1168.278) * (-1169.674) (-1174.265) (-1169.449) [-1174.006] -- 0:00:33
461000 -- (-1174.809) [-1168.430] (-1168.231) (-1167.816) * (-1169.571) (-1168.840) [-1170.401] (-1171.645) -- 0:00:33
461500 -- (-1173.789) (-1169.428) (-1168.680) [-1169.853] * (-1170.235) (-1169.510) [-1171.170] (-1169.172) -- 0:00:33
462000 -- (-1168.786) (-1168.066) (-1169.420) [-1170.456] * (-1172.686) (-1173.591) (-1169.154) [-1169.535] -- 0:00:33
462500 -- [-1169.208] (-1171.074) (-1168.667) (-1170.245) * (-1171.866) [-1169.778] (-1172.588) (-1170.548) -- 0:00:33
463000 -- (-1177.762) [-1173.200] (-1170.119) (-1171.571) * (-1174.437) [-1170.084] (-1170.043) (-1169.273) -- 0:00:33
463500 -- (-1173.733) [-1167.984] (-1168.761) (-1169.783) * (-1172.596) (-1168.229) (-1168.628) [-1174.552] -- 0:00:33
464000 -- (-1170.773) (-1168.495) (-1171.267) [-1173.144] * (-1170.698) (-1169.376) [-1167.908] (-1173.426) -- 0:00:33
464500 -- [-1169.871] (-1169.026) (-1168.717) (-1173.509) * (-1170.065) [-1170.641] (-1168.386) (-1170.662) -- 0:00:33
465000 -- (-1167.971) (-1170.797) (-1170.953) [-1169.278] * [-1172.903] (-1169.975) (-1170.838) (-1169.067) -- 0:00:33
Average standard deviation of split frequencies: 0.012778
465500 -- (-1173.802) (-1172.010) [-1175.962] (-1170.738) * (-1170.066) (-1169.769) (-1170.916) [-1168.660] -- 0:00:33
466000 -- [-1169.898] (-1168.625) (-1171.147) (-1169.010) * (-1171.125) (-1170.716) [-1170.749] (-1168.316) -- 0:00:33
466500 -- [-1169.285] (-1168.340) (-1169.771) (-1168.673) * (-1170.720) (-1172.443) [-1169.445] (-1169.821) -- 0:00:33
467000 -- [-1168.513] (-1169.883) (-1169.137) (-1168.503) * (-1171.340) (-1169.676) (-1169.459) [-1169.554] -- 0:00:33
467500 -- (-1171.476) [-1167.735] (-1171.885) (-1171.586) * (-1176.067) [-1169.387] (-1170.957) (-1169.107) -- 0:00:33
468000 -- [-1172.568] (-1169.729) (-1170.894) (-1170.969) * (-1171.875) [-1168.808] (-1173.611) (-1171.519) -- 0:00:32
468500 -- (-1168.917) [-1168.972] (-1174.139) (-1169.980) * (-1178.317) (-1168.549) [-1169.874] (-1168.735) -- 0:00:32
469000 -- [-1169.070] (-1170.933) (-1170.492) (-1170.839) * (-1175.226) [-1168.242] (-1171.255) (-1169.054) -- 0:00:32
469500 -- (-1169.936) [-1170.229] (-1167.707) (-1169.070) * [-1170.521] (-1168.395) (-1171.463) (-1169.542) -- 0:00:32
470000 -- (-1169.312) (-1168.343) [-1167.980] (-1172.474) * (-1168.129) (-1168.372) (-1168.403) [-1169.469] -- 0:00:32
Average standard deviation of split frequencies: 0.012493
470500 -- (-1169.730) [-1170.041] (-1168.937) (-1168.533) * (-1168.716) (-1168.905) (-1168.525) [-1170.650] -- 0:00:32
471000 -- [-1168.842] (-1170.448) (-1169.297) (-1169.314) * (-1169.173) (-1171.691) [-1170.787] (-1173.708) -- 0:00:32
471500 -- (-1169.814) (-1168.608) (-1169.729) [-1172.385] * (-1169.113) (-1169.185) [-1170.504] (-1171.324) -- 0:00:32
472000 -- (-1169.004) [-1168.986] (-1172.519) (-1169.740) * [-1168.427] (-1172.176) (-1170.208) (-1171.121) -- 0:00:32
472500 -- (-1169.216) [-1168.681] (-1169.792) (-1170.165) * (-1168.035) [-1170.583] (-1169.985) (-1171.665) -- 0:00:32
473000 -- [-1170.124] (-1169.160) (-1170.184) (-1169.593) * [-1169.177] (-1170.342) (-1168.579) (-1171.399) -- 0:00:32
473500 -- (-1168.159) (-1170.626) [-1172.955] (-1172.501) * (-1171.814) [-1169.737] (-1169.925) (-1170.494) -- 0:00:32
474000 -- [-1170.069] (-1169.256) (-1171.857) (-1173.463) * (-1169.502) (-1170.237) (-1173.162) [-1170.786] -- 0:00:33
474500 -- (-1168.805) [-1169.296] (-1171.421) (-1169.591) * (-1172.025) (-1171.483) (-1171.550) [-1169.581] -- 0:00:33
475000 -- (-1169.762) [-1170.122] (-1171.651) (-1168.856) * (-1172.303) (-1169.631) (-1172.040) [-1170.696] -- 0:00:33
Average standard deviation of split frequencies: 0.011780
475500 -- [-1169.643] (-1170.246) (-1170.090) (-1168.178) * [-1172.670] (-1168.442) (-1168.200) (-1176.953) -- 0:00:33
476000 -- [-1168.967] (-1172.170) (-1169.817) (-1168.325) * (-1169.283) [-1169.505] (-1171.575) (-1171.104) -- 0:00:33
476500 -- (-1169.383) [-1169.295] (-1173.725) (-1171.165) * (-1168.557) (-1169.539) (-1173.043) [-1171.801] -- 0:00:32
477000 -- (-1169.312) [-1169.250] (-1172.119) (-1174.249) * (-1172.879) (-1169.374) [-1172.973] (-1173.666) -- 0:00:32
477500 -- (-1169.317) (-1169.278) (-1170.931) [-1169.698] * [-1172.180] (-1171.156) (-1170.945) (-1171.004) -- 0:00:32
478000 -- (-1171.963) (-1170.600) (-1168.677) [-1167.990] * (-1173.291) (-1176.660) [-1169.740] (-1173.138) -- 0:00:32
478500 -- (-1172.183) [-1170.355] (-1170.956) (-1169.572) * (-1169.764) (-1178.287) [-1170.731] (-1170.797) -- 0:00:32
479000 -- (-1169.249) (-1172.892) (-1170.957) [-1168.906] * [-1169.778] (-1172.800) (-1169.595) (-1170.992) -- 0:00:32
479500 -- [-1170.827] (-1170.293) (-1171.300) (-1170.848) * (-1168.438) (-1170.492) [-1169.532] (-1170.946) -- 0:00:32
480000 -- (-1170.861) (-1170.536) [-1172.488] (-1174.376) * (-1168.487) [-1168.103] (-1169.883) (-1170.722) -- 0:00:32
Average standard deviation of split frequencies: 0.012388
480500 -- [-1171.022] (-1176.015) (-1172.663) (-1172.603) * [-1172.429] (-1169.526) (-1169.472) (-1173.183) -- 0:00:32
481000 -- [-1169.980] (-1169.990) (-1170.534) (-1170.669) * (-1168.577) (-1173.517) [-1170.966] (-1173.533) -- 0:00:32
481500 -- (-1175.270) [-1170.112] (-1171.119) (-1170.476) * (-1171.701) [-1174.149] (-1168.917) (-1168.399) -- 0:00:32
482000 -- [-1170.736] (-1170.861) (-1174.358) (-1176.310) * (-1177.770) (-1171.598) (-1170.465) [-1168.345] -- 0:00:32
482500 -- (-1172.191) [-1168.728] (-1169.574) (-1170.057) * (-1173.453) (-1168.643) (-1170.401) [-1169.677] -- 0:00:32
483000 -- [-1170.434] (-1168.975) (-1169.234) (-1171.663) * (-1173.283) (-1171.805) (-1168.571) [-1169.591] -- 0:00:32
483500 -- (-1172.606) (-1169.986) (-1171.544) [-1169.348] * [-1168.727] (-1168.147) (-1168.811) (-1172.984) -- 0:00:32
484000 -- [-1170.504] (-1169.611) (-1171.036) (-1169.310) * (-1168.921) (-1172.125) [-1169.671] (-1170.811) -- 0:00:31
484500 -- [-1171.143] (-1169.697) (-1171.208) (-1170.235) * (-1168.540) [-1168.290] (-1171.281) (-1168.851) -- 0:00:31
485000 -- (-1171.677) (-1172.371) (-1168.010) [-1168.729] * (-1170.953) (-1169.018) (-1170.806) [-1174.840] -- 0:00:31
Average standard deviation of split frequencies: 0.012405
485500 -- (-1172.815) (-1171.789) (-1173.087) [-1169.910] * [-1170.768] (-1169.013) (-1170.429) (-1171.477) -- 0:00:31
486000 -- (-1170.524) (-1168.640) [-1170.934] (-1170.129) * [-1170.371] (-1169.859) (-1170.115) (-1178.755) -- 0:00:31
486500 -- (-1170.125) (-1171.500) (-1172.164) [-1168.499] * (-1169.722) (-1168.386) [-1170.736] (-1169.435) -- 0:00:31
487000 -- (-1169.559) (-1172.102) [-1170.056] (-1169.014) * (-1171.609) [-1168.932] (-1168.829) (-1169.958) -- 0:00:31
487500 -- (-1169.086) (-1172.460) [-1170.755] (-1169.481) * [-1171.217] (-1171.593) (-1171.155) (-1168.331) -- 0:00:31
488000 -- [-1170.401] (-1173.162) (-1168.919) (-1168.982) * [-1169.580] (-1169.029) (-1176.471) (-1169.930) -- 0:00:31
488500 -- (-1171.699) (-1168.827) [-1168.891] (-1168.027) * (-1171.137) (-1168.704) [-1167.948] (-1168.115) -- 0:00:31
489000 -- (-1169.426) (-1169.741) (-1168.745) [-1169.308] * (-1169.732) (-1170.640) [-1168.546] (-1168.357) -- 0:00:31
489500 -- (-1174.997) [-1172.680] (-1168.466) (-1169.363) * [-1169.163] (-1169.742) (-1168.122) (-1169.674) -- 0:00:31
490000 -- (-1170.521) (-1170.103) (-1171.473) [-1169.151] * (-1169.163) (-1170.305) [-1168.944] (-1171.798) -- 0:00:32
Average standard deviation of split frequencies: 0.012063
490500 -- (-1170.293) (-1169.709) [-1169.820] (-1168.891) * (-1168.525) (-1168.443) (-1169.902) [-1170.121] -- 0:00:32
491000 -- (-1170.530) (-1168.388) [-1168.880] (-1169.236) * (-1169.166) [-1169.261] (-1170.846) (-1172.109) -- 0:00:32
491500 -- (-1171.055) (-1171.558) (-1172.117) [-1170.198] * (-1168.766) (-1169.205) [-1170.025] (-1170.459) -- 0:00:32
492000 -- (-1174.141) [-1167.925] (-1177.316) (-1170.192) * [-1168.501] (-1168.880) (-1168.254) (-1168.782) -- 0:00:32
492500 -- (-1172.593) [-1170.585] (-1175.982) (-1168.810) * (-1168.973) [-1170.065] (-1168.795) (-1172.812) -- 0:00:31
493000 -- (-1172.714) [-1169.439] (-1173.258) (-1168.365) * (-1173.377) [-1167.977] (-1168.836) (-1169.814) -- 0:00:31
493500 -- (-1168.524) (-1170.785) [-1169.996] (-1168.076) * (-1173.722) (-1168.789) [-1173.052] (-1170.259) -- 0:00:31
494000 -- [-1171.800] (-1169.063) (-1171.234) (-1169.065) * [-1172.437] (-1171.168) (-1171.701) (-1173.988) -- 0:00:31
494500 -- (-1172.231) [-1168.732] (-1176.346) (-1169.107) * [-1174.196] (-1169.509) (-1169.501) (-1173.249) -- 0:00:31
495000 -- [-1168.911] (-1168.358) (-1170.457) (-1170.871) * (-1173.772) [-1169.620] (-1169.092) (-1170.534) -- 0:00:31
Average standard deviation of split frequencies: 0.012039
495500 -- [-1168.848] (-1170.324) (-1169.287) (-1168.355) * (-1174.432) (-1171.968) [-1168.364] (-1170.947) -- 0:00:31
496000 -- (-1171.365) [-1168.751] (-1171.914) (-1169.310) * (-1168.751) [-1170.300] (-1169.515) (-1170.658) -- 0:00:31
496500 -- [-1170.473] (-1169.288) (-1171.055) (-1169.354) * (-1168.289) (-1173.513) (-1172.133) [-1168.770] -- 0:00:31
497000 -- [-1170.587] (-1173.185) (-1169.226) (-1167.795) * [-1168.215] (-1174.450) (-1169.407) (-1172.534) -- 0:00:31
497500 -- (-1171.649) [-1173.111] (-1171.134) (-1170.778) * (-1169.384) [-1170.432] (-1169.090) (-1172.093) -- 0:00:31
498000 -- (-1173.212) (-1167.781) (-1172.546) [-1170.904] * [-1169.950] (-1170.031) (-1169.518) (-1177.155) -- 0:00:31
498500 -- (-1169.906) [-1168.737] (-1169.955) (-1170.597) * (-1170.670) [-1169.482] (-1171.200) (-1171.067) -- 0:00:31
499000 -- [-1170.035] (-1170.303) (-1168.064) (-1171.466) * (-1170.342) (-1174.538) [-1170.078] (-1170.307) -- 0:00:31
499500 -- [-1168.763] (-1168.542) (-1168.077) (-1175.637) * [-1170.623] (-1170.000) (-1169.869) (-1170.837) -- 0:00:31
500000 -- (-1169.229) (-1168.563) [-1167.708] (-1172.503) * (-1168.461) (-1170.903) [-1169.770] (-1169.003) -- 0:00:31
Average standard deviation of split frequencies: 0.011979
500500 -- (-1170.213) (-1168.236) [-1169.347] (-1168.809) * [-1170.689] (-1170.607) (-1170.465) (-1169.421) -- 0:00:30
501000 -- (-1169.839) (-1168.240) [-1171.036] (-1170.236) * (-1172.728) (-1169.202) [-1169.826] (-1171.596) -- 0:00:30
501500 -- (-1169.781) (-1168.887) [-1170.071] (-1173.958) * (-1172.086) (-1172.393) (-1169.538) [-1170.877] -- 0:00:30
502000 -- [-1170.773] (-1168.903) (-1169.894) (-1173.696) * (-1170.245) (-1168.452) (-1171.600) [-1169.664] -- 0:00:30
502500 -- (-1169.645) (-1168.653) (-1170.041) [-1170.544] * [-1170.424] (-1171.209) (-1171.737) (-1170.848) -- 0:00:30
503000 -- (-1171.788) [-1171.009] (-1168.666) (-1170.084) * (-1170.958) [-1170.674] (-1171.712) (-1170.259) -- 0:00:30
503500 -- [-1170.869] (-1170.452) (-1171.501) (-1168.856) * [-1169.758] (-1168.002) (-1169.824) (-1170.257) -- 0:00:30
504000 -- [-1172.794] (-1171.376) (-1171.170) (-1170.018) * (-1168.405) (-1172.095) [-1169.675] (-1170.134) -- 0:00:30
504500 -- [-1171.216] (-1169.033) (-1169.550) (-1168.126) * (-1172.170) [-1171.750] (-1173.480) (-1168.668) -- 0:00:30
505000 -- [-1168.031] (-1169.320) (-1170.650) (-1169.505) * (-1169.366) (-1171.466) (-1169.051) [-1170.814] -- 0:00:30
Average standard deviation of split frequencies: 0.011594
505500 -- (-1169.794) (-1171.789) [-1172.432] (-1168.276) * [-1176.694] (-1170.758) (-1171.327) (-1169.088) -- 0:00:30
506000 -- (-1170.916) (-1171.155) (-1172.048) [-1170.004] * (-1173.842) (-1178.370) [-1168.085] (-1169.288) -- 0:00:31
506500 -- [-1170.832] (-1170.391) (-1171.155) (-1169.560) * [-1169.836] (-1169.534) (-1169.201) (-1169.076) -- 0:00:31
507000 -- (-1174.158) [-1168.479] (-1170.991) (-1169.382) * (-1171.874) [-1167.895] (-1171.242) (-1172.411) -- 0:00:31
507500 -- [-1169.045] (-1169.595) (-1168.846) (-1172.617) * (-1169.814) [-1169.510] (-1170.202) (-1174.332) -- 0:00:31
508000 -- [-1168.878] (-1169.296) (-1171.104) (-1174.204) * (-1170.036) (-1170.787) [-1168.118] (-1169.020) -- 0:00:30
508500 -- (-1169.351) (-1169.979) (-1170.112) [-1169.363] * (-1173.069) (-1170.708) (-1169.114) [-1169.085] -- 0:00:30
509000 -- (-1170.597) [-1169.355] (-1170.941) (-1170.983) * [-1172.507] (-1169.485) (-1172.738) (-1169.917) -- 0:00:30
509500 -- [-1169.776] (-1169.909) (-1169.047) (-1171.825) * (-1170.670) [-1168.346] (-1169.385) (-1170.207) -- 0:00:30
510000 -- (-1172.488) (-1169.566) (-1174.018) [-1169.435] * (-1168.520) (-1168.961) (-1168.354) [-1171.946] -- 0:00:30
Average standard deviation of split frequencies: 0.012243
510500 -- [-1169.621] (-1170.210) (-1172.957) (-1171.812) * (-1171.740) (-1167.882) [-1168.928] (-1169.936) -- 0:00:30
511000 -- (-1168.649) (-1171.089) [-1179.163] (-1169.942) * [-1170.952] (-1171.222) (-1172.337) (-1170.225) -- 0:00:30
511500 -- [-1168.093] (-1171.047) (-1177.059) (-1171.671) * (-1172.433) (-1170.614) (-1171.081) [-1169.737] -- 0:00:30
512000 -- (-1168.296) [-1170.715] (-1171.581) (-1168.571) * (-1169.565) (-1171.561) (-1168.490) [-1173.086] -- 0:00:30
512500 -- (-1168.095) (-1169.614) [-1168.560] (-1168.810) * (-1171.915) (-1173.121) (-1170.499) [-1167.872] -- 0:00:30
513000 -- (-1170.588) (-1171.186) (-1169.143) [-1169.936] * [-1167.968] (-1171.232) (-1167.967) (-1177.082) -- 0:00:30
513500 -- [-1170.900] (-1171.034) (-1169.310) (-1169.637) * [-1170.937] (-1174.659) (-1168.662) (-1171.138) -- 0:00:30
514000 -- (-1171.368) [-1169.225] (-1174.233) (-1171.491) * (-1170.659) (-1172.349) (-1170.156) [-1169.995] -- 0:00:30
514500 -- (-1168.847) [-1169.258] (-1168.641) (-1175.281) * (-1172.125) (-1171.402) (-1168.907) [-1170.285] -- 0:00:30
515000 -- [-1174.612] (-1168.652) (-1172.488) (-1172.885) * (-1170.324) (-1173.286) (-1170.059) [-1168.898] -- 0:00:30
Average standard deviation of split frequencies: 0.011724
515500 -- (-1169.527) (-1169.360) (-1168.999) [-1170.270] * [-1169.129] (-1169.334) (-1169.834) (-1168.281) -- 0:00:30
516000 -- (-1168.379) (-1168.667) (-1171.073) [-1171.190] * [-1169.512] (-1169.062) (-1169.274) (-1172.049) -- 0:00:30
516500 -- (-1168.377) (-1168.708) (-1171.477) [-1170.343] * [-1170.442] (-1171.747) (-1169.025) (-1170.186) -- 0:00:29
517000 -- [-1169.476] (-1168.851) (-1169.705) (-1169.846) * (-1169.501) (-1171.447) (-1171.135) [-1171.840] -- 0:00:29
517500 -- [-1169.206] (-1172.891) (-1168.155) (-1172.483) * (-1168.246) [-1168.859] (-1169.519) (-1171.875) -- 0:00:29
518000 -- (-1168.107) (-1169.322) [-1171.013] (-1171.677) * (-1169.545) [-1169.869] (-1171.047) (-1172.475) -- 0:00:29
518500 -- (-1168.741) (-1168.624) (-1170.243) [-1168.398] * (-1169.649) [-1169.928] (-1170.758) (-1176.095) -- 0:00:29
519000 -- (-1169.341) (-1168.982) [-1173.475] (-1168.606) * (-1169.251) (-1169.409) (-1169.351) [-1171.391] -- 0:00:29
519500 -- [-1172.660] (-1168.735) (-1174.317) (-1170.373) * (-1169.529) [-1170.953] (-1169.455) (-1168.632) -- 0:00:29
520000 -- [-1168.476] (-1170.448) (-1169.822) (-1170.076) * (-1169.262) (-1169.556) [-1170.145] (-1168.438) -- 0:00:29
Average standard deviation of split frequencies: 0.011418
520500 -- (-1169.136) [-1168.090] (-1169.281) (-1170.477) * [-1169.241] (-1170.115) (-1167.985) (-1170.505) -- 0:00:29
521000 -- (-1169.385) (-1171.719) (-1169.880) [-1169.783] * [-1169.531] (-1169.265) (-1167.864) (-1170.102) -- 0:00:29
521500 -- (-1168.173) (-1171.873) (-1169.557) [-1169.559] * (-1168.868) (-1169.222) [-1170.963] (-1169.684) -- 0:00:29
522000 -- (-1170.491) (-1168.766) [-1169.939] (-1169.647) * (-1171.368) (-1172.285) [-1169.935] (-1171.447) -- 0:00:30
522500 -- (-1172.523) (-1169.349) (-1174.224) [-1169.173] * (-1172.983) (-1170.504) [-1170.480] (-1171.800) -- 0:00:30
523000 -- (-1172.078) [-1170.172] (-1168.383) (-1169.241) * (-1170.542) (-1172.370) (-1170.947) [-1168.670] -- 0:00:30
523500 -- [-1169.842] (-1168.957) (-1168.772) (-1169.131) * [-1167.939] (-1174.245) (-1177.588) (-1170.632) -- 0:00:30
524000 -- [-1168.724] (-1169.145) (-1168.002) (-1170.189) * [-1168.596] (-1172.092) (-1171.496) (-1169.252) -- 0:00:29
524500 -- (-1170.408) [-1168.593] (-1171.236) (-1170.823) * (-1168.438) (-1172.196) [-1168.574] (-1173.220) -- 0:00:29
525000 -- (-1170.170) [-1168.242] (-1171.654) (-1169.023) * (-1168.517) (-1172.473) [-1169.625] (-1169.670) -- 0:00:29
Average standard deviation of split frequencies: 0.011551
525500 -- [-1170.369] (-1168.023) (-1171.280) (-1171.311) * (-1168.943) [-1168.850] (-1174.597) (-1170.055) -- 0:00:29
526000 -- (-1169.573) [-1168.374] (-1172.816) (-1171.547) * (-1171.879) [-1171.174] (-1174.542) (-1168.538) -- 0:00:29
526500 -- [-1170.769] (-1171.835) (-1170.892) (-1168.372) * [-1169.347] (-1173.656) (-1168.762) (-1170.303) -- 0:00:29
527000 -- (-1170.696) (-1173.790) [-1168.638] (-1170.519) * (-1171.952) (-1169.817) (-1171.007) [-1170.579] -- 0:00:29
527500 -- [-1169.481] (-1169.638) (-1173.951) (-1171.165) * (-1175.410) [-1170.870] (-1170.554) (-1173.923) -- 0:00:29
528000 -- (-1171.456) [-1171.883] (-1169.202) (-1167.962) * (-1170.686) (-1169.987) [-1169.852] (-1170.548) -- 0:00:29
528500 -- (-1174.004) (-1171.744) [-1170.089] (-1170.629) * (-1169.041) (-1170.142) [-1170.098] (-1169.043) -- 0:00:29
529000 -- (-1171.482) (-1171.718) [-1169.283] (-1170.751) * (-1172.224) [-1171.376] (-1171.153) (-1168.452) -- 0:00:29
529500 -- [-1171.505] (-1169.287) (-1169.649) (-1172.870) * (-1175.118) [-1168.934] (-1169.635) (-1171.472) -- 0:00:29
530000 -- (-1172.302) (-1167.829) (-1171.761) [-1169.934] * [-1172.730] (-1172.829) (-1168.222) (-1172.257) -- 0:00:29
Average standard deviation of split frequencies: 0.012437
530500 -- [-1173.354] (-1168.026) (-1171.179) (-1168.886) * (-1173.080) [-1170.523] (-1168.389) (-1168.540) -- 0:00:29
531000 -- (-1172.658) (-1173.815) (-1177.185) [-1168.633] * [-1175.269] (-1169.247) (-1170.266) (-1168.349) -- 0:00:29
531500 -- (-1174.907) (-1173.650) (-1169.017) [-1171.638] * (-1168.282) (-1170.566) (-1168.748) [-1171.458] -- 0:00:29
532000 -- (-1170.679) [-1169.113] (-1172.677) (-1169.146) * [-1169.153] (-1169.863) (-1169.564) (-1168.343) -- 0:00:29
532500 -- (-1170.535) (-1168.459) (-1169.562) [-1168.409] * [-1171.169] (-1168.220) (-1171.354) (-1168.794) -- 0:00:28
533000 -- (-1169.004) [-1169.699] (-1170.734) (-1170.073) * [-1169.224] (-1170.860) (-1171.461) (-1169.155) -- 0:00:28
533500 -- (-1173.137) (-1168.390) (-1168.850) [-1169.926] * (-1171.987) (-1168.427) [-1174.183] (-1168.520) -- 0:00:28
534000 -- [-1168.688] (-1169.619) (-1170.282) (-1169.462) * (-1171.066) [-1168.762] (-1169.178) (-1169.906) -- 0:00:28
534500 -- (-1167.969) [-1172.466] (-1169.923) (-1171.290) * (-1169.898) (-1169.883) (-1168.510) [-1169.918] -- 0:00:28
535000 -- (-1167.976) [-1170.571] (-1168.336) (-1171.539) * (-1171.284) [-1171.875] (-1173.114) (-1170.339) -- 0:00:28
Average standard deviation of split frequencies: 0.012362
535500 -- [-1168.554] (-1170.803) (-1170.232) (-1168.424) * [-1168.521] (-1169.452) (-1171.061) (-1171.945) -- 0:00:28
536000 -- [-1169.029] (-1170.800) (-1169.484) (-1171.736) * (-1173.517) (-1169.571) (-1172.730) [-1170.068] -- 0:00:28
536500 -- [-1171.026] (-1169.721) (-1169.965) (-1169.806) * (-1174.578) [-1168.298] (-1171.905) (-1174.776) -- 0:00:28
537000 -- (-1168.725) (-1171.684) (-1170.001) [-1170.566] * (-1173.469) (-1169.885) [-1174.388] (-1172.625) -- 0:00:28
537500 -- (-1172.076) (-1168.907) (-1169.211) [-1173.120] * (-1170.772) (-1169.928) (-1171.247) [-1170.505] -- 0:00:28
538000 -- (-1178.397) [-1169.378] (-1170.643) (-1170.492) * (-1170.208) (-1168.916) (-1172.413) [-1168.047] -- 0:00:28
538500 -- (-1171.518) (-1168.634) [-1168.444] (-1169.876) * (-1170.043) (-1170.364) [-1169.903] (-1171.005) -- 0:00:29
539000 -- (-1168.609) [-1168.822] (-1169.232) (-1173.075) * [-1170.554] (-1170.245) (-1169.690) (-1168.418) -- 0:00:29
539500 -- (-1168.249) (-1169.539) [-1169.289] (-1171.176) * (-1171.346) (-1168.117) (-1168.959) [-1168.546] -- 0:00:29
540000 -- (-1169.826) [-1170.539] (-1172.364) (-1171.350) * (-1169.560) (-1168.117) [-1167.694] (-1169.534) -- 0:00:28
Average standard deviation of split frequencies: 0.012546
540500 -- (-1168.207) [-1173.391] (-1168.506) (-1171.102) * (-1173.296) (-1169.732) [-1168.658] (-1170.022) -- 0:00:28
541000 -- (-1170.901) (-1169.282) (-1169.992) [-1168.788] * (-1174.464) (-1167.904) (-1168.678) [-1170.252] -- 0:00:28
541500 -- (-1167.772) (-1170.012) [-1170.749] (-1169.028) * (-1174.345) (-1168.093) (-1168.642) [-1169.551] -- 0:00:28
542000 -- (-1167.969) [-1171.064] (-1171.505) (-1172.338) * (-1172.925) (-1168.730) [-1169.619] (-1169.817) -- 0:00:28
542500 -- (-1168.873) (-1169.363) [-1170.560] (-1170.622) * (-1172.176) [-1169.013] (-1172.439) (-1169.611) -- 0:00:28
543000 -- [-1170.988] (-1170.112) (-1170.272) (-1168.684) * (-1170.411) (-1168.458) [-1169.627] (-1168.650) -- 0:00:28
543500 -- [-1171.412] (-1170.756) (-1170.705) (-1167.831) * (-1168.270) (-1171.098) (-1174.363) [-1170.334] -- 0:00:28
544000 -- (-1169.524) (-1169.179) (-1173.616) [-1172.327] * [-1169.458] (-1168.914) (-1173.903) (-1176.152) -- 0:00:28
544500 -- (-1170.014) [-1170.659] (-1170.956) (-1170.414) * (-1171.133) (-1169.976) [-1169.198] (-1169.405) -- 0:00:28
545000 -- (-1170.567) [-1171.474] (-1171.012) (-1170.306) * (-1172.412) [-1169.277] (-1172.958) (-1167.999) -- 0:00:28
Average standard deviation of split frequencies: 0.012711
545500 -- [-1173.347] (-1170.364) (-1171.340) (-1169.453) * (-1169.469) (-1168.978) (-1173.357) [-1168.222] -- 0:00:28
546000 -- (-1169.781) (-1173.006) [-1168.353] (-1169.391) * (-1170.772) (-1168.469) (-1172.782) [-1169.990] -- 0:00:28
546500 -- (-1169.038) (-1170.652) (-1168.819) [-1169.729] * (-1170.303) (-1168.967) [-1171.469] (-1168.418) -- 0:00:28
547000 -- (-1169.631) (-1169.209) [-1168.773] (-1170.887) * (-1169.085) (-1169.117) [-1170.430] (-1169.825) -- 0:00:28
547500 -- (-1170.369) (-1168.148) (-1169.419) [-1170.715] * (-1169.808) (-1170.366) (-1170.993) [-1171.619] -- 0:00:28
548000 -- (-1170.595) (-1169.082) (-1170.979) [-1170.478] * (-1170.416) (-1172.615) [-1170.967] (-1170.416) -- 0:00:28
548500 -- (-1171.517) (-1169.516) [-1168.980] (-1170.619) * (-1170.576) [-1169.046] (-1168.846) (-1168.044) -- 0:00:27
549000 -- (-1169.470) (-1170.452) [-1168.699] (-1169.244) * (-1170.718) (-1169.770) (-1169.524) [-1170.744] -- 0:00:27
549500 -- (-1172.421) [-1169.703] (-1169.666) (-1169.598) * (-1170.146) (-1168.905) (-1170.185) [-1168.960] -- 0:00:27
550000 -- (-1171.715) [-1168.973] (-1172.672) (-1170.751) * [-1169.019] (-1171.597) (-1168.606) (-1169.230) -- 0:00:27
Average standard deviation of split frequencies: 0.011842
550500 -- (-1173.094) (-1170.362) [-1168.256] (-1169.845) * (-1169.426) (-1168.862) (-1168.512) [-1168.276] -- 0:00:27
551000 -- (-1173.119) (-1170.572) (-1168.926) [-1169.044] * (-1172.948) (-1168.971) (-1175.332) [-1169.266] -- 0:00:27
551500 -- (-1171.513) [-1170.790] (-1171.576) (-1168.123) * [-1168.514] (-1170.892) (-1169.295) (-1169.855) -- 0:00:27
552000 -- (-1171.393) (-1169.285) [-1168.923] (-1168.903) * (-1170.399) (-1172.413) [-1168.406] (-1170.282) -- 0:00:27
552500 -- (-1172.352) (-1169.731) [-1167.899] (-1169.524) * (-1168.541) (-1168.508) [-1168.105] (-1174.092) -- 0:00:27
553000 -- [-1173.538] (-1171.750) (-1169.694) (-1171.906) * (-1174.023) [-1169.441] (-1171.709) (-1173.067) -- 0:00:27
553500 -- (-1168.772) [-1170.569] (-1169.571) (-1168.176) * (-1169.028) (-1168.831) [-1169.089] (-1168.264) -- 0:00:27
554000 -- (-1169.731) [-1168.549] (-1174.731) (-1168.006) * (-1170.799) (-1174.343) (-1169.704) [-1169.012] -- 0:00:27
554500 -- (-1169.732) (-1168.299) [-1169.987] (-1169.249) * (-1170.742) (-1170.663) (-1169.152) [-1169.188] -- 0:00:27
555000 -- (-1170.969) [-1169.293] (-1168.960) (-1167.797) * (-1173.525) [-1168.508] (-1171.051) (-1170.070) -- 0:00:28
Average standard deviation of split frequencies: 0.012058
555500 -- (-1172.302) (-1173.788) [-1169.610] (-1168.656) * (-1169.983) (-1168.755) [-1170.167] (-1171.807) -- 0:00:28
556000 -- (-1173.373) (-1169.637) (-1168.551) [-1168.324] * (-1168.952) (-1169.250) [-1169.776] (-1170.679) -- 0:00:27
556500 -- (-1169.352) (-1167.985) [-1168.403] (-1168.210) * (-1170.701) [-1168.820] (-1170.080) (-1170.712) -- 0:00:27
557000 -- (-1169.656) [-1167.747] (-1170.116) (-1169.908) * (-1170.332) [-1170.525] (-1168.439) (-1170.159) -- 0:00:27
557500 -- [-1170.168] (-1168.575) (-1170.277) (-1168.643) * (-1169.468) [-1169.996] (-1169.062) (-1170.506) -- 0:00:27
558000 -- (-1168.345) (-1169.478) [-1172.740] (-1172.441) * (-1169.800) (-1170.059) (-1170.436) [-1170.350] -- 0:00:27
558500 -- [-1168.577] (-1170.205) (-1170.754) (-1169.843) * (-1168.486) (-1170.360) [-1171.237] (-1170.296) -- 0:00:27
559000 -- (-1170.885) [-1169.950] (-1172.773) (-1171.395) * (-1168.659) (-1168.625) [-1168.481] (-1170.068) -- 0:00:27
559500 -- (-1173.282) [-1171.427] (-1171.618) (-1169.578) * (-1171.899) (-1170.539) [-1170.966] (-1169.014) -- 0:00:27
560000 -- (-1173.401) (-1169.926) (-1169.786) [-1169.695] * (-1170.135) (-1168.262) (-1180.713) [-1167.928] -- 0:00:27
Average standard deviation of split frequencies: 0.012145
560500 -- [-1169.532] (-1171.127) (-1167.963) (-1169.194) * (-1169.301) (-1170.874) [-1169.041] (-1168.055) -- 0:00:27
561000 -- (-1169.613) (-1168.151) [-1171.704] (-1171.008) * (-1171.872) (-1172.051) [-1169.006] (-1169.074) -- 0:00:27
561500 -- [-1170.159] (-1167.938) (-1169.976) (-1172.170) * (-1171.201) [-1171.251] (-1169.282) (-1168.685) -- 0:00:27
562000 -- [-1168.851] (-1168.184) (-1169.221) (-1169.523) * (-1172.591) (-1170.412) [-1168.504] (-1169.304) -- 0:00:27
562500 -- (-1169.990) [-1171.006] (-1168.882) (-1168.514) * [-1169.667] (-1169.660) (-1171.022) (-1173.876) -- 0:00:27
563000 -- (-1170.078) (-1170.292) [-1171.077] (-1169.483) * [-1167.883] (-1171.764) (-1172.030) (-1172.476) -- 0:00:27
563500 -- (-1168.781) (-1171.091) [-1169.752] (-1172.352) * (-1167.883) (-1168.835) (-1169.551) [-1172.517] -- 0:00:27
564000 -- (-1169.778) (-1169.811) [-1169.033] (-1170.554) * (-1168.347) (-1169.363) (-1167.905) [-1170.726] -- 0:00:27
564500 -- [-1170.551] (-1172.901) (-1170.286) (-1171.956) * (-1170.635) [-1171.171] (-1169.467) (-1173.513) -- 0:00:27
565000 -- (-1171.374) [-1170.825] (-1171.782) (-1172.704) * (-1172.782) [-1169.004] (-1169.175) (-1169.677) -- 0:00:26
Average standard deviation of split frequencies: 0.011845
565500 -- (-1169.778) [-1169.223] (-1173.164) (-1170.226) * [-1173.434] (-1168.131) (-1171.008) (-1170.486) -- 0:00:26
566000 -- (-1169.649) (-1169.217) (-1171.892) [-1171.646] * (-1170.552) (-1168.275) [-1168.410] (-1172.231) -- 0:00:26
566500 -- [-1168.088] (-1171.730) (-1169.288) (-1170.386) * [-1170.103] (-1175.254) (-1168.117) (-1170.113) -- 0:00:26
567000 -- (-1170.058) [-1170.209] (-1171.778) (-1169.853) * (-1170.345) (-1174.838) [-1168.467] (-1168.176) -- 0:00:26
567500 -- (-1169.057) (-1172.194) [-1170.333] (-1172.295) * (-1170.633) (-1177.739) (-1176.619) [-1168.442] -- 0:00:26
568000 -- (-1169.691) (-1170.676) [-1169.529] (-1168.693) * [-1173.752] (-1169.363) (-1168.737) (-1170.475) -- 0:00:26
568500 -- (-1172.221) [-1171.342] (-1169.994) (-1168.268) * (-1172.982) (-1169.760) (-1170.417) [-1169.947] -- 0:00:26
569000 -- (-1170.272) (-1169.294) [-1168.862] (-1168.781) * (-1173.159) (-1168.528) [-1168.292] (-1170.345) -- 0:00:26
569500 -- [-1170.710] (-1167.968) (-1168.781) (-1168.471) * (-1175.065) (-1168.840) (-1171.016) [-1170.329] -- 0:00:26
570000 -- (-1168.187) (-1168.947) (-1169.709) [-1169.144] * [-1169.489] (-1168.982) (-1171.236) (-1172.163) -- 0:00:26
Average standard deviation of split frequencies: 0.012070
570500 -- (-1171.784) (-1172.031) (-1168.649) [-1169.167] * (-1170.411) [-1168.995] (-1171.153) (-1170.964) -- 0:00:26
571000 -- (-1170.743) [-1168.228] (-1172.940) (-1169.292) * (-1171.447) (-1169.566) (-1172.166) [-1169.399] -- 0:00:27
571500 -- (-1168.865) [-1168.773] (-1172.477) (-1169.676) * (-1169.710) (-1170.852) (-1170.109) [-1169.196] -- 0:00:26
572000 -- [-1171.056] (-1169.493) (-1171.646) (-1169.644) * (-1169.546) [-1172.192] (-1168.755) (-1170.426) -- 0:00:26
572500 -- (-1169.564) [-1169.321] (-1171.110) (-1170.395) * (-1168.725) (-1176.803) (-1169.065) [-1168.715] -- 0:00:26
573000 -- (-1171.292) [-1170.120] (-1168.895) (-1168.181) * [-1169.431] (-1171.700) (-1169.026) (-1169.509) -- 0:00:26
573500 -- [-1171.224] (-1175.007) (-1169.021) (-1171.412) * [-1168.760] (-1170.074) (-1172.717) (-1169.112) -- 0:00:26
574000 -- (-1168.540) (-1170.848) (-1168.676) [-1168.815] * (-1170.387) (-1168.971) [-1171.752] (-1171.738) -- 0:00:26
574500 -- [-1170.928] (-1170.465) (-1170.413) (-1168.857) * (-1172.179) [-1167.858] (-1171.196) (-1168.836) -- 0:00:26
575000 -- (-1168.882) (-1168.105) (-1168.686) [-1171.802] * (-1169.546) (-1169.098) [-1168.677] (-1168.551) -- 0:00:26
Average standard deviation of split frequencies: 0.011776
575500 -- (-1168.933) (-1172.925) (-1168.290) [-1170.154] * (-1170.100) (-1172.347) (-1168.232) [-1168.613] -- 0:00:26
576000 -- [-1169.375] (-1170.840) (-1171.374) (-1175.276) * [-1173.521] (-1169.987) (-1169.025) (-1168.608) -- 0:00:26
576500 -- [-1168.900] (-1170.878) (-1167.912) (-1170.238) * (-1170.578) (-1169.083) (-1168.582) [-1168.541] -- 0:00:26
577000 -- [-1172.416] (-1170.078) (-1168.367) (-1171.496) * [-1168.627] (-1170.384) (-1168.243) (-1173.290) -- 0:00:26
577500 -- (-1169.401) (-1169.526) (-1171.951) [-1170.870] * [-1168.646] (-1172.333) (-1171.971) (-1176.513) -- 0:00:26
578000 -- (-1172.934) (-1169.677) (-1168.895) [-1170.601] * [-1168.595] (-1169.170) (-1174.153) (-1171.772) -- 0:00:26
578500 -- (-1170.347) [-1168.272] (-1170.977) (-1168.269) * (-1175.018) (-1169.750) [-1169.403] (-1172.683) -- 0:00:26
579000 -- (-1171.841) [-1168.307] (-1170.456) (-1168.436) * (-1175.044) (-1170.800) (-1169.434) [-1169.462] -- 0:00:26
579500 -- (-1170.214) (-1168.450) (-1172.347) [-1170.252] * (-1170.744) (-1171.041) [-1168.589] (-1175.261) -- 0:00:26
580000 -- (-1168.755) [-1169.891] (-1170.856) (-1171.933) * (-1172.064) [-1170.129] (-1172.526) (-1172.149) -- 0:00:26
Average standard deviation of split frequencies: 0.011952
580500 -- [-1168.331] (-1169.218) (-1171.309) (-1170.632) * (-1173.279) [-1169.861] (-1169.003) (-1173.603) -- 0:00:26
581000 -- (-1168.531) [-1168.677] (-1171.817) (-1169.975) * (-1170.307) (-1172.191) [-1171.050] (-1171.529) -- 0:00:25
581500 -- (-1172.826) (-1168.867) (-1170.759) [-1168.500] * [-1170.748] (-1173.492) (-1172.539) (-1168.991) -- 0:00:25
582000 -- [-1171.433] (-1168.115) (-1170.173) (-1170.570) * [-1170.209] (-1169.931) (-1169.585) (-1170.187) -- 0:00:25
582500 -- (-1170.108) (-1168.431) (-1168.961) [-1171.307] * (-1172.020) (-1168.399) [-1169.922] (-1170.422) -- 0:00:25
583000 -- (-1168.443) [-1169.034] (-1171.259) (-1169.179) * (-1169.778) [-1172.179] (-1176.333) (-1171.699) -- 0:00:25
583500 -- (-1168.450) [-1174.359] (-1169.136) (-1170.013) * (-1173.969) [-1171.458] (-1171.144) (-1170.059) -- 0:00:25
584000 -- (-1169.020) (-1171.585) (-1170.551) [-1168.255] * (-1177.678) [-1170.836] (-1170.976) (-1173.069) -- 0:00:25
584500 -- [-1169.156] (-1172.912) (-1170.497) (-1173.021) * [-1169.593] (-1170.136) (-1173.387) (-1170.727) -- 0:00:25
585000 -- (-1169.198) (-1170.036) [-1167.956] (-1168.526) * (-1170.939) (-1169.412) [-1174.013] (-1171.521) -- 0:00:25
Average standard deviation of split frequencies: 0.012245
585500 -- (-1168.557) (-1169.447) [-1169.530] (-1169.714) * (-1169.688) (-1168.694) (-1170.977) [-1169.532] -- 0:00:25
586000 -- (-1168.098) [-1170.558] (-1169.753) (-1171.888) * [-1169.287] (-1168.329) (-1169.337) (-1169.436) -- 0:00:25
586500 -- [-1168.105] (-1168.677) (-1169.617) (-1168.417) * (-1169.957) [-1170.535] (-1169.831) (-1172.267) -- 0:00:25
587000 -- (-1171.035) (-1171.444) (-1168.825) [-1168.379] * (-1168.627) (-1168.916) [-1169.251] (-1169.880) -- 0:00:25
587500 -- (-1169.149) [-1172.389] (-1168.034) (-1170.009) * (-1175.082) [-1168.757] (-1171.795) (-1169.620) -- 0:00:25
588000 -- (-1169.864) (-1168.344) [-1169.764] (-1172.581) * (-1173.171) (-1168.981) [-1170.029] (-1169.985) -- 0:00:25
588500 -- [-1169.877] (-1171.747) (-1169.243) (-1173.177) * (-1171.737) (-1172.459) (-1170.105) [-1168.823] -- 0:00:25
589000 -- (-1169.401) [-1170.225] (-1170.611) (-1169.375) * [-1169.929] (-1169.421) (-1173.095) (-1171.074) -- 0:00:25
589500 -- [-1169.886] (-1171.192) (-1170.402) (-1169.712) * (-1171.046) (-1170.026) (-1171.284) [-1169.140] -- 0:00:25
590000 -- (-1170.342) (-1173.827) (-1170.069) [-1169.202] * (-1169.111) (-1169.309) (-1171.198) [-1167.928] -- 0:00:25
Average standard deviation of split frequencies: 0.012592
590500 -- (-1172.507) (-1171.823) [-1169.944] (-1168.943) * (-1171.724) [-1170.049] (-1169.009) (-1171.337) -- 0:00:25
591000 -- [-1169.329] (-1171.366) (-1173.251) (-1171.520) * (-1170.187) [-1171.999] (-1168.753) (-1170.506) -- 0:00:25
591500 -- (-1168.864) [-1171.001] (-1170.423) (-1172.080) * [-1168.589] (-1171.344) (-1169.204) (-1169.169) -- 0:00:25
592000 -- [-1171.761] (-1176.156) (-1169.175) (-1169.093) * (-1168.830) (-1169.759) [-1169.444] (-1169.297) -- 0:00:25
592500 -- [-1170.493] (-1174.449) (-1169.548) (-1170.467) * (-1168.288) (-1173.826) (-1168.759) [-1169.908] -- 0:00:25
593000 -- [-1169.647] (-1172.616) (-1171.964) (-1170.783) * (-1169.399) (-1171.572) [-1169.289] (-1171.992) -- 0:00:25
593500 -- [-1167.849] (-1170.785) (-1172.291) (-1169.224) * [-1169.056] (-1172.705) (-1170.374) (-1170.267) -- 0:00:25
594000 -- (-1169.322) (-1169.426) [-1171.827] (-1170.486) * (-1171.858) (-1168.045) (-1168.353) [-1171.444] -- 0:00:25
594500 -- [-1172.417] (-1172.080) (-1172.737) (-1171.760) * [-1171.213] (-1170.351) (-1170.105) (-1173.680) -- 0:00:25
595000 -- (-1170.647) (-1171.208) [-1167.999] (-1169.083) * (-1172.772) (-1173.944) [-1171.804] (-1170.536) -- 0:00:25
Average standard deviation of split frequencies: 0.011996
595500 -- (-1169.770) (-1175.210) [-1169.976] (-1168.917) * (-1172.827) (-1172.001) [-1169.459] (-1172.795) -- 0:00:25
596000 -- (-1169.230) (-1172.594) [-1170.825] (-1168.161) * [-1172.687] (-1170.918) (-1172.282) (-1171.507) -- 0:00:25
596500 -- (-1174.520) (-1169.599) [-1169.984] (-1168.881) * (-1170.204) [-1169.608] (-1171.667) (-1172.165) -- 0:00:25
597000 -- [-1172.079] (-1169.650) (-1169.805) (-1169.080) * (-1169.091) [-1172.328] (-1168.532) (-1170.533) -- 0:00:24
597500 -- (-1172.288) [-1168.801] (-1169.949) (-1168.022) * (-1169.748) (-1172.134) [-1170.721] (-1171.624) -- 0:00:24
598000 -- (-1174.479) (-1169.433) (-1170.406) [-1169.949] * [-1168.263] (-1169.141) (-1169.775) (-1171.732) -- 0:00:24
598500 -- (-1170.234) (-1168.618) [-1170.254] (-1172.183) * [-1170.367] (-1169.912) (-1170.303) (-1171.662) -- 0:00:24
599000 -- (-1169.246) (-1169.582) (-1170.716) [-1173.341] * [-1168.322] (-1171.661) (-1172.592) (-1168.144) -- 0:00:24
599500 -- (-1168.795) (-1169.411) [-1169.037] (-1170.485) * [-1174.559] (-1168.749) (-1172.462) (-1171.735) -- 0:00:24
600000 -- (-1171.871) [-1171.317] (-1171.815) (-1168.470) * (-1168.880) (-1169.403) (-1172.761) [-1169.912] -- 0:00:24
Average standard deviation of split frequencies: 0.011080
600500 -- (-1172.132) (-1169.990) (-1170.264) [-1172.279] * (-1170.284) (-1169.831) [-1170.553] (-1168.946) -- 0:00:24
601000 -- (-1168.703) (-1168.997) [-1168.155] (-1173.736) * [-1171.094] (-1169.944) (-1168.690) (-1168.393) -- 0:00:24
601500 -- (-1169.040) (-1172.072) [-1168.817] (-1170.457) * (-1174.342) (-1170.717) [-1171.759] (-1169.061) -- 0:00:24
602000 -- (-1170.654) (-1170.975) (-1168.581) [-1170.251] * (-1172.257) (-1169.872) (-1170.453) [-1171.021] -- 0:00:24
602500 -- (-1171.540) (-1169.022) [-1169.480] (-1169.839) * (-1170.157) (-1173.111) [-1172.031] (-1176.159) -- 0:00:24
603000 -- (-1169.667) [-1170.075] (-1169.237) (-1172.750) * (-1171.046) [-1169.369] (-1172.587) (-1169.055) -- 0:00:24
603500 -- [-1171.978] (-1170.760) (-1168.597) (-1171.166) * [-1171.780] (-1170.235) (-1169.259) (-1169.055) -- 0:00:24
604000 -- (-1171.508) (-1170.891) [-1170.082] (-1170.464) * (-1172.629) [-1173.920] (-1168.837) (-1168.918) -- 0:00:24
604500 -- (-1169.260) (-1167.982) (-1168.277) [-1172.286] * [-1170.657] (-1171.442) (-1169.845) (-1174.278) -- 0:00:24
605000 -- (-1169.101) (-1168.270) (-1169.510) [-1169.763] * (-1173.663) [-1171.403] (-1173.926) (-1173.664) -- 0:00:24
Average standard deviation of split frequencies: 0.010761
605500 -- [-1167.846] (-1172.286) (-1169.593) (-1172.008) * (-1170.875) [-1168.956] (-1167.903) (-1172.798) -- 0:00:24
606000 -- [-1170.399] (-1172.077) (-1169.855) (-1169.339) * (-1173.287) (-1169.025) (-1169.013) [-1170.533] -- 0:00:24
606500 -- [-1171.361] (-1171.434) (-1170.088) (-1168.560) * (-1171.708) (-1169.287) [-1168.399] (-1174.768) -- 0:00:24
607000 -- (-1169.491) (-1169.748) (-1172.926) [-1172.563] * (-1169.507) [-1169.493] (-1168.768) (-1169.371) -- 0:00:24
607500 -- (-1168.765) (-1170.532) [-1169.909] (-1169.859) * (-1170.249) [-1169.613] (-1169.691) (-1170.966) -- 0:00:24
608000 -- (-1167.873) (-1169.991) [-1168.818] (-1169.338) * (-1170.662) (-1168.841) (-1172.902) [-1169.787] -- 0:00:24
608500 -- (-1170.495) (-1168.225) [-1169.019] (-1169.773) * (-1170.435) (-1173.133) [-1169.690] (-1169.972) -- 0:00:24
609000 -- (-1170.102) [-1167.881] (-1167.991) (-1170.409) * (-1168.519) [-1172.348] (-1171.436) (-1168.798) -- 0:00:24
609500 -- (-1170.180) (-1167.861) (-1167.860) [-1169.527] * [-1169.165] (-1169.451) (-1172.286) (-1170.496) -- 0:00:24
610000 -- (-1173.396) [-1169.928] (-1168.191) (-1169.040) * [-1169.128] (-1173.297) (-1170.371) (-1169.486) -- 0:00:24
Average standard deviation of split frequencies: 0.010580
610500 -- (-1173.683) (-1169.597) [-1169.467] (-1169.204) * (-1170.242) [-1169.669] (-1170.672) (-1170.624) -- 0:00:24
611000 -- [-1171.237] (-1168.907) (-1170.191) (-1173.255) * (-1169.806) (-1169.783) [-1173.505] (-1170.810) -- 0:00:24
611500 -- (-1177.828) (-1170.306) (-1169.929) [-1171.134] * (-1170.997) (-1169.529) (-1169.293) [-1168.887] -- 0:00:24
612000 -- (-1177.229) (-1169.281) (-1170.515) [-1168.384] * (-1171.621) (-1173.112) [-1171.466] (-1168.171) -- 0:00:24
612500 -- (-1175.052) (-1169.199) [-1171.853] (-1169.828) * [-1169.057] (-1171.293) (-1180.598) (-1168.054) -- 0:00:24
613000 -- (-1174.843) [-1169.534] (-1171.880) (-1167.940) * (-1171.663) (-1170.627) (-1173.453) [-1169.659] -- 0:00:23
613500 -- (-1168.825) [-1170.668] (-1169.761) (-1169.159) * (-1170.435) (-1168.490) (-1168.485) [-1168.865] -- 0:00:23
614000 -- (-1169.820) [-1170.245] (-1169.081) (-1170.095) * (-1172.697) (-1169.848) (-1169.112) [-1170.577] -- 0:00:23
614500 -- (-1169.489) [-1170.853] (-1170.502) (-1170.999) * [-1170.547] (-1170.549) (-1169.178) (-1172.506) -- 0:00:23
615000 -- (-1168.360) (-1169.574) (-1169.670) [-1170.310] * [-1170.484] (-1172.302) (-1169.298) (-1171.580) -- 0:00:23
Average standard deviation of split frequencies: 0.010501
615500 -- (-1169.448) (-1171.391) [-1171.315] (-1171.223) * (-1170.403) (-1173.010) [-1168.692] (-1170.143) -- 0:00:23
616000 -- (-1169.292) [-1168.884] (-1170.531) (-1173.961) * (-1168.649) (-1171.326) [-1169.602] (-1169.986) -- 0:00:23
616500 -- (-1169.386) (-1170.631) [-1169.288] (-1170.825) * [-1169.844] (-1171.127) (-1168.487) (-1169.131) -- 0:00:23
617000 -- (-1169.582) (-1169.252) [-1170.235] (-1170.009) * (-1168.910) (-1168.938) (-1171.195) [-1169.089] -- 0:00:23
617500 -- (-1169.893) (-1169.108) (-1171.130) [-1170.077] * (-1168.086) (-1169.550) (-1170.347) [-1170.238] -- 0:00:23
618000 -- (-1170.322) (-1168.915) [-1170.361] (-1169.424) * [-1168.114] (-1171.984) (-1169.131) (-1169.278) -- 0:00:23
618500 -- (-1170.745) [-1168.881] (-1169.734) (-1169.378) * (-1168.640) (-1168.545) [-1168.222] (-1168.720) -- 0:00:23
619000 -- (-1168.907) [-1169.239] (-1169.801) (-1168.478) * (-1168.358) (-1168.981) (-1169.312) [-1171.103] -- 0:00:23
619500 -- (-1170.214) (-1175.834) (-1171.936) [-1169.308] * (-1167.850) (-1169.721) [-1169.163] (-1168.270) -- 0:00:23
620000 -- (-1169.995) (-1171.552) (-1172.638) [-1169.694] * [-1169.033] (-1172.891) (-1169.100) (-1169.035) -- 0:00:23
Average standard deviation of split frequencies: 0.010549
620500 -- [-1169.744] (-1168.821) (-1169.361) (-1169.569) * (-1169.642) [-1168.988] (-1169.335) (-1171.980) -- 0:00:23
621000 -- (-1171.592) (-1168.198) [-1169.603] (-1169.480) * (-1170.754) [-1170.128] (-1169.860) (-1171.074) -- 0:00:23
621500 -- (-1171.586) [-1168.994] (-1172.171) (-1169.477) * (-1168.316) (-1168.764) [-1169.447] (-1170.855) -- 0:00:23
622000 -- (-1169.599) (-1170.844) (-1169.731) [-1169.546] * (-1170.987) (-1170.291) (-1169.720) [-1170.310] -- 0:00:23
622500 -- [-1168.940] (-1170.242) (-1170.834) (-1169.711) * (-1168.430) [-1170.587] (-1169.828) (-1179.849) -- 0:00:23
623000 -- [-1170.457] (-1170.199) (-1169.276) (-1181.178) * (-1168.632) [-1172.241] (-1171.201) (-1175.133) -- 0:00:23
623500 -- (-1168.502) (-1168.398) [-1169.107] (-1175.944) * (-1168.484) (-1169.635) (-1173.537) [-1169.810] -- 0:00:23
624000 -- (-1169.846) (-1169.252) (-1169.106) [-1172.831] * (-1168.944) (-1170.379) [-1167.967] (-1169.524) -- 0:00:23
624500 -- (-1171.837) (-1171.088) [-1168.496] (-1168.790) * (-1170.570) (-1173.487) [-1167.964] (-1170.291) -- 0:00:23
625000 -- (-1175.590) [-1174.825] (-1169.566) (-1170.326) * (-1172.797) (-1172.619) (-1169.415) [-1169.101] -- 0:00:23
Average standard deviation of split frequencies: 0.010668
625500 -- [-1169.049] (-1172.900) (-1169.818) (-1168.492) * (-1172.829) (-1172.838) (-1169.311) [-1170.058] -- 0:00:23
626000 -- (-1172.573) (-1170.230) [-1171.326] (-1169.067) * (-1173.385) (-1171.057) [-1169.500] (-1170.026) -- 0:00:23
626500 -- (-1170.524) (-1169.792) [-1170.300] (-1168.960) * [-1170.562] (-1171.441) (-1169.797) (-1169.698) -- 0:00:23
627000 -- [-1169.976] (-1170.020) (-1172.067) (-1168.267) * [-1171.141] (-1170.256) (-1168.730) (-1170.667) -- 0:00:23
627500 -- (-1173.097) (-1168.351) (-1168.837) [-1171.521] * (-1170.046) (-1170.428) [-1169.382] (-1168.357) -- 0:00:23
628000 -- (-1171.897) (-1172.170) (-1168.674) [-1169.489] * (-1169.390) (-1170.161) [-1174.118] (-1168.557) -- 0:00:23
628500 -- (-1172.711) (-1171.519) (-1172.199) [-1170.742] * (-1169.658) [-1169.569] (-1175.512) (-1169.878) -- 0:00:23
629000 -- (-1170.153) [-1171.752] (-1169.959) (-1170.813) * (-1168.067) [-1170.076] (-1169.054) (-1173.471) -- 0:00:23
629500 -- [-1169.011] (-1169.648) (-1170.740) (-1172.621) * [-1173.228] (-1169.500) (-1170.431) (-1170.140) -- 0:00:22
630000 -- (-1169.717) [-1168.570] (-1175.085) (-1172.398) * (-1170.799) (-1170.689) (-1168.635) [-1168.164] -- 0:00:22
Average standard deviation of split frequencies: 0.010714
630500 -- (-1168.107) [-1169.940] (-1175.827) (-1171.497) * [-1169.485] (-1172.733) (-1170.531) (-1169.627) -- 0:00:22
631000 -- (-1169.699) [-1170.257] (-1174.696) (-1173.286) * (-1168.085) (-1170.427) [-1170.054] (-1169.501) -- 0:00:22
631500 -- (-1169.053) [-1169.119] (-1171.586) (-1170.053) * (-1168.118) (-1170.779) [-1168.674] (-1169.510) -- 0:00:22
632000 -- (-1169.677) [-1175.354] (-1170.394) (-1171.091) * (-1173.246) (-1169.260) (-1169.173) [-1168.349] -- 0:00:22
632500 -- [-1168.521] (-1173.849) (-1169.378) (-1168.786) * (-1168.795) (-1168.706) [-1169.164] (-1169.333) -- 0:00:22
633000 -- (-1173.265) (-1169.103) (-1172.703) [-1169.331] * [-1169.104] (-1169.739) (-1169.266) (-1169.122) -- 0:00:22
633500 -- [-1172.835] (-1168.409) (-1168.369) (-1169.913) * (-1169.615) (-1169.958) (-1171.747) [-1169.847] -- 0:00:22
634000 -- (-1170.756) [-1169.366] (-1169.936) (-1170.933) * [-1169.609] (-1168.395) (-1169.555) (-1170.023) -- 0:00:22
634500 -- (-1168.409) (-1170.504) (-1169.941) [-1169.166] * (-1168.129) (-1170.886) [-1168.680] (-1169.277) -- 0:00:22
635000 -- [-1168.542] (-1170.782) (-1169.713) (-1169.133) * [-1168.129] (-1170.168) (-1169.301) (-1169.589) -- 0:00:22
Average standard deviation of split frequencies: 0.010624
635500 -- [-1169.432] (-1170.831) (-1176.996) (-1170.606) * [-1168.120] (-1174.994) (-1169.203) (-1168.142) -- 0:00:22
636000 -- (-1170.826) (-1172.029) [-1169.407] (-1169.595) * (-1168.125) [-1168.057] (-1169.756) (-1168.556) -- 0:00:22
636500 -- (-1173.013) (-1170.648) (-1168.731) [-1169.739] * (-1170.226) (-1170.933) [-1174.073] (-1171.639) -- 0:00:22
637000 -- (-1169.486) [-1173.884] (-1168.810) (-1169.294) * (-1169.043) (-1168.413) [-1169.999] (-1169.615) -- 0:00:22
637500 -- (-1170.322) (-1173.357) [-1168.111] (-1168.627) * (-1169.479) [-1168.947] (-1170.106) (-1170.612) -- 0:00:22
638000 -- [-1169.750] (-1168.980) (-1168.448) (-1168.145) * (-1168.860) (-1169.449) [-1168.925] (-1169.547) -- 0:00:22
638500 -- (-1168.458) (-1168.805) (-1168.075) [-1170.940] * (-1171.682) [-1169.285] (-1169.753) (-1170.087) -- 0:00:22
639000 -- (-1169.377) [-1170.204] (-1171.728) (-1171.216) * (-1169.754) [-1171.182] (-1169.312) (-1168.777) -- 0:00:22
639500 -- (-1168.846) (-1169.689) [-1168.682] (-1169.448) * (-1171.692) [-1172.587] (-1170.799) (-1169.377) -- 0:00:22
640000 -- (-1168.980) (-1167.923) [-1167.940] (-1171.795) * (-1171.101) [-1171.690] (-1171.123) (-1169.607) -- 0:00:22
Average standard deviation of split frequencies: 0.010914
640500 -- [-1173.443] (-1171.233) (-1168.078) (-1171.013) * [-1169.943] (-1169.851) (-1171.141) (-1172.337) -- 0:00:22
641000 -- (-1170.777) (-1172.079) [-1169.151] (-1170.785) * (-1169.780) (-1168.211) (-1171.681) [-1169.876] -- 0:00:22
641500 -- (-1173.095) (-1171.947) (-1171.592) [-1174.019] * (-1171.950) [-1169.163] (-1169.928) (-1174.335) -- 0:00:22
642000 -- (-1171.145) (-1168.809) [-1170.843] (-1170.067) * [-1170.139] (-1168.924) (-1168.795) (-1173.329) -- 0:00:22
642500 -- (-1167.837) (-1169.153) [-1169.166] (-1171.453) * (-1169.093) (-1170.909) (-1168.711) [-1171.386] -- 0:00:22
643000 -- [-1169.088] (-1168.850) (-1170.288) (-1168.011) * (-1169.038) (-1173.885) [-1170.145] (-1174.934) -- 0:00:22
643500 -- (-1167.943) [-1173.431] (-1169.775) (-1169.816) * (-1170.617) (-1168.940) [-1169.041] (-1171.695) -- 0:00:22
644000 -- (-1168.736) (-1172.609) [-1168.993] (-1171.705) * (-1168.335) (-1169.240) (-1171.124) [-1168.398] -- 0:00:22
644500 -- (-1170.242) (-1167.997) [-1168.561] (-1173.789) * (-1169.694) (-1168.790) (-1174.683) [-1170.511] -- 0:00:22
645000 -- [-1169.006] (-1171.026) (-1168.822) (-1169.254) * (-1168.471) (-1169.818) [-1168.984] (-1171.418) -- 0:00:22
Average standard deviation of split frequencies: 0.010743
645500 -- (-1168.699) (-1170.903) (-1168.738) [-1168.188] * [-1168.906] (-1169.583) (-1168.793) (-1174.931) -- 0:00:21
646000 -- (-1169.782) (-1178.081) [-1169.582] (-1168.177) * (-1169.498) (-1167.978) [-1168.475] (-1172.614) -- 0:00:21
646500 -- (-1169.486) [-1168.026] (-1174.541) (-1169.578) * (-1173.412) (-1170.929) [-1168.240] (-1172.225) -- 0:00:21
647000 -- (-1168.928) [-1167.869] (-1170.829) (-1169.580) * [-1170.070] (-1170.244) (-1168.909) (-1174.900) -- 0:00:21
647500 -- (-1172.048) [-1170.713] (-1171.593) (-1168.449) * (-1172.195) (-1170.340) [-1168.391] (-1171.001) -- 0:00:21
648000 -- [-1169.312] (-1172.267) (-1169.626) (-1169.950) * (-1172.665) (-1171.132) [-1172.526] (-1172.000) -- 0:00:21
648500 -- (-1168.307) (-1170.899) [-1169.534] (-1169.005) * (-1172.123) (-1168.688) [-1170.528] (-1173.565) -- 0:00:21
649000 -- (-1169.528) (-1168.986) (-1168.689) [-1169.289] * [-1168.612] (-1171.905) (-1172.720) (-1168.456) -- 0:00:21
649500 -- [-1169.127] (-1171.003) (-1169.010) (-1170.207) * (-1168.311) (-1170.916) [-1169.396] (-1169.807) -- 0:00:21
650000 -- (-1169.616) (-1170.274) (-1168.094) [-1169.239] * (-1169.033) [-1170.253] (-1169.002) (-1172.349) -- 0:00:21
Average standard deviation of split frequencies: 0.010596
650500 -- (-1171.071) (-1169.001) [-1169.717] (-1169.313) * [-1174.508] (-1171.942) (-1168.611) (-1169.111) -- 0:00:21
651000 -- (-1170.962) [-1170.013] (-1168.609) (-1169.750) * [-1170.196] (-1171.690) (-1169.196) (-1174.008) -- 0:00:21
651500 -- (-1172.634) (-1170.882) (-1169.550) [-1169.639] * [-1168.195] (-1170.256) (-1168.911) (-1171.656) -- 0:00:21
652000 -- [-1170.620] (-1171.792) (-1169.298) (-1169.532) * (-1169.735) (-1169.718) [-1168.183] (-1172.821) -- 0:00:21
652500 -- (-1170.628) (-1168.045) [-1170.430] (-1174.196) * (-1170.202) (-1169.038) [-1169.289] (-1168.922) -- 0:00:21
653000 -- (-1172.435) [-1167.988] (-1169.344) (-1168.845) * (-1170.127) (-1170.820) [-1169.726] (-1168.361) -- 0:00:21
653500 -- (-1171.282) (-1169.899) (-1170.951) [-1169.325] * (-1170.179) [-1170.554] (-1169.998) (-1168.810) -- 0:00:21
654000 -- (-1172.425) (-1169.380) [-1168.654] (-1173.407) * (-1170.214) [-1170.994] (-1171.326) (-1169.472) -- 0:00:21
654500 -- [-1169.821] (-1169.470) (-1169.441) (-1172.016) * [-1174.293] (-1169.737) (-1171.536) (-1170.041) -- 0:00:21
655000 -- (-1169.133) (-1170.156) (-1169.647) [-1169.095] * (-1168.326) (-1168.964) [-1174.866] (-1170.418) -- 0:00:21
Average standard deviation of split frequencies: 0.010734
655500 -- (-1168.575) (-1168.630) [-1170.947] (-1168.695) * (-1173.618) [-1169.341] (-1173.228) (-1171.527) -- 0:00:21
656000 -- (-1173.578) [-1172.463] (-1169.558) (-1170.088) * (-1169.827) (-1168.769) [-1168.048] (-1170.902) -- 0:00:21
656500 -- (-1171.276) (-1168.870) (-1169.072) [-1171.435] * (-1169.213) (-1170.469) (-1172.538) [-1168.721] -- 0:00:21
657000 -- (-1168.818) (-1171.119) [-1171.311] (-1172.895) * [-1169.336] (-1168.704) (-1170.948) (-1171.117) -- 0:00:21
657500 -- (-1171.139) [-1169.991] (-1169.691) (-1168.965) * (-1169.537) (-1170.619) (-1176.981) [-1168.854] -- 0:00:21
658000 -- (-1170.043) (-1169.831) (-1170.698) [-1167.685] * (-1171.047) (-1169.923) (-1171.160) [-1169.897] -- 0:00:21
658500 -- (-1171.180) [-1173.961] (-1169.020) (-1167.649) * (-1170.770) (-1168.811) [-1168.338] (-1170.420) -- 0:00:21
659000 -- (-1175.552) [-1169.264] (-1175.625) (-1167.971) * (-1168.897) (-1170.202) (-1171.182) [-1171.621] -- 0:00:21
659500 -- (-1170.110) (-1170.259) (-1173.805) [-1169.881] * [-1169.873] (-1170.187) (-1168.766) (-1168.916) -- 0:00:21
660000 -- (-1168.577) (-1168.726) (-1175.559) [-1172.321] * (-1169.731) (-1169.633) [-1169.706] (-1170.089) -- 0:00:21
Average standard deviation of split frequencies: 0.010367
660500 -- (-1168.029) (-1169.618) [-1170.364] (-1171.000) * (-1169.305) (-1169.775) (-1171.925) [-1170.988] -- 0:00:21
661000 -- (-1170.745) (-1169.031) [-1170.194] (-1169.131) * (-1170.182) (-1171.814) (-1170.429) [-1169.170] -- 0:00:21
661500 -- [-1174.011] (-1171.514) (-1169.824) (-1169.372) * (-1170.190) (-1169.619) (-1170.890) [-1169.057] -- 0:00:20
662000 -- (-1168.725) (-1172.958) [-1169.909] (-1170.457) * [-1170.201] (-1173.593) (-1173.482) (-1170.353) -- 0:00:20
662500 -- (-1168.956) [-1171.840] (-1170.322) (-1168.801) * (-1171.223) (-1169.477) (-1171.706) [-1168.367] -- 0:00:20
663000 -- (-1168.623) (-1170.250) (-1170.292) [-1168.690] * (-1170.348) [-1169.125] (-1168.869) (-1171.386) -- 0:00:20
663500 -- (-1170.522) (-1170.065) (-1169.434) [-1169.425] * (-1169.213) (-1168.640) [-1168.637] (-1174.268) -- 0:00:20
664000 -- [-1169.402] (-1169.572) (-1171.184) (-1169.683) * (-1169.690) (-1169.908) [-1170.825] (-1169.840) -- 0:00:20
664500 -- (-1169.538) [-1169.397] (-1170.567) (-1168.761) * (-1168.714) [-1171.350] (-1171.029) (-1168.244) -- 0:00:20
665000 -- [-1172.321] (-1168.777) (-1170.394) (-1169.430) * (-1169.651) (-1171.137) [-1170.356] (-1172.042) -- 0:00:20
Average standard deviation of split frequencies: 0.010159
665500 -- (-1172.921) [-1168.255] (-1169.311) (-1169.839) * (-1171.799) (-1171.806) [-1169.564] (-1168.733) -- 0:00:20
666000 -- (-1169.579) (-1169.697) (-1170.459) [-1169.736] * [-1170.947] (-1169.535) (-1169.663) (-1169.742) -- 0:00:20
666500 -- (-1169.855) (-1173.229) (-1172.699) [-1169.257] * [-1169.944] (-1170.991) (-1168.717) (-1169.158) -- 0:00:20
667000 -- [-1173.340] (-1173.666) (-1170.611) (-1170.283) * (-1174.002) [-1169.269] (-1168.904) (-1168.051) -- 0:00:20
667500 -- [-1168.505] (-1174.738) (-1174.678) (-1171.216) * [-1170.763] (-1170.489) (-1169.615) (-1169.160) -- 0:00:20
668000 -- [-1168.420] (-1171.430) (-1170.676) (-1171.072) * (-1173.673) (-1170.849) [-1170.763] (-1171.899) -- 0:00:20
668500 -- (-1170.496) (-1170.258) [-1169.457] (-1170.437) * (-1172.093) (-1169.053) (-1169.225) [-1169.809] -- 0:00:20
669000 -- [-1168.839] (-1171.060) (-1168.970) (-1170.497) * (-1171.045) (-1169.052) (-1172.820) [-1170.510] -- 0:00:20
669500 -- [-1173.553] (-1171.258) (-1168.120) (-1170.440) * (-1169.999) (-1173.126) (-1171.497) [-1176.158] -- 0:00:20
670000 -- (-1168.254) (-1168.962) [-1169.800] (-1171.653) * (-1172.790) [-1172.351] (-1171.015) (-1170.498) -- 0:00:20
Average standard deviation of split frequencies: 0.010006
670500 -- (-1171.498) (-1177.658) (-1171.927) [-1169.726] * (-1172.083) (-1171.448) (-1170.466) [-1168.357] -- 0:00:20
671000 -- (-1172.506) (-1170.336) (-1171.811) [-1169.829] * (-1171.193) (-1170.898) (-1171.339) [-1174.838] -- 0:00:20
671500 -- (-1170.333) (-1169.087) [-1170.069] (-1169.934) * (-1173.066) (-1167.836) [-1172.364] (-1168.039) -- 0:00:20
672000 -- [-1170.233] (-1171.941) (-1170.772) (-1172.082) * (-1169.679) [-1169.511] (-1169.665) (-1168.111) -- 0:00:20
672500 -- (-1170.634) [-1173.828] (-1172.225) (-1170.064) * (-1169.391) (-1169.650) [-1171.291] (-1168.885) -- 0:00:20
673000 -- (-1171.053) (-1169.642) (-1169.683) [-1169.553] * [-1169.611] (-1170.111) (-1173.018) (-1168.271) -- 0:00:20
673500 -- (-1171.103) (-1170.147) (-1174.244) [-1170.732] * (-1171.529) (-1173.131) [-1170.557] (-1168.737) -- 0:00:20
674000 -- (-1171.218) (-1168.615) (-1169.909) [-1176.599] * [-1169.503] (-1172.764) (-1168.576) (-1170.716) -- 0:00:20
674500 -- (-1169.756) (-1171.092) [-1169.952] (-1175.904) * [-1171.797] (-1172.628) (-1168.955) (-1169.836) -- 0:00:20
675000 -- (-1168.283) (-1167.970) (-1169.059) [-1171.960] * (-1172.606) [-1169.920] (-1168.951) (-1171.755) -- 0:00:20
Average standard deviation of split frequencies: 0.010337
675500 -- [-1170.734] (-1169.379) (-1168.570) (-1168.928) * (-1171.519) (-1169.214) [-1168.666] (-1169.288) -- 0:00:20
676000 -- [-1169.602] (-1168.690) (-1168.883) (-1170.571) * (-1169.209) (-1171.493) (-1169.660) [-1169.275] -- 0:00:20
676500 -- (-1169.894) [-1168.690] (-1169.317) (-1168.974) * (-1168.950) (-1172.162) (-1170.913) [-1169.285] -- 0:00:20
677000 -- (-1170.501) [-1170.981] (-1169.242) (-1169.649) * (-1169.912) [-1170.194] (-1168.806) (-1169.213) -- 0:00:20
677500 -- [-1167.833] (-1169.912) (-1167.923) (-1168.820) * (-1168.766) (-1168.807) [-1168.867] (-1170.166) -- 0:00:19
678000 -- (-1168.208) (-1170.228) (-1169.165) [-1168.300] * (-1168.906) (-1169.089) (-1168.830) [-1168.317] -- 0:00:19
678500 -- (-1168.251) (-1169.446) [-1170.750] (-1168.623) * (-1172.776) (-1171.857) [-1170.967] (-1169.195) -- 0:00:19
679000 -- (-1168.164) [-1169.964] (-1172.171) (-1168.497) * [-1169.279] (-1176.714) (-1174.747) (-1170.144) -- 0:00:19
679500 -- (-1168.145) (-1171.429) [-1169.273] (-1171.704) * [-1169.545] (-1169.896) (-1170.119) (-1171.213) -- 0:00:19
680000 -- [-1168.893] (-1169.922) (-1169.457) (-1171.432) * (-1168.397) (-1168.926) [-1169.266] (-1173.514) -- 0:00:19
Average standard deviation of split frequencies: 0.010348
680500 -- (-1169.218) (-1174.069) (-1169.623) [-1172.634] * [-1169.277] (-1169.751) (-1168.917) (-1171.690) -- 0:00:19
681000 -- (-1170.917) (-1168.648) [-1169.108] (-1170.072) * (-1169.698) [-1169.655] (-1170.792) (-1169.597) -- 0:00:19
681500 -- (-1170.410) (-1169.561) [-1170.044] (-1168.380) * (-1171.335) (-1171.261) (-1169.309) [-1169.869] -- 0:00:19
682000 -- [-1172.751] (-1168.988) (-1168.076) (-1170.571) * [-1168.714] (-1170.201) (-1168.740) (-1173.626) -- 0:00:19
682500 -- (-1170.333) (-1168.494) [-1170.441] (-1170.462) * (-1170.967) (-1170.525) [-1168.542] (-1171.211) -- 0:00:19
683000 -- (-1169.664) [-1167.634] (-1169.661) (-1171.193) * (-1171.642) (-1169.187) [-1171.020] (-1169.014) -- 0:00:19
683500 -- (-1169.121) (-1169.603) (-1170.265) [-1169.660] * [-1169.964] (-1169.926) (-1170.474) (-1172.009) -- 0:00:19
684000 -- (-1167.663) (-1169.618) [-1172.426] (-1169.263) * (-1168.442) (-1170.773) [-1168.964] (-1170.556) -- 0:00:19
684500 -- (-1171.810) (-1170.584) [-1170.060] (-1170.288) * [-1169.208] (-1171.327) (-1171.917) (-1170.993) -- 0:00:19
685000 -- (-1168.808) (-1168.413) [-1171.054] (-1170.947) * [-1169.463] (-1171.171) (-1172.119) (-1169.596) -- 0:00:19
Average standard deviation of split frequencies: 0.009944
685500 -- (-1172.842) (-1168.770) (-1176.471) [-1170.830] * (-1173.362) (-1169.242) (-1180.339) [-1168.620] -- 0:00:19
686000 -- (-1173.132) (-1168.496) [-1174.176] (-1172.450) * (-1170.098) (-1172.343) (-1169.447) [-1168.202] -- 0:00:19
686500 -- (-1170.684) (-1168.322) (-1169.040) [-1172.935] * (-1172.707) (-1170.898) (-1169.489) [-1168.349] -- 0:00:19
687000 -- [-1173.967] (-1170.724) (-1170.494) (-1170.295) * (-1171.667) (-1171.365) [-1170.080] (-1171.581) -- 0:00:19
687500 -- (-1171.598) (-1169.969) [-1168.749] (-1173.458) * (-1170.369) (-1171.610) [-1169.775] (-1172.788) -- 0:00:19
688000 -- (-1169.897) (-1173.966) [-1171.719] (-1169.782) * [-1168.265] (-1169.767) (-1168.979) (-1170.230) -- 0:00:19
688500 -- (-1171.687) (-1171.956) [-1169.283] (-1171.073) * [-1168.189] (-1169.577) (-1168.446) (-1175.236) -- 0:00:19
689000 -- [-1169.287] (-1169.947) (-1170.072) (-1171.379) * [-1171.609] (-1168.289) (-1169.804) (-1169.320) -- 0:00:19
689500 -- [-1169.283] (-1172.104) (-1168.697) (-1171.640) * (-1171.823) (-1169.503) [-1170.378] (-1171.471) -- 0:00:19
690000 -- [-1172.134] (-1174.543) (-1172.290) (-1171.352) * (-1169.899) (-1170.352) (-1170.271) [-1170.316] -- 0:00:19
Average standard deviation of split frequencies: 0.009756
690500 -- [-1169.556] (-1172.999) (-1170.914) (-1170.706) * (-1170.223) (-1175.157) [-1170.778] (-1168.906) -- 0:00:19
691000 -- [-1170.999] (-1172.315) (-1170.673) (-1169.418) * [-1170.309] (-1172.030) (-1169.955) (-1170.319) -- 0:00:19
691500 -- [-1170.090] (-1170.245) (-1168.870) (-1168.612) * (-1170.001) (-1174.882) [-1168.571] (-1168.320) -- 0:00:19
692000 -- (-1168.378) (-1176.781) (-1168.815) [-1170.323] * (-1171.118) (-1169.633) [-1170.405] (-1171.206) -- 0:00:19
692500 -- (-1170.160) (-1170.495) [-1170.011] (-1168.697) * (-1171.991) (-1171.085) [-1170.777] (-1170.997) -- 0:00:19
693000 -- (-1170.056) [-1168.228] (-1173.136) (-1171.814) * (-1176.453) (-1172.504) (-1169.851) [-1168.778] -- 0:00:19
693500 -- (-1171.233) [-1167.998] (-1170.367) (-1172.466) * (-1169.650) [-1169.775] (-1172.279) (-1168.919) -- 0:00:19
694000 -- (-1168.742) [-1169.878] (-1172.636) (-1170.751) * (-1168.401) (-1172.308) (-1173.907) [-1167.931] -- 0:00:18
694500 -- (-1169.588) [-1169.993] (-1170.707) (-1171.035) * (-1168.856) [-1172.777] (-1176.176) (-1171.495) -- 0:00:18
695000 -- (-1169.559) (-1168.914) (-1171.111) [-1170.647] * (-1169.230) (-1169.685) [-1173.825] (-1170.793) -- 0:00:18
Average standard deviation of split frequencies: 0.009694
695500 -- (-1170.002) (-1173.084) (-1169.405) [-1169.363] * (-1170.607) [-1172.890] (-1167.956) (-1172.541) -- 0:00:18
696000 -- (-1172.640) (-1169.880) (-1169.290) [-1167.968] * (-1169.816) (-1170.144) (-1168.884) [-1174.098] -- 0:00:18
696500 -- (-1168.977) (-1169.056) (-1169.772) [-1168.343] * [-1168.816] (-1168.954) (-1169.614) (-1169.490) -- 0:00:18
697000 -- [-1168.830] (-1169.436) (-1169.775) (-1170.465) * (-1168.507) (-1170.299) (-1168.456) [-1170.355] -- 0:00:18
697500 -- (-1171.322) (-1169.006) (-1169.738) [-1168.965] * (-1169.335) (-1170.865) [-1169.237] (-1170.734) -- 0:00:18
698000 -- (-1170.175) [-1168.088] (-1172.036) (-1169.256) * (-1169.343) (-1173.489) (-1169.480) [-1171.511] -- 0:00:18
698500 -- (-1169.011) [-1170.238] (-1168.944) (-1170.093) * (-1169.038) [-1169.374] (-1169.509) (-1169.844) -- 0:00:18
699000 -- (-1168.007) (-1169.583) (-1172.573) [-1171.264] * [-1168.165] (-1171.292) (-1173.672) (-1169.444) -- 0:00:18
699500 -- [-1170.430] (-1170.313) (-1171.596) (-1170.222) * (-1169.600) (-1169.290) [-1169.968] (-1173.907) -- 0:00:18
700000 -- (-1170.941) (-1169.595) (-1170.185) [-1170.790] * (-1170.636) (-1170.292) (-1170.345) [-1171.617] -- 0:00:18
Average standard deviation of split frequencies: 0.009882
700500 -- (-1168.351) (-1171.897) (-1172.752) [-1172.216] * (-1170.096) (-1169.647) [-1168.678] (-1171.548) -- 0:00:18
701000 -- (-1168.700) (-1173.174) [-1172.375] (-1172.254) * (-1170.937) (-1169.529) [-1168.781] (-1172.418) -- 0:00:18
701500 -- [-1169.157] (-1174.510) (-1168.649) (-1168.527) * [-1169.200] (-1170.600) (-1168.320) (-1173.578) -- 0:00:18
702000 -- [-1168.361] (-1170.049) (-1172.455) (-1168.192) * (-1169.450) (-1171.751) [-1170.680] (-1169.984) -- 0:00:18
702500 -- [-1171.240] (-1168.473) (-1169.329) (-1171.338) * (-1170.723) (-1176.153) (-1168.742) [-1171.765] -- 0:00:18
703000 -- (-1170.191) (-1168.240) [-1169.076] (-1172.197) * [-1170.543] (-1170.223) (-1171.145) (-1172.417) -- 0:00:18
703500 -- [-1169.557] (-1169.126) (-1170.998) (-1173.160) * [-1172.066] (-1170.569) (-1172.088) (-1172.465) -- 0:00:18
704000 -- (-1170.594) (-1168.583) (-1173.552) [-1170.576] * (-1170.731) [-1168.634] (-1171.713) (-1170.076) -- 0:00:18
704500 -- (-1169.688) [-1169.774] (-1175.622) (-1175.407) * (-1172.532) (-1169.349) [-1171.306] (-1168.942) -- 0:00:18
705000 -- (-1170.410) [-1168.294] (-1173.567) (-1172.320) * (-1171.176) (-1169.500) [-1168.488] (-1168.620) -- 0:00:18
Average standard deviation of split frequencies: 0.010266
705500 -- [-1172.848] (-1171.297) (-1169.677) (-1168.233) * (-1171.543) [-1169.315] (-1168.979) (-1169.031) -- 0:00:18
706000 -- (-1172.644) (-1171.078) (-1168.842) [-1172.100] * (-1168.693) (-1173.291) [-1174.616] (-1170.212) -- 0:00:18
706500 -- (-1173.347) (-1172.426) [-1169.717] (-1170.590) * (-1169.158) (-1171.417) (-1172.677) [-1168.337] -- 0:00:18
707000 -- (-1179.494) (-1172.838) (-1172.230) [-1171.164] * [-1167.988] (-1172.751) (-1172.744) (-1171.212) -- 0:00:18
707500 -- (-1169.067) (-1168.954) [-1171.994] (-1172.831) * (-1169.466) [-1170.593] (-1170.640) (-1169.201) -- 0:00:18
708000 -- [-1170.027] (-1172.891) (-1170.713) (-1168.483) * (-1170.146) [-1170.183] (-1171.357) (-1171.563) -- 0:00:18
708500 -- (-1169.831) (-1171.414) (-1168.517) [-1168.842] * (-1169.143) [-1171.026] (-1171.302) (-1171.034) -- 0:00:18
709000 -- [-1172.636] (-1170.851) (-1168.500) (-1167.928) * (-1171.253) [-1171.595] (-1171.165) (-1167.766) -- 0:00:18
709500 -- (-1168.336) [-1171.069] (-1169.185) (-1170.519) * (-1173.276) (-1168.330) [-1170.417] (-1168.624) -- 0:00:18
710000 -- [-1168.463] (-1169.653) (-1168.930) (-1168.953) * [-1170.932] (-1168.241) (-1170.610) (-1167.648) -- 0:00:17
Average standard deviation of split frequencies: 0.010862
710500 -- (-1172.626) (-1170.907) (-1169.125) [-1168.573] * (-1168.286) (-1168.587) [-1172.119] (-1170.717) -- 0:00:17
711000 -- (-1170.164) [-1170.450] (-1172.003) (-1169.231) * [-1169.553] (-1171.277) (-1171.072) (-1170.220) -- 0:00:17
711500 -- (-1168.679) (-1171.153) (-1169.441) [-1170.271] * (-1169.607) (-1171.928) [-1168.078] (-1168.244) -- 0:00:17
712000 -- (-1174.351) [-1169.738] (-1169.486) (-1169.325) * (-1167.674) (-1172.956) [-1168.111] (-1169.028) -- 0:00:17
712500 -- (-1169.397) (-1167.920) [-1170.051] (-1169.301) * (-1171.549) (-1170.788) (-1168.936) [-1168.898] -- 0:00:17
713000 -- (-1170.440) (-1168.938) [-1180.283] (-1172.554) * (-1173.275) [-1171.759] (-1174.468) (-1175.401) -- 0:00:17
713500 -- (-1172.209) (-1168.934) (-1171.182) [-1171.515] * (-1174.059) (-1170.069) (-1170.768) [-1170.719] -- 0:00:17
714000 -- (-1168.118) (-1168.942) [-1170.711] (-1169.366) * (-1176.930) [-1171.045] (-1168.157) (-1172.294) -- 0:00:17
714500 -- (-1168.535) (-1170.910) [-1169.352] (-1174.105) * [-1170.021] (-1169.591) (-1168.583) (-1170.540) -- 0:00:17
715000 -- [-1169.963] (-1171.614) (-1169.083) (-1169.920) * [-1168.411] (-1174.236) (-1167.678) (-1170.536) -- 0:00:17
Average standard deviation of split frequencies: 0.010370
715500 -- (-1170.428) [-1175.265] (-1173.004) (-1173.060) * (-1168.042) [-1171.362] (-1169.744) (-1170.644) -- 0:00:17
716000 -- (-1171.437) (-1173.819) (-1170.789) [-1168.857] * [-1167.884] (-1170.667) (-1170.509) (-1170.647) -- 0:00:17
716500 -- (-1170.943) (-1170.888) [-1170.873] (-1167.933) * (-1168.067) (-1172.340) [-1169.547] (-1169.651) -- 0:00:17
717000 -- (-1169.649) (-1169.006) (-1172.409) [-1173.645] * (-1168.073) (-1169.093) [-1170.177] (-1168.790) -- 0:00:17
717500 -- (-1169.213) (-1170.273) [-1169.845] (-1171.567) * [-1170.123] (-1168.766) (-1169.687) (-1169.100) -- 0:00:17
718000 -- (-1169.848) [-1175.303] (-1170.109) (-1168.372) * [-1168.948] (-1170.573) (-1170.688) (-1170.336) -- 0:00:17
718500 -- (-1169.581) [-1169.658] (-1171.660) (-1170.335) * (-1168.726) (-1172.108) (-1168.551) [-1169.704] -- 0:00:17
719000 -- [-1168.101] (-1168.163) (-1171.494) (-1170.283) * (-1170.396) (-1169.076) [-1169.498] (-1169.414) -- 0:00:17
719500 -- [-1172.463] (-1168.387) (-1170.742) (-1169.975) * (-1168.948) (-1169.464) (-1170.973) [-1171.826] -- 0:00:17
720000 -- (-1172.453) (-1170.687) (-1168.195) [-1168.026] * (-1170.238) (-1175.349) (-1176.695) [-1170.665] -- 0:00:17
Average standard deviation of split frequencies: 0.010262
720500 -- (-1170.172) (-1171.691) [-1168.172] (-1168.674) * (-1176.061) (-1169.532) (-1168.594) [-1170.946] -- 0:00:17
721000 -- (-1170.176) (-1176.575) (-1169.998) [-1170.757] * (-1173.766) (-1171.405) (-1168.164) [-1170.038] -- 0:00:17
721500 -- (-1169.566) (-1174.235) (-1169.511) [-1169.837] * (-1175.905) (-1169.500) [-1173.741] (-1170.098) -- 0:00:17
722000 -- [-1171.320] (-1173.350) (-1167.814) (-1171.824) * (-1169.551) (-1171.559) [-1169.411] (-1170.191) -- 0:00:17
722500 -- (-1172.889) (-1169.547) (-1169.268) [-1169.376] * (-1169.822) (-1169.594) (-1168.837) [-1170.929] -- 0:00:17
723000 -- [-1170.481] (-1169.528) (-1170.066) (-1168.703) * (-1171.043) (-1170.375) [-1169.321] (-1167.750) -- 0:00:17
723500 -- (-1169.433) [-1168.140] (-1169.475) (-1169.480) * (-1169.812) (-1172.984) [-1169.670] (-1171.593) -- 0:00:17
724000 -- (-1173.128) [-1168.354] (-1168.244) (-1170.150) * (-1167.901) (-1171.583) [-1167.719] (-1170.040) -- 0:00:17
724500 -- (-1172.801) (-1174.127) [-1168.288] (-1170.219) * (-1167.808) (-1172.946) (-1167.769) [-1172.879] -- 0:00:17
725000 -- (-1177.354) [-1169.052] (-1171.957) (-1169.041) * (-1171.204) (-1170.964) [-1168.450] (-1173.222) -- 0:00:17
Average standard deviation of split frequencies: 0.010430
725500 -- (-1169.410) [-1170.302] (-1169.438) (-1168.740) * (-1168.673) (-1168.881) [-1169.645] (-1170.793) -- 0:00:17
726000 -- [-1168.553] (-1169.050) (-1168.462) (-1169.724) * (-1171.335) (-1169.995) [-1174.984] (-1173.290) -- 0:00:16
726500 -- (-1170.564) (-1170.712) [-1172.317] (-1177.785) * (-1170.162) (-1169.142) [-1168.515] (-1173.180) -- 0:00:16
727000 -- (-1170.218) [-1170.328] (-1169.475) (-1174.277) * (-1172.271) (-1172.444) (-1168.768) [-1168.610] -- 0:00:16
727500 -- (-1173.031) [-1170.851] (-1171.820) (-1171.597) * (-1169.384) (-1168.022) (-1170.402) [-1170.397] -- 0:00:16
728000 -- [-1173.395] (-1170.106) (-1169.036) (-1178.183) * (-1170.657) (-1168.489) [-1170.928] (-1172.759) -- 0:00:16
728500 -- (-1170.955) (-1170.794) [-1167.913] (-1173.602) * [-1168.633] (-1168.759) (-1172.155) (-1173.610) -- 0:00:16
729000 -- (-1170.907) [-1169.780] (-1168.893) (-1173.110) * [-1169.917] (-1169.671) (-1168.998) (-1171.030) -- 0:00:16
729500 -- (-1172.760) [-1169.370] (-1171.023) (-1173.612) * [-1171.193] (-1168.645) (-1170.222) (-1170.337) -- 0:00:16
730000 -- (-1169.725) (-1169.672) [-1167.760] (-1170.526) * (-1168.772) [-1168.650] (-1170.409) (-1169.769) -- 0:00:16
Average standard deviation of split frequencies: 0.010766
730500 -- (-1170.693) (-1172.718) (-1170.068) [-1168.246] * [-1172.805] (-1171.269) (-1169.408) (-1170.793) -- 0:00:16
731000 -- (-1168.406) [-1170.386] (-1173.630) (-1168.566) * (-1171.375) (-1168.651) [-1169.960] (-1170.134) -- 0:00:16
731500 -- (-1171.445) (-1172.485) [-1167.804] (-1169.995) * [-1170.364] (-1171.686) (-1169.432) (-1168.057) -- 0:00:16
732000 -- (-1173.336) [-1170.374] (-1169.790) (-1175.241) * (-1168.882) [-1171.492] (-1168.812) (-1169.289) -- 0:00:16
732500 -- (-1169.634) (-1171.328) [-1169.615] (-1170.525) * (-1169.514) (-1172.707) (-1168.536) [-1169.063] -- 0:00:16
733000 -- (-1168.612) (-1171.809) [-1168.513] (-1169.152) * [-1169.121] (-1167.950) (-1170.895) (-1171.955) -- 0:00:16
733500 -- [-1169.823] (-1170.774) (-1169.574) (-1168.310) * (-1170.310) (-1172.488) (-1176.617) [-1167.879] -- 0:00:16
734000 -- [-1168.088] (-1173.226) (-1171.788) (-1168.130) * (-1168.036) (-1168.751) [-1172.979] (-1170.661) -- 0:00:16
734500 -- (-1168.548) (-1175.653) (-1171.800) [-1168.903] * (-1169.109) (-1173.133) (-1172.548) [-1170.431] -- 0:00:16
735000 -- (-1168.782) [-1175.862] (-1171.131) (-1171.322) * (-1171.471) (-1172.497) (-1171.296) [-1171.868] -- 0:00:16
Average standard deviation of split frequencies: 0.010888
735500 -- (-1171.457) [-1169.079] (-1174.367) (-1168.349) * (-1167.944) [-1171.210] (-1169.773) (-1170.236) -- 0:00:16
736000 -- (-1171.042) (-1171.247) (-1168.442) [-1169.999] * [-1170.078] (-1172.020) (-1171.786) (-1170.467) -- 0:00:16
736500 -- (-1172.898) [-1172.803] (-1172.784) (-1170.190) * [-1168.792] (-1171.123) (-1168.181) (-1168.653) -- 0:00:16
737000 -- [-1172.445] (-1172.365) (-1171.174) (-1171.005) * (-1170.976) (-1171.460) [-1169.757] (-1170.954) -- 0:00:16
737500 -- [-1169.822] (-1171.161) (-1170.097) (-1168.144) * (-1170.113) [-1171.495] (-1169.318) (-1171.262) -- 0:00:16
738000 -- (-1170.596) (-1169.274) [-1168.564] (-1169.500) * (-1170.767) (-1173.847) [-1170.888] (-1171.538) -- 0:00:16
738500 -- (-1168.451) (-1168.991) (-1168.364) [-1171.456] * [-1168.637] (-1172.446) (-1170.562) (-1170.968) -- 0:00:16
739000 -- (-1167.897) (-1169.218) [-1171.646] (-1168.974) * [-1169.272] (-1169.561) (-1169.215) (-1169.833) -- 0:00:16
739500 -- [-1176.801] (-1169.723) (-1168.490) (-1169.225) * (-1170.529) [-1169.528] (-1169.687) (-1172.585) -- 0:00:16
740000 -- [-1171.348] (-1168.899) (-1168.851) (-1169.179) * (-1168.458) (-1169.925) (-1172.211) [-1169.607] -- 0:00:16
Average standard deviation of split frequencies: 0.010700
740500 -- (-1169.946) [-1169.460] (-1169.568) (-1168.505) * (-1169.599) (-1170.438) (-1172.079) [-1170.493] -- 0:00:16
741000 -- (-1170.691) (-1171.815) (-1169.054) [-1168.862] * (-1169.546) [-1170.559] (-1173.740) (-1169.639) -- 0:00:16
741500 -- (-1168.858) (-1173.480) [-1170.760] (-1170.220) * (-1171.307) [-1168.259] (-1173.478) (-1174.606) -- 0:00:16
742000 -- (-1170.819) (-1171.504) [-1171.456] (-1171.320) * (-1172.524) (-1168.698) (-1171.716) [-1169.166] -- 0:00:15
742500 -- [-1170.759] (-1172.010) (-1170.244) (-1175.323) * (-1171.562) (-1169.891) [-1174.491] (-1168.867) -- 0:00:15
743000 -- (-1169.528) [-1170.806] (-1168.760) (-1168.525) * (-1170.840) (-1170.138) [-1169.096] (-1172.074) -- 0:00:15
743500 -- (-1172.222) [-1170.826] (-1172.223) (-1169.340) * (-1169.461) (-1171.068) (-1169.541) [-1168.639] -- 0:00:15
744000 -- (-1171.708) (-1168.584) (-1172.924) [-1170.251] * (-1169.322) (-1171.375) [-1169.414] (-1168.191) -- 0:00:15
744500 -- (-1168.942) (-1169.250) (-1169.435) [-1170.229] * (-1169.910) (-1168.067) (-1169.101) [-1169.110] -- 0:00:15
745000 -- (-1170.249) [-1168.348] (-1169.875) (-1170.081) * [-1170.693] (-1173.027) (-1168.111) (-1170.028) -- 0:00:15
Average standard deviation of split frequencies: 0.010190
745500 -- (-1169.575) [-1168.237] (-1175.411) (-1170.922) * (-1170.780) (-1170.114) [-1168.361] (-1170.034) -- 0:00:15
746000 -- (-1170.099) (-1172.443) [-1172.468] (-1169.735) * (-1174.435) (-1168.829) (-1168.312) [-1171.237] -- 0:00:15
746500 -- (-1171.690) [-1170.059] (-1171.137) (-1169.384) * [-1173.524] (-1168.957) (-1169.048) (-1168.202) -- 0:00:15
747000 -- [-1172.150] (-1170.128) (-1170.632) (-1169.447) * (-1169.670) (-1169.333) (-1173.146) [-1169.235] -- 0:00:15
747500 -- (-1168.702) [-1169.311] (-1169.751) (-1171.274) * (-1170.091) (-1168.323) [-1170.131] (-1170.482) -- 0:00:15
748000 -- (-1168.538) (-1169.639) (-1169.003) [-1173.259] * (-1175.771) (-1170.228) [-1171.069] (-1169.313) -- 0:00:15
748500 -- (-1168.475) (-1168.154) (-1169.973) [-1171.557] * (-1174.781) [-1169.554] (-1169.437) (-1169.786) -- 0:00:15
749000 -- (-1170.007) (-1170.535) [-1169.737] (-1173.109) * (-1173.283) (-1168.456) (-1171.258) [-1174.454] -- 0:00:15
749500 -- (-1169.195) [-1170.008] (-1169.951) (-1169.629) * (-1175.631) (-1170.678) [-1170.551] (-1168.301) -- 0:00:15
750000 -- (-1168.610) (-1169.325) [-1169.793] (-1170.094) * (-1173.338) (-1172.949) (-1172.840) [-1170.383] -- 0:00:15
Average standard deviation of split frequencies: 0.010362
750500 -- (-1171.221) [-1168.526] (-1169.485) (-1173.794) * [-1171.397] (-1168.516) (-1173.852) (-1169.503) -- 0:00:15
751000 -- (-1169.607) (-1171.697) (-1171.278) [-1169.628] * (-1169.358) [-1169.454] (-1172.515) (-1172.546) -- 0:00:15
751500 -- (-1170.956) [-1169.670] (-1171.254) (-1169.571) * (-1170.622) (-1168.587) (-1175.306) [-1172.421] -- 0:00:15
752000 -- (-1169.268) (-1170.767) (-1169.246) [-1169.905] * (-1170.982) [-1170.817] (-1173.164) (-1168.725) -- 0:00:15
752500 -- (-1170.667) (-1169.031) [-1169.001] (-1169.765) * (-1171.329) [-1170.153] (-1170.799) (-1168.141) -- 0:00:15
753000 -- (-1171.391) (-1172.931) [-1169.811] (-1169.995) * (-1174.468) (-1169.403) [-1173.786] (-1167.839) -- 0:00:15
753500 -- [-1170.055] (-1173.064) (-1173.716) (-1169.453) * (-1169.246) (-1169.595) [-1168.959] (-1169.329) -- 0:00:15
754000 -- (-1168.993) (-1169.467) (-1171.187) [-1169.567] * [-1171.275] (-1170.589) (-1168.940) (-1169.928) -- 0:00:15
754500 -- (-1168.944) (-1169.291) [-1168.796] (-1171.276) * (-1172.945) (-1169.166) [-1170.746] (-1168.602) -- 0:00:15
755000 -- (-1169.724) (-1170.546) [-1170.746] (-1172.006) * (-1171.223) (-1169.144) (-1170.353) [-1169.427] -- 0:00:15
Average standard deviation of split frequencies: 0.010756
755500 -- [-1168.956] (-1171.869) (-1171.213) (-1168.135) * [-1169.378] (-1168.852) (-1170.105) (-1173.050) -- 0:00:15
756000 -- (-1171.831) (-1169.231) [-1170.814] (-1169.007) * (-1173.310) (-1169.741) [-1173.405] (-1172.538) -- 0:00:15
756500 -- [-1169.438] (-1169.774) (-1169.534) (-1171.161) * (-1177.681) [-1170.566] (-1170.504) (-1172.899) -- 0:00:15
757000 -- (-1169.732) (-1168.526) [-1170.953] (-1172.218) * (-1169.358) (-1172.441) [-1168.218] (-1168.199) -- 0:00:15
757500 -- (-1174.925) (-1168.506) (-1168.619) [-1170.597] * (-1168.712) [-1171.379] (-1167.836) (-1169.399) -- 0:00:15
758000 -- (-1173.138) [-1168.992] (-1169.852) (-1172.608) * (-1168.342) (-1169.155) (-1169.208) [-1171.672] -- 0:00:15
758500 -- (-1168.198) (-1168.773) [-1169.852] (-1174.044) * (-1170.244) (-1169.334) (-1168.260) [-1174.199] -- 0:00:14
759000 -- (-1169.506) (-1169.172) (-1169.949) [-1170.803] * (-1169.318) [-1171.005] (-1169.620) (-1172.174) -- 0:00:14
759500 -- (-1170.754) (-1168.825) [-1170.387] (-1169.703) * (-1171.082) (-1174.720) (-1170.144) [-1170.173] -- 0:00:14
760000 -- (-1170.221) (-1169.338) (-1169.141) [-1169.897] * (-1173.199) (-1175.137) (-1170.681) [-1170.231] -- 0:00:14
Average standard deviation of split frequencies: 0.010458
760500 -- [-1173.270] (-1169.356) (-1172.554) (-1169.666) * (-1172.972) (-1167.962) [-1168.840] (-1169.576) -- 0:00:14
761000 -- (-1169.944) (-1173.318) (-1172.449) [-1169.186] * (-1169.665) [-1169.264] (-1170.971) (-1169.355) -- 0:00:14
761500 -- [-1169.286] (-1172.825) (-1171.815) (-1171.376) * [-1169.014] (-1171.169) (-1170.523) (-1172.917) -- 0:00:14
762000 -- (-1170.701) (-1171.484) [-1171.100] (-1168.739) * (-1168.830) [-1169.508] (-1168.917) (-1169.539) -- 0:00:14
762500 -- (-1171.657) [-1170.267] (-1170.483) (-1170.812) * (-1169.567) [-1172.103] (-1169.389) (-1170.473) -- 0:00:14
763000 -- (-1174.496) [-1168.561] (-1168.709) (-1168.624) * (-1168.574) (-1169.375) (-1168.404) [-1171.523] -- 0:00:14
763500 -- [-1170.076] (-1169.713) (-1169.738) (-1169.038) * (-1172.328) [-1169.413] (-1167.710) (-1169.533) -- 0:00:14
764000 -- (-1169.430) [-1170.020] (-1169.447) (-1168.577) * [-1171.191] (-1168.885) (-1174.522) (-1168.944) -- 0:00:14
764500 -- (-1177.434) (-1168.957) (-1170.623) [-1169.857] * (-1173.216) (-1169.423) (-1169.313) [-1169.926] -- 0:00:14
765000 -- (-1171.505) [-1169.354] (-1171.081) (-1168.425) * (-1171.506) (-1169.769) (-1171.045) [-1168.162] -- 0:00:14
Average standard deviation of split frequencies: 0.010385
765500 -- (-1168.847) [-1172.274] (-1169.038) (-1168.481) * [-1170.098] (-1172.449) (-1172.590) (-1170.002) -- 0:00:14
766000 -- [-1169.012] (-1170.964) (-1168.508) (-1169.879) * [-1171.714] (-1172.224) (-1174.200) (-1174.514) -- 0:00:14
766500 -- (-1175.279) (-1169.250) [-1170.031] (-1168.807) * (-1168.736) (-1169.619) [-1171.987] (-1173.351) -- 0:00:14
767000 -- [-1172.188] (-1169.961) (-1174.897) (-1171.493) * (-1169.698) [-1169.020] (-1173.444) (-1170.669) -- 0:00:14
767500 -- [-1169.213] (-1172.399) (-1168.537) (-1169.390) * [-1169.747] (-1169.250) (-1172.538) (-1168.955) -- 0:00:14
768000 -- (-1169.173) (-1169.541) (-1169.880) [-1170.154] * [-1171.831] (-1171.337) (-1170.073) (-1170.320) -- 0:00:14
768500 -- (-1170.771) (-1170.128) (-1173.280) [-1170.845] * (-1169.973) (-1171.138) [-1169.087] (-1171.601) -- 0:00:14
769000 -- (-1170.870) (-1168.709) [-1168.414] (-1169.139) * [-1171.124] (-1169.489) (-1169.463) (-1170.281) -- 0:00:14
769500 -- [-1172.587] (-1170.372) (-1168.750) (-1171.722) * (-1168.511) (-1170.495) [-1169.511] (-1168.488) -- 0:00:14
770000 -- (-1173.607) (-1170.130) (-1168.390) [-1172.827] * (-1168.105) (-1172.552) (-1170.620) [-1168.702] -- 0:00:14
Average standard deviation of split frequencies: 0.010513
770500 -- (-1171.178) (-1170.452) [-1171.608] (-1173.185) * [-1168.426] (-1169.673) (-1175.000) (-1168.696) -- 0:00:14
771000 -- (-1168.594) [-1173.943] (-1169.012) (-1175.794) * [-1170.691] (-1169.756) (-1170.051) (-1169.203) -- 0:00:14
771500 -- [-1168.280] (-1174.973) (-1169.490) (-1169.097) * (-1170.332) (-1173.012) (-1173.405) [-1171.502] -- 0:00:14
772000 -- [-1168.596] (-1173.889) (-1170.089) (-1169.806) * (-1172.703) (-1169.939) (-1169.097) [-1169.924] -- 0:00:14
772500 -- [-1172.025] (-1170.806) (-1173.516) (-1169.534) * (-1170.690) (-1169.671) [-1167.859] (-1168.839) -- 0:00:14
773000 -- (-1170.588) (-1169.820) [-1171.238] (-1174.276) * (-1172.882) [-1168.964] (-1168.339) (-1167.919) -- 0:00:14
773500 -- [-1173.558] (-1173.049) (-1169.912) (-1171.255) * (-1170.503) [-1169.847] (-1170.961) (-1169.683) -- 0:00:14
774000 -- (-1174.103) (-1169.334) (-1169.116) [-1170.988] * [-1169.711] (-1174.713) (-1174.249) (-1170.193) -- 0:00:14
774500 -- (-1170.098) (-1169.134) [-1173.357] (-1170.418) * (-1172.535) (-1174.187) (-1172.587) [-1170.313] -- 0:00:13
775000 -- (-1173.772) (-1169.897) [-1169.907] (-1168.567) * (-1171.354) (-1169.573) [-1172.242] (-1170.707) -- 0:00:13
Average standard deviation of split frequencies: 0.010251
775500 -- [-1174.407] (-1171.195) (-1168.857) (-1171.873) * [-1169.089] (-1170.562) (-1171.397) (-1172.164) -- 0:00:13
776000 -- (-1171.810) (-1168.544) (-1169.532) [-1172.035] * (-1169.546) [-1169.575] (-1170.926) (-1169.922) -- 0:00:13
776500 -- [-1169.542] (-1169.030) (-1170.285) (-1172.434) * (-1169.789) [-1170.076] (-1169.659) (-1170.147) -- 0:00:13
777000 -- (-1173.458) (-1174.486) [-1169.744] (-1172.062) * (-1168.356) [-1172.089] (-1175.823) (-1169.854) -- 0:00:13
777500 -- [-1176.554] (-1170.303) (-1169.852) (-1170.368) * (-1170.114) [-1168.689] (-1170.392) (-1171.027) -- 0:00:13
778000 -- [-1171.402] (-1170.052) (-1169.426) (-1167.997) * (-1171.763) (-1169.987) [-1170.542] (-1175.343) -- 0:00:13
778500 -- (-1171.678) (-1171.461) [-1168.098] (-1173.218) * (-1169.088) [-1169.886] (-1170.732) (-1173.329) -- 0:00:13
779000 -- (-1171.134) [-1168.909] (-1169.268) (-1171.977) * (-1172.164) (-1170.133) [-1170.387] (-1172.409) -- 0:00:13
779500 -- (-1168.128) [-1171.747] (-1168.147) (-1171.770) * [-1169.455] (-1169.947) (-1169.625) (-1171.504) -- 0:00:13
780000 -- (-1171.145) (-1170.082) [-1168.066] (-1168.483) * [-1170.455] (-1171.137) (-1171.623) (-1171.605) -- 0:00:13
Average standard deviation of split frequencies: 0.009813
780500 -- [-1171.929] (-1173.675) (-1168.482) (-1170.190) * (-1169.935) (-1171.805) (-1170.945) [-1170.800] -- 0:00:13
781000 -- (-1172.675) [-1168.759] (-1170.173) (-1174.076) * [-1168.957] (-1169.457) (-1169.223) (-1170.629) -- 0:00:13
781500 -- (-1170.831) (-1169.598) [-1170.134] (-1169.930) * (-1170.413) (-1170.944) [-1169.650] (-1170.252) -- 0:00:13
782000 -- (-1169.527) [-1168.175] (-1169.980) (-1170.736) * (-1171.434) [-1168.045] (-1168.602) (-1168.891) -- 0:00:13
782500 -- (-1168.920) (-1168.655) [-1170.174] (-1172.699) * (-1170.565) [-1174.372] (-1170.509) (-1172.698) -- 0:00:13
783000 -- (-1169.586) [-1170.746] (-1170.225) (-1169.319) * (-1168.727) (-1173.440) [-1171.474] (-1169.685) -- 0:00:13
783500 -- (-1171.377) (-1168.600) [-1172.150] (-1169.777) * [-1171.597] (-1171.103) (-1167.669) (-1171.359) -- 0:00:13
784000 -- (-1169.110) [-1170.116] (-1169.658) (-1169.386) * (-1170.148) [-1169.520] (-1167.669) (-1169.451) -- 0:00:13
784500 -- [-1168.808] (-1168.571) (-1169.552) (-1168.362) * (-1169.729) (-1172.121) [-1168.083] (-1172.272) -- 0:00:13
785000 -- [-1168.939] (-1174.488) (-1168.097) (-1169.070) * (-1172.595) (-1171.355) (-1169.959) [-1171.946] -- 0:00:13
Average standard deviation of split frequencies: 0.009521
785500 -- (-1170.000) (-1168.576) (-1172.075) [-1170.046] * (-1172.584) (-1171.574) (-1170.385) [-1170.910] -- 0:00:13
786000 -- (-1170.566) [-1168.191] (-1172.627) (-1169.013) * (-1172.099) (-1170.023) (-1172.859) [-1168.905] -- 0:00:13
786500 -- (-1173.060) [-1168.404] (-1172.676) (-1168.149) * (-1176.810) (-1168.420) [-1170.235] (-1168.625) -- 0:00:13
787000 -- (-1169.784) (-1171.036) (-1167.812) [-1167.794] * (-1168.513) (-1169.209) (-1172.095) [-1169.135] -- 0:00:13
787500 -- (-1170.947) [-1171.241] (-1168.228) (-1167.808) * [-1168.235] (-1168.817) (-1168.710) (-1169.858) -- 0:00:13
788000 -- (-1171.835) [-1171.885] (-1170.245) (-1170.725) * (-1168.376) (-1170.210) [-1170.649] (-1172.926) -- 0:00:13
788500 -- [-1172.549] (-1171.300) (-1172.437) (-1170.229) * (-1168.289) [-1169.124] (-1172.324) (-1171.954) -- 0:00:13
789000 -- (-1174.754) [-1170.041] (-1170.833) (-1175.301) * (-1169.119) [-1168.192] (-1170.027) (-1175.776) -- 0:00:13
789500 -- [-1167.839] (-1169.907) (-1172.760) (-1174.265) * [-1168.893] (-1168.350) (-1169.221) (-1173.490) -- 0:00:13
790000 -- (-1168.524) (-1173.580) (-1169.302) [-1171.185] * (-1168.007) (-1169.154) (-1171.613) [-1173.027] -- 0:00:13
Average standard deviation of split frequencies: 0.009502
790500 -- (-1172.605) (-1171.045) [-1171.043] (-1168.809) * (-1167.978) (-1167.964) [-1173.803] (-1168.092) -- 0:00:12
791000 -- (-1170.284) (-1169.203) (-1173.025) [-1169.726] * [-1170.083] (-1170.076) (-1170.375) (-1170.010) -- 0:00:12
791500 -- [-1169.929] (-1170.323) (-1170.091) (-1169.064) * (-1168.337) (-1169.523) [-1168.693] (-1170.219) -- 0:00:12
792000 -- (-1174.004) (-1171.755) (-1170.874) [-1173.717] * (-1169.345) [-1169.078] (-1170.146) (-1171.615) -- 0:00:12
792500 -- (-1173.834) [-1173.831] (-1167.703) (-1172.712) * (-1169.509) [-1168.981] (-1169.856) (-1170.698) -- 0:00:12
793000 -- (-1169.345) [-1172.401] (-1170.394) (-1168.866) * (-1169.596) [-1170.915] (-1168.733) (-1170.795) -- 0:00:12
793500 -- (-1169.598) (-1170.568) [-1170.510] (-1169.043) * (-1169.363) (-1169.532) (-1169.010) [-1168.711] -- 0:00:12
794000 -- (-1168.347) [-1168.408] (-1170.470) (-1168.832) * (-1176.570) [-1170.492] (-1169.573) (-1168.616) -- 0:00:12
794500 -- (-1172.511) (-1172.004) [-1170.107] (-1171.299) * [-1171.176] (-1172.506) (-1169.940) (-1167.928) -- 0:00:12
795000 -- [-1169.757] (-1170.213) (-1168.157) (-1171.572) * (-1169.841) (-1169.785) [-1169.480] (-1168.090) -- 0:00:12
Average standard deviation of split frequencies: 0.009031
795500 -- (-1172.725) (-1178.795) [-1168.708] (-1170.106) * (-1169.174) [-1168.400] (-1170.815) (-1169.175) -- 0:00:12
796000 -- (-1167.938) [-1176.803] (-1169.855) (-1172.407) * [-1169.438] (-1168.780) (-1171.544) (-1169.512) -- 0:00:12
796500 -- [-1169.380] (-1174.075) (-1168.927) (-1171.741) * [-1170.755] (-1168.548) (-1168.305) (-1169.138) -- 0:00:12
797000 -- [-1169.986] (-1168.592) (-1168.509) (-1169.203) * (-1170.787) (-1169.548) [-1169.375] (-1168.327) -- 0:00:12
797500 -- (-1174.806) (-1171.474) [-1168.230] (-1170.141) * [-1173.168] (-1169.035) (-1169.240) (-1167.946) -- 0:00:12
798000 -- [-1170.964] (-1172.370) (-1169.977) (-1172.574) * [-1168.016] (-1169.509) (-1168.789) (-1170.233) -- 0:00:12
798500 -- (-1170.014) (-1168.260) [-1169.068] (-1169.490) * (-1169.639) (-1170.122) [-1168.997] (-1169.768) -- 0:00:12
799000 -- (-1171.117) (-1170.700) (-1171.764) [-1171.234] * (-1171.626) [-1169.202] (-1170.359) (-1168.869) -- 0:00:12
799500 -- (-1168.286) (-1173.046) (-1172.335) [-1170.705] * (-1168.707) (-1171.203) (-1172.474) [-1170.937] -- 0:00:12
800000 -- (-1167.765) (-1170.907) [-1172.874] (-1171.479) * [-1168.733] (-1177.214) (-1170.475) (-1174.888) -- 0:00:12
Average standard deviation of split frequencies: 0.009052
800500 -- [-1169.205] (-1168.695) (-1172.366) (-1169.045) * (-1169.565) [-1168.574] (-1170.385) (-1168.893) -- 0:00:12
801000 -- (-1169.829) [-1170.787] (-1170.377) (-1169.158) * (-1169.696) (-1169.645) [-1168.884] (-1169.441) -- 0:00:12
801500 -- [-1168.843] (-1174.326) (-1169.758) (-1168.726) * [-1171.107] (-1168.226) (-1172.100) (-1173.031) -- 0:00:12
802000 -- [-1171.818] (-1169.126) (-1171.575) (-1171.740) * (-1172.047) [-1168.029] (-1170.235) (-1172.980) -- 0:00:12
802500 -- (-1173.095) (-1168.984) [-1171.297] (-1167.952) * [-1169.308] (-1168.290) (-1175.916) (-1173.522) -- 0:00:12
803000 -- [-1169.100] (-1170.370) (-1170.156) (-1169.481) * (-1168.744) [-1168.220] (-1172.635) (-1174.496) -- 0:00:12
803500 -- [-1170.022] (-1168.911) (-1171.541) (-1169.643) * [-1169.247] (-1168.318) (-1171.209) (-1173.712) -- 0:00:12
804000 -- [-1169.683] (-1169.870) (-1169.794) (-1169.586) * (-1172.425) (-1175.021) [-1168.881] (-1169.946) -- 0:00:12
804500 -- (-1168.798) (-1169.209) (-1169.280) [-1170.592] * (-1171.301) [-1168.802] (-1169.020) (-1174.282) -- 0:00:12
805000 -- (-1169.396) (-1170.203) (-1168.349) [-1169.369] * (-1169.787) [-1170.311] (-1174.276) (-1169.791) -- 0:00:12
Average standard deviation of split frequencies: 0.008344
805500 -- (-1169.817) [-1169.795] (-1168.515) (-1168.268) * [-1169.811] (-1170.834) (-1169.333) (-1173.052) -- 0:00:12
806000 -- (-1171.262) (-1169.502) (-1168.204) [-1168.294] * (-1170.065) (-1170.047) (-1170.419) [-1169.238] -- 0:00:12
806500 -- (-1173.636) (-1171.378) [-1170.222] (-1169.559) * [-1169.048] (-1169.687) (-1172.219) (-1170.871) -- 0:00:11
807000 -- (-1171.121) [-1169.603] (-1170.442) (-1168.936) * (-1170.204) (-1168.188) (-1170.398) [-1168.856] -- 0:00:11
807500 -- (-1169.309) (-1169.668) [-1172.450] (-1168.106) * [-1168.853] (-1173.257) (-1169.503) (-1169.174) -- 0:00:11
808000 -- (-1169.895) [-1169.968] (-1170.299) (-1168.465) * (-1171.823) (-1170.420) [-1170.012] (-1168.123) -- 0:00:11
808500 -- (-1171.383) [-1169.745] (-1169.126) (-1168.369) * (-1171.719) [-1169.993] (-1168.641) (-1170.074) -- 0:00:11
809000 -- (-1171.463) (-1169.374) (-1168.303) [-1176.076] * (-1168.535) [-1169.760] (-1168.172) (-1170.220) -- 0:00:11
809500 -- (-1169.451) [-1167.887] (-1176.782) (-1173.042) * (-1171.573) (-1169.378) (-1171.960) [-1169.284] -- 0:00:11
810000 -- [-1169.338] (-1169.989) (-1175.427) (-1170.942) * [-1169.869] (-1171.388) (-1172.163) (-1168.051) -- 0:00:11
Average standard deviation of split frequencies: 0.008180
810500 -- (-1171.156) [-1170.031] (-1174.417) (-1170.834) * (-1171.871) (-1173.891) [-1171.410] (-1170.254) -- 0:00:11
811000 -- (-1168.277) [-1169.517] (-1182.441) (-1178.151) * (-1169.577) (-1172.437) (-1173.299) [-1171.208] -- 0:00:11
811500 -- [-1175.390] (-1169.393) (-1170.528) (-1171.638) * [-1169.018] (-1175.639) (-1169.187) (-1172.308) -- 0:00:11
812000 -- (-1170.577) (-1168.884) [-1170.011] (-1172.025) * (-1170.892) (-1176.727) (-1169.804) [-1169.607] -- 0:00:11
812500 -- (-1177.605) [-1169.244] (-1171.956) (-1173.417) * (-1170.323) (-1172.197) (-1170.378) [-1170.852] -- 0:00:11
813000 -- (-1172.296) (-1172.539) (-1169.434) [-1170.727] * (-1172.069) (-1169.016) (-1170.371) [-1169.301] -- 0:00:11
813500 -- [-1167.623] (-1172.442) (-1169.839) (-1169.053) * (-1170.922) [-1169.155] (-1173.433) (-1168.064) -- 0:00:11
814000 -- (-1169.970) [-1170.270] (-1172.213) (-1168.412) * (-1170.198) (-1170.075) (-1169.626) [-1168.831] -- 0:00:11
814500 -- (-1169.982) (-1169.069) (-1170.046) [-1168.358] * (-1171.339) [-1167.921] (-1169.566) (-1168.227) -- 0:00:11
815000 -- (-1169.928) [-1171.739] (-1170.021) (-1168.485) * [-1172.128] (-1168.880) (-1170.386) (-1170.167) -- 0:00:11
Average standard deviation of split frequencies: 0.008396
815500 -- (-1169.131) (-1171.389) [-1171.641] (-1170.759) * (-1168.698) [-1170.234] (-1171.660) (-1170.214) -- 0:00:11
816000 -- (-1169.130) (-1171.101) [-1168.202] (-1171.092) * (-1168.614) (-1170.955) [-1169.418] (-1169.923) -- 0:00:11
816500 -- (-1169.417) [-1168.126] (-1169.113) (-1170.128) * [-1169.191] (-1169.151) (-1169.595) (-1168.924) -- 0:00:11
817000 -- (-1168.086) (-1168.210) [-1168.629] (-1169.438) * (-1168.266) (-1168.734) [-1167.921] (-1169.197) -- 0:00:11
817500 -- (-1169.253) (-1171.234) (-1168.423) [-1171.442] * [-1168.542] (-1171.353) (-1168.489) (-1172.330) -- 0:00:11
818000 -- [-1171.186] (-1173.543) (-1170.318) (-1173.006) * (-1173.749) (-1170.908) (-1170.356) [-1170.084] -- 0:00:11
818500 -- (-1169.931) (-1173.391) (-1172.393) [-1170.835] * [-1171.213] (-1167.999) (-1171.427) (-1171.296) -- 0:00:11
819000 -- (-1169.469) (-1174.156) [-1169.133] (-1173.437) * [-1170.322] (-1169.760) (-1170.946) (-1170.721) -- 0:00:11
819500 -- [-1170.372] (-1173.602) (-1169.066) (-1170.245) * [-1172.581] (-1172.546) (-1171.167) (-1170.695) -- 0:00:11
820000 -- [-1167.769] (-1174.557) (-1174.734) (-1170.037) * (-1167.913) (-1169.374) [-1173.036] (-1169.917) -- 0:00:11
Average standard deviation of split frequencies: 0.008118
820500 -- [-1167.965] (-1168.293) (-1170.362) (-1171.884) * (-1169.597) [-1170.361] (-1177.481) (-1169.150) -- 0:00:11
821000 -- [-1168.745] (-1172.249) (-1172.247) (-1170.253) * (-1169.002) [-1169.269] (-1173.222) (-1169.112) -- 0:00:11
821500 -- (-1169.600) (-1173.964) [-1167.676] (-1169.140) * (-1168.451) (-1170.548) [-1168.961] (-1168.801) -- 0:00:11
822000 -- (-1168.546) (-1169.789) (-1168.662) [-1174.103] * (-1173.908) [-1169.057] (-1169.640) (-1169.124) -- 0:00:11
822500 -- (-1167.946) [-1167.785] (-1169.495) (-1171.734) * (-1169.894) (-1168.668) [-1169.774] (-1170.927) -- 0:00:11
823000 -- (-1168.222) (-1167.871) [-1170.149] (-1171.529) * (-1167.922) (-1169.679) (-1169.185) [-1169.717] -- 0:00:10
823500 -- (-1176.661) [-1169.783] (-1170.268) (-1171.003) * (-1169.521) [-1168.907] (-1170.585) (-1169.930) -- 0:00:10
824000 -- [-1169.168] (-1171.479) (-1174.321) (-1172.975) * (-1168.554) (-1168.907) (-1170.582) [-1170.358] -- 0:00:10
824500 -- (-1170.194) (-1172.875) (-1168.251) [-1169.038] * [-1168.887] (-1172.324) (-1172.179) (-1172.230) -- 0:00:10
825000 -- (-1169.959) [-1174.211] (-1169.486) (-1171.134) * (-1169.597) (-1170.877) [-1172.861] (-1175.949) -- 0:00:10
Average standard deviation of split frequencies: 0.008218
825500 -- (-1170.191) (-1170.191) [-1170.386] (-1170.908) * (-1171.930) (-1170.609) [-1169.647] (-1168.911) -- 0:00:10
826000 -- (-1169.886) [-1168.859] (-1167.945) (-1171.888) * (-1170.273) (-1168.198) [-1168.927] (-1170.769) -- 0:00:10
826500 -- (-1174.992) [-1170.139] (-1169.693) (-1178.707) * [-1171.539] (-1178.355) (-1170.964) (-1169.363) -- 0:00:10
827000 -- [-1169.458] (-1170.482) (-1168.975) (-1173.383) * [-1170.304] (-1169.543) (-1176.759) (-1172.151) -- 0:00:10
827500 -- [-1171.096] (-1168.533) (-1169.942) (-1169.881) * (-1171.306) (-1170.263) [-1171.542] (-1169.851) -- 0:00:10
828000 -- (-1172.021) (-1171.122) (-1170.485) [-1169.832] * (-1171.259) (-1167.816) [-1170.512] (-1169.893) -- 0:00:10
828500 -- (-1170.067) [-1170.421] (-1171.127) (-1173.635) * (-1169.435) (-1169.300) (-1172.657) [-1169.379] -- 0:00:10
829000 -- (-1171.201) (-1169.068) [-1169.782] (-1174.259) * (-1168.640) (-1168.164) [-1170.295] (-1171.668) -- 0:00:10
829500 -- (-1169.638) (-1169.273) (-1169.596) [-1170.684] * (-1169.673) [-1173.716] (-1171.351) (-1171.270) -- 0:00:10
830000 -- (-1170.195) (-1170.094) [-1169.658] (-1173.546) * (-1170.534) [-1170.936] (-1170.101) (-1168.896) -- 0:00:10
Average standard deviation of split frequencies: 0.008548
830500 -- (-1171.849) (-1167.870) (-1170.361) [-1169.456] * (-1168.545) [-1171.873] (-1169.492) (-1168.849) -- 0:00:10
831000 -- (-1172.198) [-1169.781] (-1170.011) (-1177.197) * (-1169.077) (-1172.166) [-1169.947] (-1168.381) -- 0:00:10
831500 -- (-1168.448) (-1169.666) (-1171.870) [-1171.243] * (-1169.205) (-1169.782) [-1169.945] (-1170.480) -- 0:00:10
832000 -- (-1171.763) (-1169.376) [-1172.412] (-1169.424) * [-1169.117] (-1173.879) (-1174.796) (-1168.943) -- 0:00:10
832500 -- (-1169.334) (-1170.790) (-1169.774) [-1169.655] * [-1170.041] (-1172.560) (-1170.489) (-1169.206) -- 0:00:10
833000 -- [-1172.244] (-1171.645) (-1171.508) (-1172.676) * (-1168.692) (-1176.434) (-1169.104) [-1169.879] -- 0:00:10
833500 -- (-1170.486) [-1169.346] (-1169.118) (-1172.369) * (-1168.305) (-1169.342) [-1168.041] (-1169.314) -- 0:00:10
834000 -- (-1174.832) [-1169.223] (-1170.746) (-1169.538) * (-1171.422) (-1172.476) (-1168.151) [-1170.743] -- 0:00:10
834500 -- [-1171.948] (-1169.787) (-1170.461) (-1171.844) * (-1171.243) (-1169.709) [-1168.623] (-1168.551) -- 0:00:10
835000 -- (-1169.646) [-1169.104] (-1171.649) (-1171.018) * (-1170.163) (-1169.244) [-1173.923] (-1169.124) -- 0:00:10
Average standard deviation of split frequencies: 0.008106
835500 -- (-1169.026) (-1171.423) (-1172.100) [-1174.937] * (-1169.870) [-1170.335] (-1169.191) (-1170.874) -- 0:00:10
836000 -- [-1169.404] (-1168.796) (-1169.351) (-1170.841) * (-1170.296) (-1171.961) (-1170.037) [-1168.650] -- 0:00:10
836500 -- (-1168.928) (-1169.215) [-1174.613] (-1169.397) * (-1171.102) (-1172.145) [-1173.148] (-1175.889) -- 0:00:10
837000 -- (-1170.923) [-1169.030] (-1169.538) (-1173.731) * [-1168.434] (-1169.518) (-1168.739) (-1170.674) -- 0:00:10
837500 -- (-1171.829) (-1169.066) (-1170.108) [-1170.850] * (-1170.574) [-1172.364] (-1169.666) (-1171.698) -- 0:00:10
838000 -- (-1174.877) (-1170.310) [-1169.642] (-1168.296) * [-1169.538] (-1174.980) (-1170.333) (-1174.520) -- 0:00:10
838500 -- [-1169.212] (-1168.080) (-1174.849) (-1170.407) * [-1169.076] (-1177.289) (-1168.592) (-1171.813) -- 0:00:10
839000 -- (-1168.534) (-1170.670) [-1170.951] (-1169.292) * (-1169.400) (-1171.384) (-1167.953) [-1173.836] -- 0:00:09
839500 -- [-1168.932] (-1176.548) (-1172.474) (-1170.009) * [-1172.932] (-1169.220) (-1167.921) (-1172.652) -- 0:00:09
840000 -- (-1168.483) (-1169.102) [-1171.222] (-1169.970) * (-1168.999) (-1171.148) (-1169.237) [-1171.917] -- 0:00:09
Average standard deviation of split frequencies: 0.008299
840500 -- (-1170.032) (-1172.277) (-1170.738) [-1170.186] * (-1168.900) (-1168.838) [-1168.643] (-1171.796) -- 0:00:09
841000 -- [-1169.390] (-1172.730) (-1170.312) (-1170.689) * [-1174.008] (-1169.992) (-1171.412) (-1170.206) -- 0:00:09
841500 -- (-1168.867) [-1170.345] (-1176.430) (-1173.831) * [-1172.786] (-1170.378) (-1170.010) (-1171.407) -- 0:00:09
842000 -- [-1168.219] (-1172.900) (-1171.616) (-1168.881) * (-1169.239) (-1177.530) (-1168.343) [-1174.418] -- 0:00:09
842500 -- (-1168.481) [-1171.278] (-1169.206) (-1169.933) * [-1168.160] (-1171.130) (-1171.083) (-1168.692) -- 0:00:09
843000 -- (-1169.857) (-1169.035) (-1169.238) [-1168.805] * (-1169.422) (-1169.941) (-1170.328) [-1168.424] -- 0:00:09
843500 -- (-1170.674) (-1170.628) (-1171.296) [-1169.053] * (-1176.259) (-1169.205) [-1172.372] (-1168.142) -- 0:00:09
844000 -- [-1170.050] (-1168.567) (-1175.138) (-1169.857) * (-1168.396) (-1171.070) [-1174.602] (-1171.852) -- 0:00:09
844500 -- (-1170.910) [-1168.562] (-1175.576) (-1172.272) * (-1169.978) (-1171.775) (-1169.359) [-1168.382] -- 0:00:09
845000 -- [-1171.387] (-1172.441) (-1171.748) (-1172.291) * (-1171.062) (-1170.050) (-1168.963) [-1169.833] -- 0:00:09
Average standard deviation of split frequencies: 0.008135
845500 -- (-1169.736) (-1172.821) [-1171.946] (-1169.175) * [-1172.050] (-1170.929) (-1168.457) (-1169.026) -- 0:00:09
846000 -- (-1169.159) [-1171.566] (-1171.152) (-1170.050) * [-1168.655] (-1168.188) (-1172.635) (-1168.357) -- 0:00:09
846500 -- [-1169.129] (-1173.409) (-1168.283) (-1169.190) * (-1168.511) (-1169.525) [-1170.220] (-1169.479) -- 0:00:09
847000 -- (-1171.945) [-1168.894] (-1168.325) (-1168.710) * [-1168.398] (-1170.210) (-1171.634) (-1172.054) -- 0:00:09
847500 -- (-1169.871) [-1168.569] (-1169.009) (-1168.926) * (-1169.081) [-1169.645] (-1169.365) (-1172.690) -- 0:00:09
848000 -- (-1167.902) (-1168.548) (-1175.773) [-1169.077] * [-1171.362] (-1169.574) (-1171.727) (-1170.742) -- 0:00:09
848500 -- (-1170.365) (-1168.676) (-1172.003) [-1168.493] * (-1170.538) (-1172.307) [-1170.000] (-1170.495) -- 0:00:09
849000 -- [-1168.828] (-1168.866) (-1169.761) (-1170.413) * (-1169.574) [-1168.093] (-1172.373) (-1170.876) -- 0:00:09
849500 -- [-1169.006] (-1170.507) (-1170.942) (-1172.588) * [-1170.626] (-1171.927) (-1168.503) (-1169.505) -- 0:00:09
850000 -- (-1171.590) (-1168.886) [-1168.226] (-1171.247) * [-1170.902] (-1169.007) (-1169.014) (-1171.981) -- 0:00:09
Average standard deviation of split frequencies: 0.008382
850500 -- (-1168.823) [-1170.682] (-1170.640) (-1172.254) * (-1169.871) (-1169.878) (-1170.718) [-1171.294] -- 0:00:09
851000 -- (-1169.502) (-1169.264) (-1171.050) [-1170.011] * (-1169.231) (-1170.956) (-1169.148) [-1170.759] -- 0:00:09
851500 -- [-1170.106] (-1169.169) (-1170.400) (-1169.632) * (-1172.077) (-1169.363) [-1172.868] (-1172.764) -- 0:00:09
852000 -- (-1170.484) (-1168.774) (-1170.445) [-1169.724] * (-1173.412) (-1168.694) [-1174.002] (-1170.098) -- 0:00:09
852500 -- (-1171.169) [-1170.057] (-1170.617) (-1169.888) * (-1169.119) (-1170.533) (-1169.117) [-1169.433] -- 0:00:09
853000 -- (-1168.994) (-1168.239) [-1169.738] (-1169.522) * (-1171.628) (-1171.316) [-1172.977] (-1169.393) -- 0:00:09
853500 -- (-1168.533) (-1171.689) [-1169.970] (-1168.340) * [-1174.901] (-1171.078) (-1170.032) (-1170.250) -- 0:00:09
854000 -- (-1173.418) (-1171.746) [-1169.361] (-1168.983) * (-1168.827) [-1168.758] (-1168.535) (-1170.059) -- 0:00:09
854500 -- [-1168.045] (-1169.553) (-1170.079) (-1168.619) * [-1170.600] (-1170.540) (-1171.593) (-1168.296) -- 0:00:09
855000 -- (-1171.049) [-1169.998] (-1168.611) (-1169.583) * (-1169.522) [-1171.121] (-1170.672) (-1168.228) -- 0:00:08
Average standard deviation of split frequencies: 0.008674
855500 -- (-1169.017) (-1171.094) (-1168.953) [-1168.853] * [-1171.052] (-1169.585) (-1172.147) (-1169.584) -- 0:00:08
856000 -- (-1168.936) [-1169.843] (-1168.908) (-1170.028) * (-1169.155) (-1172.575) (-1170.526) [-1169.388] -- 0:00:08
856500 -- (-1171.866) (-1171.715) (-1168.449) [-1171.704] * (-1169.872) (-1174.624) [-1170.270] (-1168.631) -- 0:00:08
857000 -- [-1171.784] (-1169.792) (-1172.632) (-1169.941) * [-1169.868] (-1170.490) (-1170.970) (-1168.969) -- 0:00:08
857500 -- (-1168.869) (-1168.670) [-1170.910] (-1169.845) * (-1169.149) (-1172.306) [-1167.905] (-1168.576) -- 0:00:08
858000 -- (-1169.664) (-1168.537) (-1170.887) [-1169.627] * (-1168.999) (-1169.040) (-1171.407) [-1168.303] -- 0:00:08
858500 -- (-1167.970) (-1168.487) (-1168.463) [-1170.181] * (-1168.784) (-1170.373) (-1173.291) [-1172.709] -- 0:00:08
859000 -- [-1169.623] (-1168.740) (-1168.817) (-1170.120) * (-1171.826) (-1169.884) [-1170.747] (-1170.256) -- 0:00:08
859500 -- (-1170.740) (-1169.967) [-1167.964] (-1169.307) * (-1172.940) (-1168.134) [-1170.720] (-1171.522) -- 0:00:08
860000 -- (-1170.260) (-1170.258) (-1168.407) [-1170.026] * (-1172.263) [-1168.419] (-1169.753) (-1172.340) -- 0:00:08
Average standard deviation of split frequencies: 0.008319
860500 -- (-1172.726) (-1168.417) [-1170.154] (-1170.623) * (-1169.498) (-1170.185) (-1169.418) [-1169.891] -- 0:00:08
861000 -- (-1171.655) [-1169.735] (-1170.669) (-1167.896) * (-1169.497) (-1174.664) (-1170.939) [-1169.585] -- 0:00:08
861500 -- (-1168.884) (-1172.167) (-1173.137) [-1168.638] * (-1169.592) (-1175.104) [-1177.785] (-1169.163) -- 0:00:08
862000 -- (-1168.694) (-1170.347) (-1172.042) [-1167.827] * (-1174.749) [-1169.018] (-1173.028) (-1169.315) -- 0:00:08
862500 -- (-1170.012) (-1168.280) [-1169.523] (-1170.395) * (-1172.864) [-1169.467] (-1169.440) (-1172.926) -- 0:00:08
863000 -- (-1171.291) (-1169.548) (-1169.851) [-1171.189] * [-1168.021] (-1173.801) (-1172.730) (-1171.380) -- 0:00:08
863500 -- (-1172.462) [-1169.462] (-1170.231) (-1170.565) * (-1170.058) (-1173.206) [-1170.870] (-1168.829) -- 0:00:08
864000 -- (-1171.546) (-1172.729) [-1169.175] (-1171.568) * [-1170.539] (-1171.586) (-1169.905) (-1168.646) -- 0:00:08
864500 -- (-1169.375) (-1172.317) (-1170.623) [-1169.530] * [-1172.295] (-1169.587) (-1172.675) (-1171.428) -- 0:00:08
865000 -- [-1168.757] (-1170.844) (-1170.723) (-1170.930) * [-1169.867] (-1168.318) (-1173.819) (-1168.705) -- 0:00:08
Average standard deviation of split frequencies: 0.009414
865500 -- [-1168.976] (-1170.801) (-1167.919) (-1171.034) * (-1170.347) (-1169.292) (-1170.400) [-1168.322] -- 0:00:08
866000 -- [-1170.285] (-1173.268) (-1168.609) (-1173.113) * (-1173.273) (-1168.214) (-1173.579) [-1171.112] -- 0:00:08
866500 -- (-1172.496) (-1169.060) [-1168.265] (-1169.072) * (-1168.381) (-1171.620) (-1168.508) [-1170.812] -- 0:00:08
867000 -- (-1174.468) [-1168.892] (-1168.470) (-1174.293) * (-1168.272) (-1170.677) [-1168.728] (-1169.014) -- 0:00:08
867500 -- [-1169.231] (-1169.214) (-1168.831) (-1170.669) * (-1168.787) (-1168.886) [-1170.022] (-1170.438) -- 0:00:08
868000 -- (-1169.702) (-1169.554) [-1168.789] (-1168.859) * (-1169.415) [-1169.654] (-1168.732) (-1172.030) -- 0:00:08
868500 -- (-1175.257) (-1168.621) [-1169.298] (-1168.935) * [-1169.766] (-1171.682) (-1168.218) (-1170.926) -- 0:00:08
869000 -- [-1168.282] (-1170.243) (-1171.176) (-1168.767) * (-1172.647) (-1171.589) [-1169.406] (-1169.552) -- 0:00:08
869500 -- (-1172.268) (-1168.359) [-1173.555] (-1171.921) * (-1168.254) (-1173.371) [-1170.399] (-1169.691) -- 0:00:08
870000 -- (-1169.211) (-1170.015) [-1168.818] (-1173.228) * (-1168.459) (-1170.906) (-1169.771) [-1169.186] -- 0:00:08
Average standard deviation of split frequencies: 0.009778
870500 -- (-1169.133) (-1168.989) (-1171.195) [-1170.816] * (-1169.668) (-1168.134) [-1170.776] (-1171.163) -- 0:00:08
871000 -- (-1168.519) (-1173.727) [-1169.743] (-1171.494) * (-1169.223) (-1171.604) [-1170.793] (-1169.861) -- 0:00:07
871500 -- (-1169.291) (-1174.430) (-1168.403) [-1169.583] * (-1172.142) [-1169.610] (-1171.881) (-1169.414) -- 0:00:07
872000 -- (-1172.371) (-1170.666) (-1169.689) [-1171.367] * (-1171.066) (-1172.056) (-1168.308) [-1173.146] -- 0:00:07
872500 -- (-1168.503) (-1171.043) [-1171.938] (-1169.438) * (-1170.655) (-1169.471) [-1169.180] (-1168.727) -- 0:00:07
873000 -- (-1172.556) (-1168.833) [-1168.888] (-1170.101) * (-1169.566) (-1169.255) [-1175.546] (-1170.279) -- 0:00:07
873500 -- [-1170.912] (-1169.434) (-1170.907) (-1173.285) * (-1170.127) (-1170.747) [-1171.110] (-1177.637) -- 0:00:07
874000 -- [-1170.981] (-1169.094) (-1171.782) (-1168.579) * (-1169.405) (-1169.043) [-1172.078] (-1171.820) -- 0:00:07
874500 -- (-1171.453) [-1169.621] (-1169.482) (-1172.152) * [-1169.285] (-1169.536) (-1174.366) (-1175.807) -- 0:00:07
875000 -- (-1172.102) [-1175.717] (-1169.955) (-1170.869) * (-1170.861) (-1170.865) [-1169.261] (-1169.853) -- 0:00:07
Average standard deviation of split frequencies: 0.009148
875500 -- [-1169.142] (-1170.053) (-1171.434) (-1168.813) * (-1171.638) [-1169.218] (-1168.677) (-1169.246) -- 0:00:07
876000 -- (-1168.234) [-1169.853] (-1172.080) (-1173.221) * (-1170.497) [-1168.582] (-1167.592) (-1173.992) -- 0:00:07
876500 -- [-1169.193] (-1171.492) (-1169.314) (-1171.141) * (-1169.393) (-1169.998) [-1168.212] (-1169.162) -- 0:00:07
877000 -- (-1170.170) (-1169.478) [-1170.678] (-1169.022) * (-1172.281) (-1170.750) (-1171.673) [-1169.550] -- 0:00:07
877500 -- [-1169.374] (-1176.798) (-1170.887) (-1169.619) * (-1169.238) (-1170.835) [-1170.073] (-1168.656) -- 0:00:07
878000 -- [-1170.212] (-1170.395) (-1168.382) (-1171.944) * (-1168.586) (-1172.828) (-1171.349) [-1170.527] -- 0:00:07
878500 -- [-1170.645] (-1168.263) (-1168.895) (-1168.858) * [-1169.572] (-1173.243) (-1172.405) (-1171.195) -- 0:00:07
879000 -- (-1169.808) (-1170.421) (-1173.742) [-1170.049] * [-1170.039] (-1172.415) (-1169.772) (-1169.369) -- 0:00:07
879500 -- (-1170.212) (-1168.616) [-1169.814] (-1173.056) * [-1168.778] (-1169.242) (-1169.625) (-1169.945) -- 0:00:07
880000 -- (-1169.322) (-1168.044) [-1169.003] (-1169.526) * (-1169.163) [-1169.854] (-1169.397) (-1171.145) -- 0:00:07
Average standard deviation of split frequencies: 0.009066
880500 -- (-1167.920) [-1168.532] (-1169.516) (-1170.437) * (-1172.166) (-1172.826) (-1170.359) [-1172.084] -- 0:00:07
881000 -- [-1169.880] (-1171.774) (-1168.024) (-1171.676) * (-1170.241) (-1171.162) [-1168.952] (-1170.328) -- 0:00:07
881500 -- (-1168.998) (-1170.300) [-1170.310] (-1171.285) * (-1169.936) (-1176.655) (-1175.257) [-1167.729] -- 0:00:07
882000 -- [-1170.405] (-1169.951) (-1168.021) (-1170.096) * [-1171.516] (-1174.467) (-1171.563) (-1168.463) -- 0:00:07
882500 -- (-1169.572) (-1169.862) (-1169.833) [-1168.427] * (-1170.232) (-1168.631) (-1170.014) [-1171.289] -- 0:00:07
883000 -- [-1173.905] (-1171.628) (-1171.546) (-1168.583) * (-1169.099) [-1169.456] (-1168.476) (-1170.329) -- 0:00:07
883500 -- [-1171.981] (-1170.117) (-1172.183) (-1169.033) * (-1168.000) (-1169.262) (-1169.542) [-1171.108] -- 0:00:07
884000 -- (-1170.506) (-1171.835) [-1171.051] (-1168.724) * (-1169.896) [-1169.497] (-1172.206) (-1169.515) -- 0:00:07
884500 -- (-1172.612) (-1174.828) [-1170.420] (-1169.521) * (-1170.455) (-1168.375) [-1169.268] (-1168.875) -- 0:00:07
885000 -- [-1176.483] (-1170.534) (-1168.906) (-1171.683) * (-1167.762) (-1168.416) (-1169.518) [-1171.071] -- 0:00:07
Average standard deviation of split frequencies: 0.009211
885500 -- (-1171.568) [-1167.967] (-1169.556) (-1170.716) * (-1168.108) (-1171.732) [-1171.795] (-1169.180) -- 0:00:07
886000 -- (-1167.738) (-1168.974) (-1171.070) [-1170.998] * (-1168.105) (-1168.025) (-1176.891) [-1168.661] -- 0:00:07
886500 -- (-1167.953) [-1170.134] (-1170.503) (-1169.173) * [-1168.340] (-1169.660) (-1171.446) (-1177.418) -- 0:00:07
887000 -- (-1168.742) (-1169.051) (-1171.827) [-1170.852] * (-1168.417) (-1169.699) [-1170.748] (-1171.551) -- 0:00:07
887500 -- (-1168.494) (-1170.203) (-1171.863) [-1170.472] * (-1170.753) (-1169.989) [-1168.775] (-1172.938) -- 0:00:06
888000 -- (-1170.053) (-1171.473) [-1168.251] (-1171.756) * [-1169.423] (-1169.558) (-1174.155) (-1170.779) -- 0:00:06
888500 -- (-1169.257) (-1171.744) (-1170.820) [-1171.515] * (-1170.316) [-1170.134] (-1170.735) (-1170.112) -- 0:00:06
889000 -- (-1172.078) (-1173.667) [-1168.678] (-1169.684) * (-1171.720) (-1170.571) (-1169.068) [-1169.036] -- 0:00:06
889500 -- (-1170.594) (-1171.065) (-1171.388) [-1170.054] * (-1171.843) (-1170.901) (-1171.125) [-1168.957] -- 0:00:06
890000 -- (-1169.015) [-1169.331] (-1170.513) (-1170.725) * [-1169.487] (-1168.807) (-1170.491) (-1170.904) -- 0:00:06
Average standard deviation of split frequencies: 0.009361
890500 -- (-1169.172) (-1172.484) [-1167.765] (-1169.954) * (-1170.891) (-1170.374) (-1171.207) [-1169.963] -- 0:00:06
891000 -- (-1169.010) (-1169.019) [-1172.530] (-1170.911) * (-1171.676) [-1173.237] (-1168.554) (-1169.242) -- 0:00:06
891500 -- (-1169.710) (-1172.489) [-1170.139] (-1170.436) * (-1169.897) (-1168.900) (-1169.329) [-1168.907] -- 0:00:06
892000 -- (-1171.236) (-1170.758) [-1171.951] (-1170.994) * [-1169.321] (-1171.914) (-1170.358) (-1169.289) -- 0:00:06
892500 -- (-1171.723) (-1169.725) (-1171.647) [-1169.264] * (-1173.546) (-1167.935) [-1171.675] (-1168.878) -- 0:00:06
893000 -- (-1171.926) [-1171.742] (-1173.711) (-1168.671) * (-1170.015) (-1169.171) (-1169.808) [-1168.554] -- 0:00:06
893500 -- (-1170.149) (-1177.156) [-1173.069] (-1168.792) * (-1171.456) (-1168.371) (-1174.177) [-1171.089] -- 0:00:06
894000 -- (-1172.433) (-1170.465) [-1170.568] (-1169.669) * (-1170.488) (-1169.096) [-1172.949] (-1180.479) -- 0:00:06
894500 -- (-1171.154) (-1168.455) (-1170.802) [-1168.756] * (-1168.894) [-1170.603] (-1170.368) (-1170.643) -- 0:00:06
895000 -- (-1169.667) (-1171.068) (-1172.379) [-1168.350] * (-1168.758) [-1170.215] (-1169.771) (-1171.328) -- 0:00:06
Average standard deviation of split frequencies: 0.008699
895500 -- (-1169.722) (-1169.692) (-1170.139) [-1169.350] * (-1169.343) [-1171.634] (-1169.159) (-1170.224) -- 0:00:06
896000 -- (-1168.524) [-1171.431] (-1170.487) (-1169.468) * [-1170.127] (-1169.080) (-1167.990) (-1170.908) -- 0:00:06
896500 -- [-1172.505] (-1170.657) (-1172.507) (-1173.008) * (-1168.926) (-1170.440) (-1168.428) [-1172.775] -- 0:00:06
897000 -- (-1171.793) (-1169.950) [-1168.081] (-1169.136) * (-1168.339) (-1171.950) [-1168.825] (-1172.220) -- 0:00:06
897500 -- [-1170.994] (-1169.181) (-1170.929) (-1169.631) * [-1168.284] (-1169.497) (-1168.785) (-1169.023) -- 0:00:06
898000 -- (-1170.207) [-1170.947] (-1169.101) (-1169.530) * (-1169.612) (-1170.101) (-1168.898) [-1170.353] -- 0:00:06
898500 -- (-1171.742) [-1169.653] (-1170.643) (-1170.543) * (-1171.921) (-1168.000) [-1168.385] (-1173.378) -- 0:00:06
899000 -- (-1170.717) (-1170.042) [-1168.914] (-1168.752) * (-1170.010) (-1170.565) [-1170.862] (-1169.266) -- 0:00:06
899500 -- [-1168.585] (-1171.990) (-1170.534) (-1171.053) * [-1171.078] (-1173.628) (-1175.418) (-1170.008) -- 0:00:06
900000 -- (-1169.255) [-1169.219] (-1169.324) (-1173.552) * (-1174.486) (-1168.019) [-1170.626] (-1174.492) -- 0:00:06
Average standard deviation of split frequencies: 0.008933
900500 -- (-1171.350) (-1169.571) [-1168.844] (-1170.444) * (-1169.482) [-1168.652] (-1169.281) (-1168.685) -- 0:00:06
901000 -- (-1173.228) [-1168.315] (-1174.083) (-1169.822) * (-1168.939) (-1169.224) [-1173.153] (-1171.255) -- 0:00:06
901500 -- (-1171.693) (-1170.262) (-1172.572) [-1173.398] * [-1170.787] (-1169.970) (-1171.778) (-1174.085) -- 0:00:06
902000 -- (-1170.723) (-1169.137) [-1171.551] (-1170.954) * (-1173.174) [-1171.539] (-1170.642) (-1169.793) -- 0:00:06
902500 -- [-1171.169] (-1169.379) (-1169.389) (-1170.101) * (-1169.138) (-1170.315) [-1168.043] (-1172.041) -- 0:00:06
903000 -- (-1170.457) (-1170.142) (-1171.113) [-1168.020] * (-1172.926) [-1168.514] (-1172.989) (-1171.182) -- 0:00:06
903500 -- (-1169.287) [-1168.193] (-1171.379) (-1170.604) * (-1168.660) [-1168.509] (-1170.508) (-1170.508) -- 0:00:05
904000 -- (-1169.848) (-1173.215) [-1169.036] (-1169.029) * (-1171.215) (-1171.196) [-1171.500] (-1170.802) -- 0:00:05
904500 -- (-1168.433) [-1172.799] (-1168.973) (-1168.322) * [-1168.793] (-1175.178) (-1173.879) (-1172.680) -- 0:00:05
905000 -- [-1169.277] (-1170.989) (-1169.037) (-1168.282) * [-1169.956] (-1170.571) (-1176.396) (-1173.187) -- 0:00:05
Average standard deviation of split frequencies: 0.009053
905500 -- (-1169.949) (-1169.637) [-1169.337] (-1168.722) * (-1172.952) (-1173.741) (-1174.604) [-1168.894] -- 0:00:05
906000 -- (-1168.927) (-1173.166) (-1169.180) [-1169.258] * (-1170.428) (-1170.773) [-1173.901] (-1168.910) -- 0:00:05
906500 -- [-1169.484] (-1172.905) (-1168.777) (-1171.301) * (-1170.521) (-1171.761) (-1172.433) [-1169.960] -- 0:00:05
907000 -- [-1168.834] (-1168.299) (-1169.684) (-1169.355) * (-1170.323) (-1172.931) [-1171.461] (-1174.844) -- 0:00:05
907500 -- [-1171.332] (-1172.885) (-1169.153) (-1168.801) * (-1170.712) [-1169.582] (-1170.755) (-1174.555) -- 0:00:05
908000 -- (-1168.566) [-1168.393] (-1170.662) (-1171.565) * [-1168.946] (-1171.420) (-1170.192) (-1168.241) -- 0:00:05
908500 -- (-1170.500) (-1169.998) (-1169.546) [-1173.238] * [-1170.240] (-1171.144) (-1169.026) (-1168.198) -- 0:00:05
909000 -- (-1168.780) [-1168.647] (-1169.450) (-1169.967) * (-1168.682) (-1170.379) [-1169.146] (-1169.991) -- 0:00:05
909500 -- (-1170.908) [-1171.515] (-1168.015) (-1170.816) * (-1169.314) [-1168.519] (-1171.331) (-1170.901) -- 0:00:05
910000 -- [-1170.951] (-1173.967) (-1169.042) (-1170.402) * [-1170.564] (-1170.910) (-1170.287) (-1168.745) -- 0:00:05
Average standard deviation of split frequencies: 0.009042
910500 -- (-1169.105) (-1174.665) (-1169.510) [-1172.720] * (-1170.412) (-1171.079) (-1170.088) [-1168.559] -- 0:00:05
911000 -- (-1169.104) [-1170.065] (-1170.850) (-1169.934) * (-1170.477) (-1171.273) (-1172.614) [-1168.543] -- 0:00:05
911500 -- [-1169.609] (-1168.886) (-1169.793) (-1169.097) * (-1170.344) [-1171.875] (-1170.104) (-1169.500) -- 0:00:05
912000 -- (-1168.524) (-1170.839) [-1172.085] (-1168.839) * (-1172.254) (-1172.329) [-1169.477] (-1171.298) -- 0:00:05
912500 -- [-1168.411] (-1173.235) (-1170.349) (-1169.551) * (-1171.150) [-1170.425] (-1172.401) (-1173.940) -- 0:00:05
913000 -- [-1168.406] (-1172.856) (-1169.673) (-1170.658) * (-1168.680) [-1173.263] (-1169.571) (-1175.599) -- 0:00:05
913500 -- (-1169.182) (-1170.725) (-1169.142) [-1170.421] * (-1168.812) (-1170.317) (-1169.890) [-1170.299] -- 0:00:05
914000 -- (-1168.108) (-1170.393) [-1168.927] (-1171.004) * (-1171.056) (-1176.806) (-1171.910) [-1172.977] -- 0:00:05
914500 -- (-1168.902) (-1170.506) (-1167.863) [-1171.627] * (-1169.493) (-1170.920) [-1168.022] (-1171.326) -- 0:00:05
915000 -- [-1170.260] (-1169.874) (-1168.995) (-1171.410) * (-1172.564) (-1170.123) [-1171.677] (-1176.058) -- 0:00:05
Average standard deviation of split frequencies: 0.009263
915500 -- (-1172.410) [-1173.396] (-1173.069) (-1171.742) * [-1169.794] (-1168.654) (-1168.886) (-1172.479) -- 0:00:05
916000 -- (-1168.331) [-1171.968] (-1174.021) (-1170.541) * [-1169.663] (-1169.284) (-1168.489) (-1168.897) -- 0:00:05
916500 -- (-1168.201) (-1170.797) (-1168.611) [-1169.070] * [-1170.428] (-1169.994) (-1171.597) (-1167.940) -- 0:00:05
917000 -- [-1168.686] (-1171.127) (-1169.580) (-1170.362) * (-1168.886) (-1169.872) (-1171.363) [-1168.350] -- 0:00:05
917500 -- (-1169.548) [-1170.870] (-1170.323) (-1168.715) * (-1176.208) (-1169.466) [-1168.537] (-1171.225) -- 0:00:05
918000 -- (-1169.100) (-1170.287) [-1169.349] (-1169.217) * (-1169.077) (-1168.329) [-1169.531] (-1169.931) -- 0:00:05
918500 -- [-1171.920] (-1174.420) (-1170.367) (-1171.248) * (-1170.808) (-1169.147) (-1174.751) [-1170.260] -- 0:00:05
919000 -- [-1170.277] (-1174.039) (-1171.612) (-1168.836) * [-1168.136] (-1172.739) (-1171.080) (-1171.030) -- 0:00:05
919500 -- (-1170.518) (-1173.427) (-1171.327) [-1168.390] * (-1170.150) (-1169.915) (-1168.609) [-1168.441] -- 0:00:04
920000 -- (-1173.093) (-1168.907) (-1175.442) [-1169.900] * (-1171.916) (-1178.606) [-1168.179] (-1171.522) -- 0:00:04
Average standard deviation of split frequencies: 0.008875
920500 -- (-1169.899) [-1170.481] (-1173.598) (-1169.015) * (-1169.315) [-1172.336] (-1169.761) (-1168.923) -- 0:00:04
921000 -- (-1173.095) (-1171.730) [-1171.115] (-1169.399) * [-1168.071] (-1172.625) (-1170.391) (-1168.896) -- 0:00:04
921500 -- (-1172.623) [-1171.936] (-1168.791) (-1169.213) * (-1167.860) (-1170.669) (-1169.024) [-1168.458] -- 0:00:04
922000 -- (-1168.761) (-1171.462) (-1168.760) [-1169.858] * (-1167.874) (-1168.767) (-1169.898) [-1168.515] -- 0:00:04
922500 -- (-1170.519) [-1168.838] (-1167.843) (-1172.042) * [-1169.205] (-1168.626) (-1169.913) (-1168.440) -- 0:00:04
923000 -- (-1169.157) (-1169.078) (-1168.319) [-1172.379] * (-1169.267) (-1168.890) [-1168.838] (-1167.985) -- 0:00:04
923500 -- (-1170.440) (-1172.430) [-1171.559] (-1170.255) * [-1168.859] (-1170.756) (-1174.145) (-1170.943) -- 0:00:04
924000 -- (-1169.467) (-1174.324) [-1171.089] (-1172.062) * (-1169.243) [-1170.110] (-1171.676) (-1170.756) -- 0:00:04
924500 -- (-1170.525) (-1172.401) [-1169.098] (-1170.193) * (-1168.875) [-1169.485] (-1169.362) (-1170.514) -- 0:00:04
925000 -- (-1171.997) (-1171.938) (-1171.646) [-1168.296] * (-1171.447) (-1169.713) [-1170.765] (-1171.578) -- 0:00:04
Average standard deviation of split frequencies: 0.008485
925500 -- [-1171.775] (-1171.651) (-1175.057) (-1168.014) * [-1170.140] (-1169.755) (-1170.893) (-1169.924) -- 0:00:04
926000 -- (-1171.097) (-1170.808) [-1172.363] (-1168.342) * (-1170.969) (-1170.439) (-1171.432) [-1170.141] -- 0:00:04
926500 -- (-1173.703) (-1174.422) [-1168.722] (-1175.573) * (-1169.978) (-1169.723) [-1168.680] (-1169.417) -- 0:00:04
927000 -- (-1169.601) (-1172.535) (-1169.068) [-1169.261] * [-1168.651] (-1168.644) (-1168.731) (-1172.839) -- 0:00:04
927500 -- [-1168.095] (-1170.392) (-1169.272) (-1169.558) * (-1170.052) (-1171.159) [-1168.731] (-1173.912) -- 0:00:04
928000 -- (-1172.615) (-1169.491) (-1168.337) [-1169.810] * (-1169.910) (-1168.584) [-1169.875] (-1168.974) -- 0:00:04
928500 -- (-1173.119) (-1169.389) (-1172.084) [-1170.631] * (-1174.606) (-1169.040) (-1169.819) [-1169.022] -- 0:00:04
929000 -- (-1169.341) (-1169.238) (-1171.534) [-1170.082] * (-1170.832) (-1170.341) (-1170.790) [-1170.784] -- 0:00:04
929500 -- (-1168.304) (-1170.312) [-1172.201] (-1173.701) * (-1170.572) (-1169.957) [-1169.806] (-1169.232) -- 0:00:04
930000 -- (-1169.983) (-1171.878) (-1169.984) [-1172.807] * (-1170.417) (-1167.899) [-1170.379] (-1168.965) -- 0:00:04
Average standard deviation of split frequencies: 0.008577
930500 -- (-1170.432) [-1169.099] (-1170.653) (-1169.556) * (-1172.260) (-1168.503) [-1169.104] (-1170.427) -- 0:00:04
931000 -- [-1167.795] (-1168.038) (-1169.566) (-1174.519) * (-1169.535) [-1167.943] (-1170.283) (-1170.610) -- 0:00:04
931500 -- (-1172.841) (-1168.161) (-1171.066) [-1173.553] * [-1169.531] (-1170.948) (-1168.006) (-1167.957) -- 0:00:04
932000 -- (-1169.695) (-1169.181) [-1168.825] (-1169.596) * [-1171.291] (-1168.265) (-1169.386) (-1167.717) -- 0:00:04
932500 -- (-1170.981) (-1169.299) [-1169.475] (-1167.907) * (-1172.145) [-1173.397] (-1168.556) (-1167.717) -- 0:00:04
933000 -- (-1170.650) (-1170.107) [-1170.419] (-1170.290) * [-1168.579] (-1169.067) (-1173.607) (-1171.118) -- 0:00:04
933500 -- (-1170.470) (-1170.307) [-1169.233] (-1170.487) * (-1167.968) [-1169.115] (-1176.176) (-1168.823) -- 0:00:04
934000 -- (-1168.753) [-1173.599] (-1169.238) (-1171.358) * (-1169.343) (-1171.074) (-1170.022) [-1169.983] -- 0:00:04
934500 -- [-1171.206] (-1172.855) (-1170.243) (-1170.657) * (-1171.416) (-1173.657) (-1169.716) [-1171.432] -- 0:00:04
935000 -- [-1170.183] (-1171.326) (-1168.218) (-1171.576) * (-1170.147) (-1173.615) (-1169.461) [-1170.702] -- 0:00:04
Average standard deviation of split frequencies: 0.009254
935500 -- (-1174.754) (-1171.258) (-1170.472) [-1168.509] * (-1170.087) [-1170.209] (-1172.117) (-1172.070) -- 0:00:03
936000 -- (-1168.808) (-1170.743) (-1168.126) [-1168.507] * (-1168.946) (-1171.296) (-1171.372) [-1170.712] -- 0:00:03
936500 -- (-1168.709) [-1173.218] (-1169.732) (-1168.925) * (-1168.639) (-1169.447) (-1170.657) [-1170.314] -- 0:00:03
937000 -- (-1172.960) (-1172.476) (-1172.515) [-1169.902] * (-1170.011) (-1169.132) (-1173.244) [-1168.923] -- 0:00:03
937500 -- [-1167.925] (-1171.704) (-1169.818) (-1169.888) * (-1169.542) (-1171.033) (-1173.121) [-1168.018] -- 0:00:03
938000 -- [-1168.105] (-1170.095) (-1172.507) (-1171.251) * (-1170.457) (-1172.064) (-1176.947) [-1167.969] -- 0:00:03
938500 -- [-1168.731] (-1168.385) (-1169.862) (-1169.738) * (-1170.086) (-1172.004) (-1171.061) [-1169.526] -- 0:00:03
939000 -- (-1170.292) (-1169.000) (-1169.008) [-1169.588] * (-1171.640) [-1168.967] (-1169.412) (-1170.995) -- 0:00:03
939500 -- (-1168.850) (-1169.927) (-1171.621) [-1169.648] * [-1170.248] (-1171.790) (-1170.669) (-1170.023) -- 0:00:03
940000 -- (-1173.111) (-1168.791) [-1169.331] (-1169.092) * [-1169.111] (-1169.920) (-1170.448) (-1169.467) -- 0:00:03
Average standard deviation of split frequencies: 0.009428
940500 -- [-1169.777] (-1168.309) (-1171.722) (-1172.114) * (-1169.274) [-1170.068] (-1172.172) (-1172.913) -- 0:00:03
941000 -- (-1169.636) [-1169.029] (-1173.098) (-1171.578) * [-1170.242] (-1173.562) (-1172.496) (-1168.829) -- 0:00:03
941500 -- [-1168.410] (-1172.339) (-1172.862) (-1172.288) * (-1169.546) (-1168.836) [-1169.463] (-1169.814) -- 0:00:03
942000 -- [-1169.419] (-1171.426) (-1178.774) (-1169.878) * (-1168.251) (-1169.555) (-1171.502) [-1169.468] -- 0:00:03
942500 -- (-1169.350) (-1170.995) (-1169.632) [-1171.602] * [-1170.850] (-1174.723) (-1174.421) (-1179.532) -- 0:00:03
943000 -- (-1172.326) (-1170.065) (-1170.888) [-1168.387] * (-1172.699) (-1169.962) [-1173.369] (-1173.763) -- 0:00:03
943500 -- (-1168.648) [-1169.105] (-1171.499) (-1171.013) * [-1170.061] (-1172.534) (-1168.184) (-1170.890) -- 0:00:03
944000 -- [-1168.726] (-1170.402) (-1169.885) (-1171.127) * (-1168.957) (-1170.136) [-1169.993] (-1168.982) -- 0:00:03
944500 -- (-1168.823) [-1171.644] (-1172.140) (-1169.926) * (-1168.602) [-1168.016] (-1168.687) (-1167.913) -- 0:00:03
945000 -- (-1168.711) [-1168.050] (-1174.362) (-1171.691) * (-1168.775) (-1168.084) [-1170.573] (-1169.787) -- 0:00:03
Average standard deviation of split frequencies: 0.009281
945500 -- (-1167.734) [-1168.186] (-1169.520) (-1169.427) * (-1170.087) (-1171.693) [-1169.850] (-1168.928) -- 0:00:03
946000 -- [-1169.687] (-1174.881) (-1172.030) (-1168.861) * [-1169.373] (-1169.220) (-1171.396) (-1169.397) -- 0:00:03
946500 -- (-1170.902) (-1175.755) (-1169.755) [-1168.112] * [-1173.778] (-1168.217) (-1169.132) (-1170.919) -- 0:00:03
947000 -- (-1173.157) (-1172.499) [-1170.293] (-1167.948) * (-1174.104) (-1168.107) [-1169.412] (-1170.780) -- 0:00:03
947500 -- (-1173.663) (-1172.956) (-1172.246) [-1167.944] * (-1171.544) (-1170.496) [-1170.167] (-1168.786) -- 0:00:03
948000 -- (-1174.058) (-1171.994) [-1172.044] (-1169.933) * [-1169.364] (-1171.022) (-1169.450) (-1168.967) -- 0:00:03
948500 -- [-1170.697] (-1169.610) (-1168.529) (-1172.298) * (-1169.299) (-1168.671) (-1168.308) [-1168.774] -- 0:00:03
949000 -- (-1170.204) [-1169.790] (-1170.714) (-1168.814) * (-1172.887) (-1168.594) [-1170.594] (-1170.217) -- 0:00:03
949500 -- (-1169.858) [-1170.008] (-1168.757) (-1169.294) * (-1176.928) (-1168.094) [-1168.673] (-1170.373) -- 0:00:03
950000 -- (-1170.926) [-1169.345] (-1168.860) (-1170.236) * [-1169.150] (-1168.369) (-1169.454) (-1176.442) -- 0:00:03
Average standard deviation of split frequencies: 0.009731
950500 -- (-1168.097) (-1171.882) [-1170.033] (-1169.854) * (-1168.841) (-1171.443) (-1168.965) [-1173.310] -- 0:00:03
951000 -- (-1168.309) (-1171.290) [-1168.712] (-1170.054) * [-1170.067] (-1172.255) (-1169.553) (-1173.954) -- 0:00:03
951500 -- [-1168.716] (-1169.149) (-1170.135) (-1169.247) * [-1169.014] (-1171.237) (-1169.566) (-1168.183) -- 0:00:03
952000 -- (-1171.097) (-1174.189) (-1172.663) [-1168.982] * [-1169.137] (-1170.651) (-1174.497) (-1168.155) -- 0:00:02
952500 -- (-1172.879) [-1168.711] (-1172.993) (-1167.988) * (-1170.588) [-1169.857] (-1172.011) (-1170.992) -- 0:00:02
953000 -- (-1168.357) (-1173.807) [-1170.008] (-1170.037) * (-1169.650) [-1172.569] (-1172.696) (-1172.240) -- 0:00:02
953500 -- (-1168.935) [-1169.775] (-1169.353) (-1171.404) * (-1168.944) (-1170.288) [-1171.804] (-1173.910) -- 0:00:02
954000 -- [-1169.119] (-1171.634) (-1170.278) (-1169.548) * (-1168.792) (-1170.505) [-1168.893] (-1170.151) -- 0:00:02
954500 -- (-1170.398) (-1170.980) (-1171.821) [-1169.045] * (-1168.732) (-1168.390) [-1168.472] (-1173.375) -- 0:00:02
955000 -- (-1170.058) [-1168.289] (-1172.592) (-1170.828) * [-1170.625] (-1170.726) (-1171.879) (-1171.879) -- 0:00:02
Average standard deviation of split frequencies: 0.009770
955500 -- (-1169.705) (-1167.915) [-1170.514] (-1170.489) * (-1170.186) [-1173.076] (-1170.518) (-1167.887) -- 0:00:02
956000 -- (-1169.623) [-1175.038] (-1168.799) (-1169.362) * (-1170.201) (-1168.598) (-1169.482) [-1169.955] -- 0:00:02
956500 -- [-1169.542] (-1169.642) (-1170.797) (-1170.439) * (-1172.451) (-1169.158) [-1169.277] (-1170.523) -- 0:00:02
957000 -- (-1168.399) (-1169.525) (-1171.834) [-1169.198] * (-1171.213) (-1169.302) [-1172.018] (-1170.670) -- 0:00:02
957500 -- (-1169.179) [-1171.232] (-1172.056) (-1169.853) * (-1168.956) (-1170.267) (-1168.701) [-1173.567] -- 0:00:02
958000 -- (-1170.038) [-1168.602] (-1174.977) (-1169.179) * [-1170.398] (-1170.322) (-1168.708) (-1170.990) -- 0:00:02
958500 -- (-1169.921) (-1170.741) [-1169.081] (-1169.615) * (-1170.626) [-1169.799] (-1168.521) (-1170.664) -- 0:00:02
959000 -- (-1169.707) (-1170.330) (-1169.230) [-1169.475] * [-1170.112] (-1170.843) (-1168.457) (-1169.895) -- 0:00:02
959500 -- (-1169.846) (-1169.297) (-1168.410) [-1169.250] * (-1171.503) [-1171.472] (-1169.012) (-1169.693) -- 0:00:02
960000 -- (-1171.329) [-1171.253] (-1170.101) (-1170.549) * [-1169.113] (-1169.069) (-1169.840) (-1169.628) -- 0:00:02
Average standard deviation of split frequencies: 0.009354
960500 -- (-1170.606) (-1170.155) (-1170.166) [-1168.835] * (-1171.283) [-1170.059] (-1169.460) (-1172.729) -- 0:00:02
961000 -- (-1169.320) (-1172.172) (-1170.954) [-1168.217] * [-1170.065] (-1168.903) (-1168.624) (-1175.022) -- 0:00:02
961500 -- (-1171.793) (-1173.100) (-1170.385) [-1174.692] * (-1169.910) (-1168.913) [-1170.933] (-1170.744) -- 0:00:02
962000 -- [-1169.688] (-1168.890) (-1172.388) (-1170.619) * [-1169.539] (-1169.459) (-1169.908) (-1175.195) -- 0:00:02
962500 -- (-1170.964) (-1170.808) [-1168.558] (-1171.524) * (-1170.363) [-1168.334] (-1168.458) (-1169.533) -- 0:00:02
963000 -- (-1174.245) (-1172.228) (-1168.689) [-1169.150] * [-1172.496] (-1171.028) (-1169.882) (-1170.083) -- 0:00:02
963500 -- [-1168.646] (-1171.983) (-1171.272) (-1167.899) * (-1168.596) (-1175.373) [-1170.198] (-1168.866) -- 0:00:02
964000 -- [-1169.493] (-1168.930) (-1173.292) (-1169.030) * (-1168.845) (-1172.563) (-1169.639) [-1170.025] -- 0:00:02
964500 -- [-1168.296] (-1168.516) (-1174.757) (-1170.039) * (-1174.416) (-1168.301) (-1170.570) [-1170.499] -- 0:00:02
965000 -- (-1169.997) [-1168.936] (-1174.572) (-1170.122) * (-1168.660) [-1168.247] (-1171.805) (-1170.073) -- 0:00:02
Average standard deviation of split frequencies: 0.009516
965500 -- [-1173.677] (-1169.696) (-1169.364) (-1170.069) * (-1168.106) [-1168.061] (-1170.304) (-1169.174) -- 0:00:02
966000 -- (-1172.747) [-1171.127] (-1169.617) (-1171.117) * (-1169.848) (-1171.525) [-1171.021] (-1172.036) -- 0:00:02
966500 -- [-1171.174] (-1170.914) (-1168.984) (-1168.458) * (-1169.969) (-1170.417) [-1170.312] (-1169.365) -- 0:00:02
967000 -- (-1170.358) (-1173.349) (-1169.959) [-1169.466] * (-1168.969) [-1169.339] (-1169.986) (-1170.507) -- 0:00:02
967500 -- [-1168.256] (-1170.830) (-1169.062) (-1169.012) * (-1168.577) [-1170.292] (-1171.384) (-1173.075) -- 0:00:02
968000 -- (-1169.563) (-1168.418) (-1168.390) [-1171.429] * (-1174.055) (-1169.754) (-1172.849) [-1170.105] -- 0:00:01
968500 -- (-1171.577) [-1169.821] (-1173.922) (-1169.462) * [-1168.218] (-1169.180) (-1172.363) (-1172.015) -- 0:00:01
969000 -- (-1174.338) [-1172.645] (-1172.628) (-1169.009) * (-1168.348) (-1171.312) [-1171.136] (-1174.688) -- 0:00:01
969500 -- [-1169.978] (-1171.259) (-1171.920) (-1171.676) * [-1168.768] (-1170.240) (-1177.326) (-1170.808) -- 0:00:01
970000 -- (-1170.810) (-1170.046) (-1171.758) [-1169.006] * (-1170.160) (-1170.449) [-1172.747] (-1167.902) -- 0:00:01
Average standard deviation of split frequencies: 0.009409
970500 -- (-1169.774) (-1168.605) (-1170.559) [-1170.992] * (-1170.881) (-1168.767) (-1175.632) [-1169.037] -- 0:00:01
971000 -- (-1169.958) (-1170.135) (-1174.839) [-1171.044] * (-1171.368) (-1172.040) (-1173.747) [-1169.462] -- 0:00:01
971500 -- (-1171.131) (-1174.883) [-1171.133] (-1177.047) * (-1170.493) (-1170.108) (-1173.029) [-1169.408] -- 0:00:01
972000 -- (-1170.610) (-1168.182) [-1169.593] (-1169.912) * (-1170.808) (-1170.373) [-1169.331] (-1169.435) -- 0:00:01
972500 -- (-1168.570) (-1170.615) [-1169.264] (-1171.362) * [-1168.593] (-1171.116) (-1168.550) (-1170.129) -- 0:00:01
973000 -- (-1170.923) (-1170.642) [-1168.190] (-1170.586) * (-1167.949) (-1169.861) [-1172.830] (-1170.898) -- 0:00:01
973500 -- (-1169.379) (-1171.288) (-1168.182) [-1170.639] * (-1172.903) (-1172.582) (-1171.896) [-1168.107] -- 0:00:01
974000 -- (-1170.006) (-1170.297) [-1169.910] (-1171.060) * (-1168.584) (-1170.952) (-1172.197) [-1168.930] -- 0:00:01
974500 -- [-1168.987] (-1168.754) (-1172.621) (-1168.957) * (-1172.804) [-1168.382] (-1175.669) (-1168.124) -- 0:00:01
975000 -- (-1168.897) (-1169.161) (-1168.862) [-1168.625] * (-1169.790) [-1170.808] (-1172.456) (-1170.791) -- 0:00:01
Average standard deviation of split frequencies: 0.009690
975500 -- (-1171.631) [-1169.256] (-1169.968) (-1169.598) * (-1173.487) (-1170.442) [-1168.076] (-1176.878) -- 0:00:01
976000 -- (-1168.049) [-1170.511] (-1168.024) (-1168.899) * (-1177.812) (-1169.676) [-1168.249] (-1175.343) -- 0:00:01
976500 -- (-1171.405) (-1168.819) [-1173.402] (-1169.797) * (-1171.447) [-1169.438] (-1173.466) (-1170.093) -- 0:00:01
977000 -- (-1169.611) (-1169.134) [-1170.554] (-1169.854) * (-1172.566) (-1168.968) (-1169.254) [-1169.004] -- 0:00:01
977500 -- (-1174.882) (-1170.062) (-1170.047) [-1170.411] * (-1168.716) [-1170.252] (-1170.638) (-1170.156) -- 0:00:01
978000 -- (-1168.526) (-1170.683) [-1170.220] (-1168.716) * [-1168.479] (-1169.023) (-1170.674) (-1170.641) -- 0:00:01
978500 -- [-1168.419] (-1172.042) (-1171.088) (-1171.237) * (-1169.806) (-1169.034) [-1169.858] (-1169.769) -- 0:00:01
979000 -- [-1168.113] (-1170.749) (-1173.645) (-1168.636) * [-1169.620] (-1169.029) (-1168.348) (-1169.483) -- 0:00:01
979500 -- (-1169.359) (-1169.863) [-1172.358] (-1168.603) * [-1169.848] (-1169.093) (-1168.990) (-1171.929) -- 0:00:01
980000 -- (-1171.460) (-1169.346) [-1170.148] (-1171.558) * (-1171.855) [-1168.277] (-1169.214) (-1172.082) -- 0:00:01
Average standard deviation of split frequencies: 0.009734
980500 -- [-1168.874] (-1171.946) (-1169.015) (-1172.163) * (-1171.054) (-1168.606) [-1170.088] (-1168.473) -- 0:00:01
981000 -- [-1169.049] (-1174.093) (-1171.541) (-1174.979) * [-1171.777] (-1170.831) (-1171.803) (-1169.190) -- 0:00:01
981500 -- [-1171.625] (-1173.890) (-1172.501) (-1173.496) * (-1171.424) (-1170.572) [-1171.411] (-1169.817) -- 0:00:01
982000 -- (-1170.857) (-1169.736) (-1170.750) [-1169.975] * (-1169.904) (-1171.830) [-1172.840] (-1170.312) -- 0:00:01
982500 -- [-1170.625] (-1170.741) (-1169.330) (-1170.401) * (-1169.821) (-1170.827) [-1168.328] (-1169.126) -- 0:00:01
983000 -- (-1168.691) (-1171.311) [-1169.366] (-1169.623) * [-1173.601] (-1169.925) (-1168.617) (-1177.966) -- 0:00:01
983500 -- (-1171.826) [-1171.279] (-1170.180) (-1168.616) * [-1173.173] (-1168.492) (-1171.783) (-1174.235) -- 0:00:01
984000 -- [-1172.059] (-1168.728) (-1170.730) (-1168.918) * [-1169.632] (-1169.675) (-1171.164) (-1169.288) -- 0:00:00
984500 -- (-1168.767) (-1168.809) [-1169.269] (-1169.907) * (-1169.842) (-1171.119) (-1169.877) [-1170.638] -- 0:00:00
985000 -- [-1170.683] (-1169.811) (-1168.645) (-1171.283) * (-1171.772) (-1169.811) (-1170.999) [-1168.480] -- 0:00:00
Average standard deviation of split frequencies: 0.009681
985500 -- (-1172.557) [-1171.106] (-1170.212) (-1169.105) * [-1168.602] (-1173.607) (-1172.303) (-1171.791) -- 0:00:00
986000 -- (-1170.346) (-1169.608) (-1173.054) [-1168.397] * [-1171.587] (-1169.309) (-1171.759) (-1169.035) -- 0:00:00
986500 -- [-1167.941] (-1170.669) (-1172.203) (-1169.098) * (-1169.487) (-1172.888) (-1169.469) [-1169.349] -- 0:00:00
987000 -- [-1170.223] (-1168.025) (-1175.326) (-1169.353) * (-1170.710) (-1174.823) [-1167.977] (-1168.604) -- 0:00:00
987500 -- (-1170.227) [-1168.095] (-1172.007) (-1168.381) * (-1170.458) (-1171.457) [-1168.465] (-1168.684) -- 0:00:00
988000 -- (-1170.035) (-1171.062) (-1168.460) [-1170.238] * [-1169.169] (-1172.504) (-1171.080) (-1168.456) -- 0:00:00
988500 -- [-1168.834] (-1171.062) (-1171.437) (-1170.322) * (-1168.973) [-1170.491] (-1172.665) (-1169.899) -- 0:00:00
989000 -- [-1171.437] (-1175.621) (-1167.968) (-1172.279) * (-1170.583) [-1168.680] (-1171.317) (-1171.989) -- 0:00:00
989500 -- (-1172.022) [-1170.538] (-1170.596) (-1168.541) * (-1169.415) (-1168.374) [-1169.593] (-1172.515) -- 0:00:00
990000 -- (-1171.327) (-1169.232) [-1170.130] (-1171.391) * (-1172.644) (-1172.495) [-1168.700] (-1173.942) -- 0:00:00
Average standard deviation of split frequencies: 0.009576
990500 -- (-1171.384) (-1170.397) (-1168.145) [-1168.822] * [-1169.896] (-1171.258) (-1168.701) (-1172.321) -- 0:00:00
991000 -- (-1170.930) [-1169.266] (-1174.136) (-1168.828) * (-1168.965) [-1172.390] (-1173.838) (-1168.799) -- 0:00:00
991500 -- (-1174.822) [-1168.539] (-1168.660) (-1169.722) * [-1168.691] (-1173.521) (-1171.590) (-1168.842) -- 0:00:00
992000 -- [-1173.163] (-1168.092) (-1170.072) (-1170.726) * (-1171.947) [-1173.398] (-1174.067) (-1169.986) -- 0:00:00
992500 -- (-1169.752) [-1169.714] (-1169.163) (-1176.654) * (-1169.060) (-1174.713) (-1170.946) [-1168.681] -- 0:00:00
993000 -- [-1172.499] (-1169.135) (-1169.177) (-1169.203) * (-1169.288) [-1169.776] (-1172.241) (-1167.936) -- 0:00:00
993500 -- (-1174.093) (-1169.966) (-1168.553) [-1170.780] * (-1169.829) (-1170.412) [-1169.620] (-1172.411) -- 0:00:00
994000 -- [-1173.590] (-1173.522) (-1169.625) (-1168.760) * (-1170.348) [-1169.978] (-1168.956) (-1168.730) -- 0:00:00
994500 -- (-1173.238) (-1170.821) [-1168.448] (-1168.910) * (-1169.804) (-1168.849) [-1168.696] (-1169.830) -- 0:00:00
995000 -- (-1171.609) (-1169.866) (-1174.121) [-1168.583] * (-1169.843) (-1169.040) (-1174.597) [-1170.022] -- 0:00:00
Average standard deviation of split frequencies: 0.009466
995500 -- (-1168.797) (-1168.700) [-1169.428] (-1168.549) * (-1174.275) [-1168.560] (-1174.438) (-1169.346) -- 0:00:00
996000 -- (-1174.526) (-1172.006) [-1170.403] (-1169.857) * [-1168.502] (-1169.019) (-1175.508) (-1169.044) -- 0:00:00
996500 -- (-1170.564) (-1170.794) [-1171.598] (-1170.046) * (-1170.163) (-1167.977) [-1174.466] (-1168.759) -- 0:00:00
997000 -- (-1171.689) (-1168.769) (-1170.341) [-1172.907] * (-1170.051) [-1169.331] (-1171.597) (-1169.761) -- 0:00:00
997500 -- (-1172.291) (-1169.469) [-1168.701] (-1168.752) * [-1168.432] (-1171.815) (-1175.018) (-1170.130) -- 0:00:00
998000 -- (-1168.768) (-1170.322) (-1168.599) [-1170.864] * (-1168.955) (-1171.091) [-1170.270] (-1167.877) -- 0:00:00
998500 -- (-1169.085) (-1171.777) (-1170.299) [-1168.679] * [-1168.452] (-1171.201) (-1174.922) (-1169.881) -- 0:00:00
999000 -- (-1170.822) [-1168.564] (-1169.034) (-1170.438) * (-1173.468) (-1169.288) [-1171.200] (-1170.792) -- 0:00:00
999500 -- [-1169.237] (-1168.823) (-1170.511) (-1169.380) * (-1169.285) (-1169.326) (-1173.374) [-1173.149] -- 0:00:00
1000000 -- (-1172.603) (-1169.178) (-1169.916) [-1171.129] * [-1169.835] (-1170.181) (-1170.418) (-1171.639) -- 0:00:00
Average standard deviation of split frequencies: 0.009392
Analysis completed in 1 mins 2 seconds
Analysis used 60.91 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1167.57
Likelihood of best state for "cold" chain of run 2 was -1167.57
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.5 % ( 73 %) Dirichlet(Revmat{all})
100.0 % ( 99 %) Slider(Revmat{all})
26.7 % ( 35 %) Dirichlet(Pi{all})
28.1 % ( 19 %) Slider(Pi{all})
78.4 % ( 46 %) Multiplier(Alpha{1,2})
78.3 % ( 58 %) Multiplier(Alpha{3})
18.4 % ( 30 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.0 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 87 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.6 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 82 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.2 % ( 21 %) Dirichlet(Pi{all})
28.7 % ( 23 %) Slider(Pi{all})
78.8 % ( 63 %) Multiplier(Alpha{1,2})
78.1 % ( 50 %) Multiplier(Alpha{3})
19.5 % ( 19 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 83 %) ParsSPR(Tau{all},V{all})
28.1 % ( 30 %) Multiplier(V{all})
97.3 % ( 98 %) Nodeslider(V{all})
30.6 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167122 0.82 0.67
3 | 166255 166743 0.84
4 | 166256 167146 166478
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166256 0.82 0.67
3 | 166358 167117 0.84
4 | 166210 167506 166553
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1169.31
| 1 2 2 1 |
| 2 |
| 2 2 1 |
| 1 2 1 2 21 1 1 11 2 2 |
| 2 1 2 1 22 2 12 21 |
|* 1 1 1 11 * 1 1 2 2 2 122|
| 1 12 22 2 * 2 11 2 1 1 2 1 |
| 2 21 1 2 2 22 1 *1 1|
| 1 * 1 2 22 2 1 |
| 1 2 * 1 11 1 2 1 |
| 1 1 1 2 2 |
| 2 2 2 2 21 2 1 |
| 2 1 1 1 1 1 1 |
| 2 2 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1171.00
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1169.33 -1173.54
2 -1169.34 -1172.48
--------------------------------------
TOTAL -1169.33 -1173.14
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.903352 0.093210 0.377258 1.533693 0.863336 1023.15 1118.35 1.000
r(A<->C){all} 0.149065 0.017457 0.000072 0.412475 0.107190 220.93 276.95 1.000
r(A<->G){all} 0.173909 0.021158 0.000008 0.465948 0.137857 196.02 213.51 1.000
r(A<->T){all} 0.171662 0.020280 0.000085 0.453853 0.136474 52.48 139.45 1.004
r(C<->G){all} 0.167944 0.019182 0.000048 0.442659 0.135621 125.73 145.76 1.010
r(C<->T){all} 0.167614 0.019015 0.000072 0.434899 0.132391 218.86 232.91 1.001
r(G<->T){all} 0.169806 0.020668 0.000129 0.474175 0.133175 193.80 195.64 1.000
pi(A){all} 0.163182 0.000163 0.139364 0.189014 0.162720 925.83 1213.42 1.000
pi(C){all} 0.284991 0.000232 0.256031 0.315173 0.285138 1269.99 1280.28 1.000
pi(G){all} 0.360312 0.000267 0.330397 0.393567 0.360416 1001.21 1170.72 1.000
pi(T){all} 0.191515 0.000180 0.165788 0.217443 0.191522 1294.94 1296.72 1.000
alpha{1,2} 0.423223 0.222206 0.000180 1.397468 0.258042 1141.36 1209.72 1.000
alpha{3} 0.453237 0.232402 0.000124 1.421469 0.293250 1186.38 1219.19 1.000
pinvar{all} 0.998271 0.000004 0.994455 0.999999 0.998913 1222.10 1345.46 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- .**...
9 -- ...**.
10 -- .****.
11 -- .*...*
12 -- .*.***
13 -- ....**
14 -- .***.*
15 -- .*.*..
16 -- ..*.*.
17 -- ..*..*
18 -- ...*.*
19 -- .*..*.
20 -- ..****
21 -- .**.**
22 -- .*..**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 467 0.155563 0.010835 0.147901 0.163225 2
8 464 0.154564 0.014133 0.144570 0.164557 2
9 446 0.148568 0.001884 0.147235 0.149900 2
10 443 0.147568 0.007066 0.142572 0.152565 2
11 440 0.146569 0.008480 0.140573 0.152565 2
12 436 0.145237 0.008480 0.139241 0.151233 2
13 434 0.144570 0.002827 0.142572 0.146569 2
14 432 0.143904 0.010364 0.136576 0.151233 2
15 425 0.141572 0.003298 0.139241 0.143904 2
16 418 0.139241 0.014133 0.129247 0.149234 2
17 416 0.138574 0.013191 0.129247 0.147901 2
18 411 0.136909 0.013662 0.127249 0.146569 2
19 406 0.135243 0.001884 0.133911 0.136576 2
20 405 0.134910 0.000471 0.134577 0.135243 2
21 404 0.134577 0.020728 0.119920 0.149234 2
22 266 0.088608 0.018844 0.075283 0.101932 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/2res/folP2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099812 0.009974 0.000022 0.294740 0.068371 1.000 2
length{all}[2] 0.099563 0.009990 0.000022 0.297260 0.067814 1.000 2
length{all}[3] 0.099623 0.009424 0.000035 0.293294 0.070280 1.000 2
length{all}[4] 0.099538 0.009699 0.000011 0.292257 0.069318 1.000 2
length{all}[5] 0.104560 0.011198 0.000085 0.313819 0.071279 1.000 2
length{all}[6] 0.102271 0.010472 0.000026 0.305674 0.071817 1.000 2
length{all}[7] 0.097780 0.009932 0.000241 0.300679 0.063057 1.000 2
length{all}[8] 0.097052 0.008902 0.000055 0.285889 0.069520 0.998 2
length{all}[9] 0.096439 0.009402 0.000018 0.288568 0.069948 0.998 2
length{all}[10] 0.104418 0.014004 0.000001 0.320081 0.065753 0.998 2
length{all}[11] 0.100493 0.011428 0.000013 0.318754 0.058541 0.999 2
length{all}[12] 0.093753 0.008943 0.000094 0.290713 0.062760 0.999 2
length{all}[13] 0.102842 0.010197 0.000199 0.311777 0.071616 0.998 2
length{all}[14] 0.104878 0.013046 0.000283 0.336870 0.064779 0.998 2
length{all}[15] 0.097125 0.009655 0.000042 0.290816 0.065811 0.998 2
length{all}[16] 0.107411 0.011454 0.000270 0.317520 0.070861 0.998 2
length{all}[17] 0.105331 0.011803 0.000153 0.322743 0.067446 0.998 2
length{all}[18] 0.096668 0.009176 0.000076 0.291387 0.064784 1.002 2
length{all}[19] 0.107624 0.012100 0.000057 0.316833 0.080157 0.999 2
length{all}[20] 0.088698 0.007054 0.000242 0.250719 0.064906 0.998 2
length{all}[21] 0.092876 0.008718 0.000125 0.288064 0.063605 0.998 2
length{all}[22] 0.094452 0.007084 0.000666 0.249008 0.073874 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009392
Maximum standard deviation of split frequencies = 0.020728
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 873
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 291 / 291 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 291 / 291 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.047379 0.070089 0.082295 0.086845 0.020557 0.090789 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1242.266632
Iterating by ming2
Initial: fx= 1242.266632
x= 0.04738 0.07009 0.08230 0.08685 0.02056 0.09079 0.30000 1.30000
1 h-m-p 0.0000 0.0001 697.2540 ++ 1207.397838 m 0.0001 13 | 1/8
2 h-m-p 0.0007 0.0054 62.3611 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 637.8576 ++ 1169.101066 m 0.0001 44 | 2/8
4 h-m-p 0.0012 0.0084 43.5131 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 572.6432 ++ 1142.864898 m 0.0001 75 | 3/8
6 h-m-p 0.0014 0.0172 27.8524 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 497.6612 ++ 1132.199364 m 0.0000 106 | 4/8
8 h-m-p 0.0009 0.0447 18.4868 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 407.1078 ++ 1129.538787 m 0.0000 137 | 5/8
10 h-m-p 0.0004 0.1212 12.0668 ----------.. | 5/8
11 h-m-p 0.0000 0.0000 288.0085 ++ 1128.383514 m 0.0000 167 | 6/8
12 h-m-p 0.0318 8.0000 0.0000 Y 1128.383514 0 0.0318 178 | 6/8
13 h-m-p 0.2210 8.0000 0.0000 Y 1128.383514 0 0.0553 191 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 --------C 1128.383514 0 0.0000 212
Out..
lnL = -1128.383514
213 lfun, 213 eigenQcodon, 1278 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.056610 0.037323 0.067329 0.083877 0.042792 0.101023 0.299932 0.703959 0.127033
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.567865
np = 9
lnL0 = -1232.303233
Iterating by ming2
Initial: fx= 1232.303233
x= 0.05661 0.03732 0.06733 0.08388 0.04279 0.10102 0.29993 0.70396 0.12703
1 h-m-p 0.0000 0.0001 614.5331 ++ 1174.582609 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 376.5463 ++ 1167.005406 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0000 24508.9053 ++ 1152.053079 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 13624.8035 ++ 1143.776978 m 0.0000 50 | 4/9
5 h-m-p 0.0004 0.0018 40.1764 ++ 1142.272650 m 0.0018 62 | 5/9
6 h-m-p 0.0000 0.0001 243.0330 ++ 1137.500619 m 0.0001 74 | 6/9
7 h-m-p 0.0010 0.0518 15.4761 -----------.. | 6/9
8 h-m-p 0.0000 0.0001 276.3997 ++ 1128.383443 m 0.0001 107 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 1128.383443 m 8.0000 119 | 7/9
10 h-m-p 0.0770 8.0000 0.0029 ++++ 1128.383442 m 8.0000 135 | 7/9
11 h-m-p 0.0537 0.6646 0.4295 ++ 1128.383437 m 0.6646 149 | 8/9
12 h-m-p 0.0068 0.0342 12.0098 ++ 1128.383280 m 0.0342 163 | 9/9
13 h-m-p 0.0160 8.0000 0.0000 N 1128.383280 0 0.0160 175 | 9/9
14 h-m-p 0.0160 8.0000 0.0000 N 1128.383280 0 0.0160 187
Out..
lnL = -1128.383280
188 lfun, 564 eigenQcodon, 2256 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.033517 0.011811 0.012065 0.069171 0.070070 0.105288 0.000100 0.988325 0.304968 0.466549 1.300797
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.510018
np = 11
lnL0 = -1212.837446
Iterating by ming2
Initial: fx= 1212.837446
x= 0.03352 0.01181 0.01207 0.06917 0.07007 0.10529 0.00011 0.98832 0.30497 0.46655 1.30080
1 h-m-p 0.0000 0.0000 672.3799 ++ 1211.344813 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 281.9151 +++ 1192.436992 m 0.0003 31 | 2/11
3 h-m-p 0.0000 0.0000 178.0703 ++ 1192.157881 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0035 89.4740 +++++ 1139.949882 m 0.0035 62 | 4/11
5 h-m-p 0.0000 0.0000 8707.3705 ++ 1130.453161 m 0.0000 76 | 5/11
6 h-m-p 0.0000 0.0000 326.7527 ++ 1130.252528 m 0.0000 90 | 6/11
7 h-m-p 0.0000 0.0000 420954.2132 ++ 1129.477413 m 0.0000 104 | 7/11
8 h-m-p 0.0158 7.9248 16.9524 -------------.. | 7/11
9 h-m-p 0.0000 0.0000 284.4037 ++ 1128.383447 m 0.0000 143 | 8/11
10 h-m-p 0.0197 8.0000 0.0000 +++++ 1128.383447 m 8.0000 160 | 8/11
11 h-m-p 0.0802 8.0000 0.0006 ++++ 1128.383447 m 8.0000 179 | 8/11
12 h-m-p 0.0160 8.0000 1.5485 --------C 1128.383447 0 0.0000 204 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 1128.383447 m 8.0000 221 | 8/11
14 h-m-p 0.0012 0.3998 0.7516 +++++ 1128.383445 m 0.3998 241 | 9/11
15 h-m-p 0.0789 8.0000 2.1105 ++++ 1128.383281 m 8.0000 260 | 9/11
16 h-m-p 1.6000 8.0000 0.0720 ++ 1128.383280 m 8.0000 274 | 9/11
17 h-m-p 0.0476 8.0000 12.1120 ------------N 1128.383280 0 0.0000 302 | 9/11
18 h-m-p 0.5075 8.0000 0.0000 ---Y 1128.383280 0 0.0020 319 | 9/11
19 h-m-p 0.3367 8.0000 0.0000 N 1128.383280 0 0.3367 335
Out..
lnL = -1128.383280
336 lfun, 1344 eigenQcodon, 6048 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1128.429817 S = -1128.384211 -0.017600
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:03
did 20 / 57 patterns 0:03
did 30 / 57 patterns 0:03
did 40 / 57 patterns 0:03
did 50 / 57 patterns 0:03
did 57 / 57 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.051562 0.082766 0.017551 0.070236 0.027687 0.059668 0.000100 1.171738 1.943775
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.623062
np = 9
lnL0 = -1214.047474
Iterating by ming2
Initial: fx= 1214.047474
x= 0.05156 0.08277 0.01755 0.07024 0.02769 0.05967 0.00011 1.17174 1.94378
1 h-m-p 0.0000 0.0000 661.4594 ++ 1213.229793 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0236 49.7089 +++++ 1192.631348 m 0.0236 29 | 2/9
3 h-m-p 0.0000 0.0000 4146.6945 ++ 1187.269241 m 0.0000 41 | 3/9
4 h-m-p 0.0001 0.0022 384.7414
QuantileBeta(0.15, 0.00500, 2.13260) = 1.241984e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23549) = 1.170345e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.64704) = 9.504353e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.94368) = 8.367954e-161 2000 rounds
+ 1150.527129 m 0.0022 54
QuantileBeta(0.15, 0.00500, 2.94368) = 8.367954e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94368) = 8.367954e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94368) = 8.367954e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94368) = 8.367954e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94368) = 8.367954e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94368) = 8.367954e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94368) = 8.367954e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94368) = 8.660076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94368) = 8.367948e-161 2000 rounds
| 4/9
5 h-m-p 0.0000 0.0001 439.6949
QuantileBeta(0.15, 0.00500, 2.93479) = 8.398078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90811) = 8.489759e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.89922) = 8.520763e-161 2000 rounds
+ 1148.929210 m 0.0001 66
QuantileBeta(0.15, 0.00500, 2.89922) = 8.520763e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.89922) = 8.520763e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.89922) = 8.520763e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.89922) = 8.520763e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.89922) = 8.520763e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.89922) = 8.520763e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.89922) = 8.520763e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.89922) = 8.818219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.89922) = 8.520756e-161 2000 rounds
| 5/9
6 h-m-p 0.0000 0.0001 1627.7207
QuantileBeta(0.15, 0.00500, 2.87827) = 8.594702e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.81542) = 8.824373e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.79448) = 8.903663e-161 2000 rounds
+ 1146.166249 m 0.0001 78
QuantileBeta(0.15, 0.00500, 2.79448) = 8.903663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79448) = 8.903663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79448) = 8.903663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79448) = 8.903663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79448) = 8.903663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79448) = 8.903663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79448) = 8.903663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79448) = 9.214487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79448) = 8.903656e-161 2000 rounds
| 6/9
7 h-m-p 0.0004 0.0071 267.7430
QuantileBeta(0.15, 0.00500, 2.68973) = 9.322310e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37550) = 1.085049e-160 2000 rounds
+++ 1145.369395 m 0.0071 91 | 7/9
8 h-m-p 0.0050 0.0250 36.0998 ------------.. | 7/9
9 h-m-p 0.0000 0.0002 261.9908 +++ 1128.383280 m 0.0002 126 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 C 1128.383280 0 1.6000 138 | 8/9
11 h-m-p 0.0160 8.0000 0.0000 Y 1128.383280 0 0.0160 151
Out..
lnL = -1128.383280
152 lfun, 1672 eigenQcodon, 9120 P(t)
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.070070 0.019005 0.077101 0.096340 0.015569 0.044115 0.000100 0.900000 0.403805 1.594459 1.299937
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.028754
np = 11
lnL0 = -1213.535737
Iterating by ming2
Initial: fx= 1213.535737
x= 0.07007 0.01901 0.07710 0.09634 0.01557 0.04412 0.00011 0.90000 0.40380 1.59446 1.29994
1 h-m-p 0.0000 0.0000 609.2408 ++ 1213.040422 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0004 255.8899 +++ 1189.353385 m 0.0004 31 | 2/11
3 h-m-p 0.0000 0.0000 340.4000 ++ 1184.635847 m 0.0000 45 | 3/11
4 h-m-p 0.0001 0.0017 166.8532 +++ 1158.928203 m 0.0017 60 | 4/11
5 h-m-p 0.0000 0.0000 3282.8941 ++ 1141.528013 m 0.0000 74 | 5/11
6 h-m-p 0.0008 0.0038 15.7626 ++ 1141.158505 m 0.0038 88 | 6/11
7 h-m-p 0.0000 0.0002 124.1475 ++ 1138.353057 m 0.0002 102 | 7/11
8 h-m-p 0.0002 0.0032 73.2294 +++ 1128.383382 m 0.0032 117 | 8/11
9 h-m-p 1.6000 8.0000 0.0001 ++ 1128.383381 m 8.0000 131 | 8/11
10 h-m-p 0.0111 5.5620 0.2024 -----------Y 1128.383381 0 0.0000 159 | 8/11
11 h-m-p 0.0160 8.0000 0.0074 +++++ 1128.383350 m 8.0000 179 | 8/11
12 h-m-p 0.2760 5.9320 0.2144 ---------------.. | 8/11
13 h-m-p 0.0160 8.0000 0.0009 +++++ 1128.383344 m 8.0000 229 | 8/11
14 h-m-p 0.0498 6.9040 0.1368 ------------Y 1128.383344 0 0.0000 258 | 8/11
15 h-m-p 0.0000 0.0000 89459681.8576 ++ 1128.383280 m 0.0000 275 | 9/11
16 h-m-p 1.6000 8.0000 0.0000 ++ 1128.383280 m 8.0000 289 | 9/11
17 h-m-p 1.6000 8.0000 0.0000 C 1128.383280 0 1.6000 305 | 9/11
18 h-m-p 0.3333 8.0000 0.0000 --C 1128.383280 0 0.0052 323 | 9/11
19 h-m-p 0.0160 8.0000 4.1829 -----N 1128.383280 0 0.0000 344 | 9/11
20 h-m-p 1.6000 8.0000 0.0000 ----N 1128.383280 0 0.0016 362 | 9/11
21 h-m-p 1.0164 8.0000 0.0000 --N 1128.383280 0 0.0159 380
Out..
lnL = -1128.383280
381 lfun, 4572 eigenQcodon, 25146 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1128.443620 S = -1128.384222 -0.026392
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:12
did 20 / 57 patterns 0:12
did 30 / 57 patterns 0:12
did 40 / 57 patterns 0:13
did 50 / 57 patterns 0:13
did 57 / 57 patterns 0:13
Time used: 0:13
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/2res/folP2/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 291
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 1 1 1 1 1 1
TTC 6 6 6 6 6 6 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 7 7 7 7 7 7 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 5 5 5 5 5 5
CTC 2 2 2 2 2 2 | CCC 4 4 4 4 4 4 | CAC 5 5 5 5 5 5 | CGC 9 9 9 9 9 9
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1
CTG 13 13 13 13 13 13 | CCG 5 5 5 5 5 5 | CAG 4 4 4 4 4 4 | CGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 5 5 5 5 5 5 | Asn AAT 1 1 1 1 1 1 | Ser AGT 2 2 2 2 2 2
ATC 8 8 8 8 8 8 | ACC 10 10 10 10 10 10 | AAC 3 3 3 3 3 3 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 1 1 1 1 1 1
Met ATG 6 6 6 6 6 6 | ACG 8 8 8 8 8 8 | AAG 3 3 3 3 3 3 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 6 6 6 6 6 6 | Ala GCT 8 8 8 8 8 8 | Asp GAT 7 7 7 7 7 7 | Gly GGT 7 7 7 7 7 7
GTC 11 11 11 11 11 11 | GCC 10 10 10 10 10 10 | GAC 13 13 13 13 13 13 | GGC 13 13 13 13 13 13
GTA 6 6 6 6 6 6 | GCA 9 9 9 9 9 9 | Glu GAA 3 3 3 3 3 3 | GGA 2 2 2 2 2 2
GTG 12 12 12 12 12 12 | GCG 15 15 15 15 15 15 | GAG 11 11 11 11 11 11 | GGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908105_1_1099_MLBR_RS05155
position 1: T:0.10653 C:0.22337 A:0.19244 G:0.47766
position 2: T:0.28866 C:0.28522 A:0.19588 G:0.23024
position 3: T:0.17869 C:0.34708 A:0.09966 G:0.37457
Average T:0.19129 C:0.28522 A:0.16266 G:0.36082
#2: NC_002677_1_NP_301781_1_653_folP2
position 1: T:0.10653 C:0.22337 A:0.19244 G:0.47766
position 2: T:0.28866 C:0.28522 A:0.19588 G:0.23024
position 3: T:0.17869 C:0.34708 A:0.09966 G:0.37457
Average T:0.19129 C:0.28522 A:0.16266 G:0.36082
#3: NZ_LVXE01000047_1_WP_010908105_1_1968_A3216_RS11075
position 1: T:0.10653 C:0.22337 A:0.19244 G:0.47766
position 2: T:0.28866 C:0.28522 A:0.19588 G:0.23024
position 3: T:0.17869 C:0.34708 A:0.09966 G:0.37457
Average T:0.19129 C:0.28522 A:0.16266 G:0.36082
#4: NZ_LYPH01000054_1_WP_010908105_1_2006_A8144_RS09615
position 1: T:0.10653 C:0.22337 A:0.19244 G:0.47766
position 2: T:0.28866 C:0.28522 A:0.19588 G:0.23024
position 3: T:0.17869 C:0.34708 A:0.09966 G:0.37457
Average T:0.19129 C:0.28522 A:0.16266 G:0.36082
#5: NZ_CP029543_1_WP_010908105_1_1115_folP
position 1: T:0.10653 C:0.22337 A:0.19244 G:0.47766
position 2: T:0.28866 C:0.28522 A:0.19588 G:0.23024
position 3: T:0.17869 C:0.34708 A:0.09966 G:0.37457
Average T:0.19129 C:0.28522 A:0.16266 G:0.36082
#6: NZ_AP014567_1_WP_010908105_1_1140_folP
position 1: T:0.10653 C:0.22337 A:0.19244 G:0.47766
position 2: T:0.28866 C:0.28522 A:0.19588 G:0.23024
position 3: T:0.17869 C:0.34708 A:0.09966 G:0.37457
Average T:0.19129 C:0.28522 A:0.16266 G:0.36082
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 6
TTC 36 | TCC 0 | TAC 6 | TGC 12
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 42 | TCG 30 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 30
CTC 12 | CCC 24 | CAC 30 | CGC 54
CTA 12 | CCA 6 | Gln Q CAA 6 | CGA 6
CTG 78 | CCG 30 | CAG 24 | CGG 48
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 30 | Asn N AAT 6 | Ser S AGT 12
ATC 48 | ACC 60 | AAC 18 | AGC 24
ATA 0 | ACA 6 | Lys K AAA 6 | Arg R AGA 6
Met M ATG 36 | ACG 48 | AAG 18 | AGG 12
------------------------------------------------------------------------------
Val V GTT 36 | Ala A GCT 48 | Asp D GAT 42 | Gly G GGT 42
GTC 66 | GCC 60 | GAC 78 | GGC 78
GTA 36 | GCA 54 | Glu E GAA 18 | GGA 12
GTG 72 | GCG 90 | GAG 66 | GGG 36
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10653 C:0.22337 A:0.19244 G:0.47766
position 2: T:0.28866 C:0.28522 A:0.19588 G:0.23024
position 3: T:0.17869 C:0.34708 A:0.09966 G:0.37457
Average T:0.19129 C:0.28522 A:0.16266 G:0.36082
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1128.383514 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299932 1.299937
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908105_1_1099_MLBR_RS05155: 0.000004, NC_002677_1_NP_301781_1_653_folP2: 0.000004, NZ_LVXE01000047_1_WP_010908105_1_1968_A3216_RS11075: 0.000004, NZ_LYPH01000054_1_WP_010908105_1_2006_A8144_RS09615: 0.000004, NZ_CP029543_1_WP_010908105_1_1115_folP: 0.000004, NZ_AP014567_1_WP_010908105_1_1140_folP: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29993
omega (dN/dS) = 1.29994
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 635.4 237.6 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 635.4 237.6 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 635.4 237.6 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 635.4 237.6 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 635.4 237.6 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 635.4 237.6 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1128.383280 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908105_1_1099_MLBR_RS05155: 0.000004, NC_002677_1_NP_301781_1_653_folP2: 0.000004, NZ_LVXE01000047_1_WP_010908105_1_1968_A3216_RS11075: 0.000004, NZ_LYPH01000054_1_WP_010908105_1_2006_A8144_RS09615: 0.000004, NZ_CP029543_1_WP_010908105_1_1115_folP: 0.000004, NZ_AP014567_1_WP_010908105_1_1140_folP: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1128.383280 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999442 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908105_1_1099_MLBR_RS05155: 0.000004, NC_002677_1_NP_301781_1_653_folP2: 0.000004, NZ_LVXE01000047_1_WP_010908105_1_1968_A3216_RS11075: 0.000004, NZ_LYPH01000054_1_WP_010908105_1_2006_A8144_RS09615: 0.000004, NZ_CP029543_1_WP_010908105_1_1115_folP: 0.000004, NZ_AP014567_1_WP_010908105_1_1140_folP: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99944 0.00000 0.00056
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 637.0 236.0 0.0006 0.0000 0.0000 0.0 0.0
7..2 0.000 637.0 236.0 0.0006 0.0000 0.0000 0.0 0.0
7..3 0.000 637.0 236.0 0.0006 0.0000 0.0000 0.0 0.0
7..4 0.000 637.0 236.0 0.0006 0.0000 0.0000 0.0 0.0
7..5 0.000 637.0 236.0 0.0006 0.0000 0.0000 0.0 0.0
7..6 0.000 637.0 236.0 0.0006 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908105_1_1099_MLBR_RS05155)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1128.383280 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.905624
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908105_1_1099_MLBR_RS05155: 0.000004, NC_002677_1_NP_301781_1_653_folP2: 0.000004, NZ_LVXE01000047_1_WP_010908105_1_1968_A3216_RS11075: 0.000004, NZ_LYPH01000054_1_WP_010908105_1_2006_A8144_RS09615: 0.000004, NZ_CP029543_1_WP_010908105_1_1115_folP: 0.000004, NZ_AP014567_1_WP_010908105_1_1140_folP: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 0.90562
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00004
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1128.383280 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.722901 1.802476
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908105_1_1099_MLBR_RS05155: 0.000004, NC_002677_1_NP_301781_1_653_folP2: 0.000004, NZ_LVXE01000047_1_WP_010908105_1_1968_A3216_RS11075: 0.000004, NZ_LYPH01000054_1_WP_010908105_1_2006_A8144_RS09615: 0.000004, NZ_CP029543_1_WP_010908105_1_1115_folP: 0.000004, NZ_AP014567_1_WP_010908105_1_1140_folP: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.72290
(p1 = 0.00001) w = 1.80248
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.80248
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 637.0 236.0 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908105_1_1099_MLBR_RS05155)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.100 0.101 0.103 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.099 0.099 0.098 0.097 0.096
Time used: 0:13