>C1
MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
>C2
MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
>C3
MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
>C4
MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
>C5
MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
>C6
MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=282
C1 MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
C2 MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
C3 MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
C4 MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
C5 MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
C6 MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
**************************************************
C1 TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
C2 TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
C3 TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
C4 TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
C5 TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
C6 TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
**************************************************
C1 DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
C2 DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
C3 DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
C4 DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
C5 DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
C6 DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
**************************************************
C1 VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
C2 VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
C3 VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
C4 VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
C5 VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
C6 VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
**************************************************
C1 RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
C2 RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
C3 RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
C4 RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
C5 RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
C6 RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
**************************************************
C1 EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
C2 EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
C3 EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
C4 EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
C5 EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
C6 EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8460]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8460]--->[8460]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.492 Mb, Max= 30.830 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
C2 MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
C3 MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
C4 MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
C5 MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
C6 MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
**************************************************
C1 TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
C2 TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
C3 TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
C4 TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
C5 TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
C6 TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
**************************************************
C1 DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
C2 DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
C3 DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
C4 DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
C5 DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
C6 DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
**************************************************
C1 VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
C2 VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
C3 VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
C4 VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
C5 VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
C6 VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
**************************************************
C1 RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
C2 RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
C3 RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
C4 RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
C5 RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
C6 RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
**************************************************
C1 EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
C2 EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
C3 EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
C4 EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
C5 EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
C6 EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCCTGAACTGCCCGAAGTAGAGGTGGTGCGGCGCGGCCTGCAGGACTA
C2 ATGCCTGAACTGCCCGAAGTAGAGGTGGTGCGGCGCGGCCTGCAGGACTA
C3 ATGCCTGAACTGCCCGAAGTAGAGGTGGTGCGGCGCGGCCTGCAGGACTA
C4 ATGCCTGAACTGCCCGAAGTAGAGGTGGTGCGGCGCGGCCTGCAGGACTA
C5 ATGCCTGAACTGCCCGAAGTAGAGGTGGTGCGGCGCGGCCTGCAGGACTA
C6 ATGCCTGAACTGCCCGAAGTAGAGGTGGTGCGGCGCGGCCTGCAGGACTA
**************************************************
C1 TATCGTAGGCAAGACGATTACTGCGGTTCGGGTGCACCATCCGCGCGCTG
C2 TATCGTAGGCAAGACGATTACTGCGGTTCGGGTGCACCATCCGCGCGCTG
C3 TATCGTAGGCAAGACGATTACTGCGGTTCGGGTGCACCATCCGCGCGCTG
C4 TATCGTAGGCAAGACGATTACTGCGGTTCGGGTGCACCATCCGCGCGCTG
C5 TATCGTAGGCAAGACGATTACTGCGGTTCGGGTGCACCATCCGCGCGCTG
C6 TATCGTAGGCAAGACGATTACTGCGGTTCGGGTGCACCATCCGCGCGCTG
**************************************************
C1 TGCGCCGCCACGTTGCTGGACCAACTGACCTCACGAACCGGCTGCTCGGC
C2 TGCGCCGCCACGTTGCTGGACCAACTGACCTCACGAACCGGCTGCTCGGC
C3 TGCGCCGCCACGTTGCTGGACCAACTGACCTCACGAACCGGCTGCTCGGC
C4 TGCGCCGCCACGTTGCTGGACCAACTGACCTCACGAACCGGCTGCTCGGC
C5 TGCGCCGCCACGTTGCTGGACCAACTGACCTCACGAACCGGCTGCTCGGC
C6 TGCGCCGCCACGTTGCTGGACCAACTGACCTCACGAACCGGCTGCTCGGC
**************************************************
C1 ACCCGTATTAACGGAATTGATCGGCGCGGCAAATATCTGTGGTTCTTGCT
C2 ACCCGTATTAACGGAATTGATCGGCGCGGCAAATATCTGTGGTTCTTGCT
C3 ACCCGTATTAACGGAATTGATCGGCGCGGCAAATATCTGTGGTTCTTGCT
C4 ACCCGTATTAACGGAATTGATCGGCGCGGCAAATATCTGTGGTTCTTGCT
C5 ACCCGTATTAACGGAATTGATCGGCGCGGCAAATATCTGTGGTTCTTGCT
C6 ACCCGTATTAACGGAATTGATCGGCGCGGCAAATATCTGTGGTTCTTGCT
**************************************************
C1 GGACACAGACATTGCGCTCGTGGTGCACCTCGGCATGAGCGGGCAGATGT
C2 GGACACAGACATTGCGCTCGTGGTGCACCTCGGCATGAGCGGGCAGATGT
C3 GGACACAGACATTGCGCTCGTGGTGCACCTCGGCATGAGCGGGCAGATGT
C4 GGACACAGACATTGCGCTCGTGGTGCACCTCGGCATGAGCGGGCAGATGT
C5 GGACACAGACATTGCGCTCGTGGTGCACCTCGGCATGAGCGGGCAGATGT
C6 GGACACAGACATTGCGCTCGTGGTGCACCTCGGCATGAGCGGGCAGATGT
**************************************************
C1 TGCTGGGGACCGTGCCTCGCGTCGATCACGTTAGGATCTCTGCGCTGTTC
C2 TGCTGGGGACCGTGCCTCGCGTCGATCACGTTAGGATCTCTGCGCTGTTC
C3 TGCTGGGGACCGTGCCTCGCGTCGATCACGTTAGGATCTCTGCGCTGTTC
C4 TGCTGGGGACCGTGCCTCGCGTCGATCACGTTAGGATCTCTGCGCTGTTC
C5 TGCTGGGGACCGTGCCTCGCGTCGATCACGTTAGGATCTCTGCGCTGTTC
C6 TGCTGGGGACCGTGCCTCGCGTCGATCACGTTAGGATCTCTGCGCTGTTC
**************************************************
C1 GACGACGGGACCGTGTTGAACTTCACGGATCAGCGGACCTTAGGGGGATG
C2 GACGACGGGACCGTGTTGAACTTCACGGATCAGCGGACCTTAGGGGGATG
C3 GACGACGGGACCGTGTTGAACTTCACGGATCAGCGGACCTTAGGGGGATG
C4 GACGACGGGACCGTGTTGAACTTCACGGATCAGCGGACCTTAGGGGGATG
C5 GACGACGGGACCGTGTTGAACTTCACGGATCAGCGGACCTTAGGGGGATG
C6 GACGACGGGACCGTGTTGAACTTCACGGATCAGCGGACCTTAGGGGGATG
**************************************************
C1 GCTGCTAGCCGATCTAATGACGGTGGACGGCAGTGTGCTGCCGGTGCCTG
C2 GCTGCTAGCCGATCTAATGACGGTGGACGGCAGTGTGCTGCCGGTGCCTG
C3 GCTGCTAGCCGATCTAATGACGGTGGACGGCAGTGTGCTGCCGGTGCCTG
C4 GCTGCTAGCCGATCTAATGACGGTGGACGGCAGTGTGCTGCCGGTGCCTG
C5 GCTGCTAGCCGATCTAATGACGGTGGACGGCAGTGTGCTGCCGGTGCCTG
C6 GCTGCTAGCCGATCTAATGACGGTGGACGGCAGTGTGCTGCCGGTGCCTG
**************************************************
C1 TCGCCCACTTGGCGCGTGACCCGTTCGATCCGCGGTTCGATGTCGAAGCT
C2 TCGCCCACTTGGCGCGTGACCCGTTCGATCCGCGGTTCGATGTCGAAGCT
C3 TCGCCCACTTGGCGCGTGACCCGTTCGATCCGCGGTTCGATGTCGAAGCT
C4 TCGCCCACTTGGCGCGTGACCCGTTCGATCCGCGGTTCGATGTCGAAGCT
C5 TCGCCCACTTGGCGCGTGACCCGTTCGATCCGCGGTTCGATGTCGAAGCT
C6 TCGCCCACTTGGCGCGTGACCCGTTCGATCCGCGGTTCGATGTCGAAGCT
**************************************************
C1 GTAGTGAAAGTGTTGCGGTGCAAGCATTCCGAGCTCAAGCGCCAGCTCCT
C2 GTAGTGAAAGTGTTGCGGTGCAAGCATTCCGAGCTCAAGCGCCAGCTCCT
C3 GTAGTGAAAGTGTTGCGGTGCAAGCATTCCGAGCTCAAGCGCCAGCTCCT
C4 GTAGTGAAAGTGTTGCGGTGCAAGCATTCCGAGCTCAAGCGCCAGCTCCT
C5 GTAGTGAAAGTGTTGCGGTGCAAGCATTCCGAGCTCAAGCGCCAGCTCCT
C6 GTAGTGAAAGTGTTGCGGTGCAAGCATTCCGAGCTCAAGCGCCAGCTCCT
**************************************************
C1 CGATCAACAGACAGTATCTGGAATCGGCAACATTTACGCCGATGAGGCGT
C2 CGATCAACAGACAGTATCTGGAATCGGCAACATTTACGCCGATGAGGCGT
C3 CGATCAACAGACAGTATCTGGAATCGGCAACATTTACGCCGATGAGGCGT
C4 CGATCAACAGACAGTATCTGGAATCGGCAACATTTACGCCGATGAGGCGT
C5 CGATCAACAGACAGTATCTGGAATCGGCAACATTTACGCCGATGAGGCGT
C6 CGATCAACAGACAGTATCTGGAATCGGCAACATTTACGCCGATGAGGCGT
**************************************************
C1 TGTGGCGGGCCGAAGTGCACGGCGCGCGAATTGCTGCCACTCTGACCCGT
C2 TGTGGCGGGCCGAAGTGCACGGCGCGCGAATTGCTGCCACTCTGACCCGT
C3 TGTGGCGGGCCGAAGTGCACGGCGCGCGAATTGCTGCCACTCTGACCCGT
C4 TGTGGCGGGCCGAAGTGCACGGCGCGCGAATTGCTGCCACTCTGACCCGT
C5 TGTGGCGGGCCGAAGTGCACGGCGCGCGAATTGCTGCCACTCTGACCCGT
C6 TGTGGCGGGCCGAAGTGCACGGCGCGCGAATTGCTGCCACTCTGACCCGT
**************************************************
C1 CGGCAGCTGGCCGCGGTTCTGGATGCTGCCGCCGATGTGATGCGCGACTC
C2 CGGCAGCTGGCCGCGGTTCTGGATGCTGCCGCCGATGTGATGCGCGACTC
C3 CGGCAGCTGGCCGCGGTTCTGGATGCTGCCGCCGATGTGATGCGCGACTC
C4 CGGCAGCTGGCCGCGGTTCTGGATGCTGCCGCCGATGTGATGCGCGACTC
C5 CGGCAGCTGGCCGCGGTTCTGGATGCTGCCGCCGATGTGATGCGCGACTC
C6 CGGCAGCTGGCCGCGGTTCTGGATGCTGCCGCCGATGTGATGCGCGACTC
**************************************************
C1 GTTGGCCAAGGGTGGGACTTCGTTCGATTCGCTGTATGTCAACGTCAACG
C2 GTTGGCCAAGGGTGGGACTTCGTTCGATTCGCTGTATGTCAACGTCAACG
C3 GTTGGCCAAGGGTGGGACTTCGTTCGATTCGCTGTATGTCAACGTCAACG
C4 GTTGGCCAAGGGTGGGACTTCGTTCGATTCGCTGTATGTCAACGTCAACG
C5 GTTGGCCAAGGGTGGGACTTCGTTCGATTCGCTGTATGTCAACGTCAACG
C6 GTTGGCCAAGGGTGGGACTTCGTTCGATTCGCTGTATGTCAACGTCAACG
**************************************************
C1 GCGAATCGGGGTACTTTGACCGATCTTTGGATGCCTATGGTCGTGAAGGC
C2 GCGAATCGGGGTACTTTGACCGATCTTTGGATGCCTATGGTCGTGAAGGC
C3 GCGAATCGGGGTACTTTGACCGATCTTTGGATGCCTATGGTCGTGAAGGC
C4 GCGAATCGGGGTACTTTGACCGATCTTTGGATGCCTATGGTCGTGAAGGC
C5 GCGAATCGGGGTACTTTGACCGATCTTTGGATGCCTATGGTCGTGAAGGC
C6 GCGAATCGGGGTACTTTGACCGATCTTTGGATGCCTATGGTCGTGAAGGC
**************************************************
C1 GAAGGCTGCCGGCGTTGCGGCGCGGTGATGCACCGGGAAAAGTTCATGAA
C2 GAAGGCTGCCGGCGTTGCGGCGCGGTGATGCACCGGGAAAAGTTCATGAA
C3 GAAGGCTGCCGGCGTTGCGGCGCGGTGATGCACCGGGAAAAGTTCATGAA
C4 GAAGGCTGCCGGCGTTGCGGCGCGGTGATGCACCGGGAAAAGTTCATGAA
C5 GAAGGCTGCCGGCGTTGCGGCGCGGTGATGCACCGGGAAAAGTTCATGAA
C6 GAAGGCTGCCGGCGTTGCGGCGCGGTGATGCACCGGGAAAAGTTCATGAA
**************************************************
C1 CCGCTCGTCCTTCTATTGCCCTAGATGCCAACCTCGGCCCCGGCGG
C2 CCGCTCGTCCTTCTATTGCCCTAGATGCCAACCTCGGCCCCGGCGG
C3 CCGCTCGTCCTTCTATTGCCCTAGATGCCAACCTCGGCCCCGGCGG
C4 CCGCTCGTCCTTCTATTGCCCTAGATGCCAACCTCGGCCCCGGCGG
C5 CCGCTCGTCCTTCTATTGCCCTAGATGCCAACCTCGGCCCCGGCGG
C6 CCGCTCGTCCTTCTATTGCCCTAGATGCCAACCTCGGCCCCGGCGG
**********************************************
>C1
ATGCCTGAACTGCCCGAAGTAGAGGTGGTGCGGCGCGGCCTGCAGGACTA
TATCGTAGGCAAGACGATTACTGCGGTTCGGGTGCACCATCCGCGCGCTG
TGCGCCGCCACGTTGCTGGACCAACTGACCTCACGAACCGGCTGCTCGGC
ACCCGTATTAACGGAATTGATCGGCGCGGCAAATATCTGTGGTTCTTGCT
GGACACAGACATTGCGCTCGTGGTGCACCTCGGCATGAGCGGGCAGATGT
TGCTGGGGACCGTGCCTCGCGTCGATCACGTTAGGATCTCTGCGCTGTTC
GACGACGGGACCGTGTTGAACTTCACGGATCAGCGGACCTTAGGGGGATG
GCTGCTAGCCGATCTAATGACGGTGGACGGCAGTGTGCTGCCGGTGCCTG
TCGCCCACTTGGCGCGTGACCCGTTCGATCCGCGGTTCGATGTCGAAGCT
GTAGTGAAAGTGTTGCGGTGCAAGCATTCCGAGCTCAAGCGCCAGCTCCT
CGATCAACAGACAGTATCTGGAATCGGCAACATTTACGCCGATGAGGCGT
TGTGGCGGGCCGAAGTGCACGGCGCGCGAATTGCTGCCACTCTGACCCGT
CGGCAGCTGGCCGCGGTTCTGGATGCTGCCGCCGATGTGATGCGCGACTC
GTTGGCCAAGGGTGGGACTTCGTTCGATTCGCTGTATGTCAACGTCAACG
GCGAATCGGGGTACTTTGACCGATCTTTGGATGCCTATGGTCGTGAAGGC
GAAGGCTGCCGGCGTTGCGGCGCGGTGATGCACCGGGAAAAGTTCATGAA
CCGCTCGTCCTTCTATTGCCCTAGATGCCAACCTCGGCCCCGGCGG
>C2
ATGCCTGAACTGCCCGAAGTAGAGGTGGTGCGGCGCGGCCTGCAGGACTA
TATCGTAGGCAAGACGATTACTGCGGTTCGGGTGCACCATCCGCGCGCTG
TGCGCCGCCACGTTGCTGGACCAACTGACCTCACGAACCGGCTGCTCGGC
ACCCGTATTAACGGAATTGATCGGCGCGGCAAATATCTGTGGTTCTTGCT
GGACACAGACATTGCGCTCGTGGTGCACCTCGGCATGAGCGGGCAGATGT
TGCTGGGGACCGTGCCTCGCGTCGATCACGTTAGGATCTCTGCGCTGTTC
GACGACGGGACCGTGTTGAACTTCACGGATCAGCGGACCTTAGGGGGATG
GCTGCTAGCCGATCTAATGACGGTGGACGGCAGTGTGCTGCCGGTGCCTG
TCGCCCACTTGGCGCGTGACCCGTTCGATCCGCGGTTCGATGTCGAAGCT
GTAGTGAAAGTGTTGCGGTGCAAGCATTCCGAGCTCAAGCGCCAGCTCCT
CGATCAACAGACAGTATCTGGAATCGGCAACATTTACGCCGATGAGGCGT
TGTGGCGGGCCGAAGTGCACGGCGCGCGAATTGCTGCCACTCTGACCCGT
CGGCAGCTGGCCGCGGTTCTGGATGCTGCCGCCGATGTGATGCGCGACTC
GTTGGCCAAGGGTGGGACTTCGTTCGATTCGCTGTATGTCAACGTCAACG
GCGAATCGGGGTACTTTGACCGATCTTTGGATGCCTATGGTCGTGAAGGC
GAAGGCTGCCGGCGTTGCGGCGCGGTGATGCACCGGGAAAAGTTCATGAA
CCGCTCGTCCTTCTATTGCCCTAGATGCCAACCTCGGCCCCGGCGG
>C3
ATGCCTGAACTGCCCGAAGTAGAGGTGGTGCGGCGCGGCCTGCAGGACTA
TATCGTAGGCAAGACGATTACTGCGGTTCGGGTGCACCATCCGCGCGCTG
TGCGCCGCCACGTTGCTGGACCAACTGACCTCACGAACCGGCTGCTCGGC
ACCCGTATTAACGGAATTGATCGGCGCGGCAAATATCTGTGGTTCTTGCT
GGACACAGACATTGCGCTCGTGGTGCACCTCGGCATGAGCGGGCAGATGT
TGCTGGGGACCGTGCCTCGCGTCGATCACGTTAGGATCTCTGCGCTGTTC
GACGACGGGACCGTGTTGAACTTCACGGATCAGCGGACCTTAGGGGGATG
GCTGCTAGCCGATCTAATGACGGTGGACGGCAGTGTGCTGCCGGTGCCTG
TCGCCCACTTGGCGCGTGACCCGTTCGATCCGCGGTTCGATGTCGAAGCT
GTAGTGAAAGTGTTGCGGTGCAAGCATTCCGAGCTCAAGCGCCAGCTCCT
CGATCAACAGACAGTATCTGGAATCGGCAACATTTACGCCGATGAGGCGT
TGTGGCGGGCCGAAGTGCACGGCGCGCGAATTGCTGCCACTCTGACCCGT
CGGCAGCTGGCCGCGGTTCTGGATGCTGCCGCCGATGTGATGCGCGACTC
GTTGGCCAAGGGTGGGACTTCGTTCGATTCGCTGTATGTCAACGTCAACG
GCGAATCGGGGTACTTTGACCGATCTTTGGATGCCTATGGTCGTGAAGGC
GAAGGCTGCCGGCGTTGCGGCGCGGTGATGCACCGGGAAAAGTTCATGAA
CCGCTCGTCCTTCTATTGCCCTAGATGCCAACCTCGGCCCCGGCGG
>C4
ATGCCTGAACTGCCCGAAGTAGAGGTGGTGCGGCGCGGCCTGCAGGACTA
TATCGTAGGCAAGACGATTACTGCGGTTCGGGTGCACCATCCGCGCGCTG
TGCGCCGCCACGTTGCTGGACCAACTGACCTCACGAACCGGCTGCTCGGC
ACCCGTATTAACGGAATTGATCGGCGCGGCAAATATCTGTGGTTCTTGCT
GGACACAGACATTGCGCTCGTGGTGCACCTCGGCATGAGCGGGCAGATGT
TGCTGGGGACCGTGCCTCGCGTCGATCACGTTAGGATCTCTGCGCTGTTC
GACGACGGGACCGTGTTGAACTTCACGGATCAGCGGACCTTAGGGGGATG
GCTGCTAGCCGATCTAATGACGGTGGACGGCAGTGTGCTGCCGGTGCCTG
TCGCCCACTTGGCGCGTGACCCGTTCGATCCGCGGTTCGATGTCGAAGCT
GTAGTGAAAGTGTTGCGGTGCAAGCATTCCGAGCTCAAGCGCCAGCTCCT
CGATCAACAGACAGTATCTGGAATCGGCAACATTTACGCCGATGAGGCGT
TGTGGCGGGCCGAAGTGCACGGCGCGCGAATTGCTGCCACTCTGACCCGT
CGGCAGCTGGCCGCGGTTCTGGATGCTGCCGCCGATGTGATGCGCGACTC
GTTGGCCAAGGGTGGGACTTCGTTCGATTCGCTGTATGTCAACGTCAACG
GCGAATCGGGGTACTTTGACCGATCTTTGGATGCCTATGGTCGTGAAGGC
GAAGGCTGCCGGCGTTGCGGCGCGGTGATGCACCGGGAAAAGTTCATGAA
CCGCTCGTCCTTCTATTGCCCTAGATGCCAACCTCGGCCCCGGCGG
>C5
ATGCCTGAACTGCCCGAAGTAGAGGTGGTGCGGCGCGGCCTGCAGGACTA
TATCGTAGGCAAGACGATTACTGCGGTTCGGGTGCACCATCCGCGCGCTG
TGCGCCGCCACGTTGCTGGACCAACTGACCTCACGAACCGGCTGCTCGGC
ACCCGTATTAACGGAATTGATCGGCGCGGCAAATATCTGTGGTTCTTGCT
GGACACAGACATTGCGCTCGTGGTGCACCTCGGCATGAGCGGGCAGATGT
TGCTGGGGACCGTGCCTCGCGTCGATCACGTTAGGATCTCTGCGCTGTTC
GACGACGGGACCGTGTTGAACTTCACGGATCAGCGGACCTTAGGGGGATG
GCTGCTAGCCGATCTAATGACGGTGGACGGCAGTGTGCTGCCGGTGCCTG
TCGCCCACTTGGCGCGTGACCCGTTCGATCCGCGGTTCGATGTCGAAGCT
GTAGTGAAAGTGTTGCGGTGCAAGCATTCCGAGCTCAAGCGCCAGCTCCT
CGATCAACAGACAGTATCTGGAATCGGCAACATTTACGCCGATGAGGCGT
TGTGGCGGGCCGAAGTGCACGGCGCGCGAATTGCTGCCACTCTGACCCGT
CGGCAGCTGGCCGCGGTTCTGGATGCTGCCGCCGATGTGATGCGCGACTC
GTTGGCCAAGGGTGGGACTTCGTTCGATTCGCTGTATGTCAACGTCAACG
GCGAATCGGGGTACTTTGACCGATCTTTGGATGCCTATGGTCGTGAAGGC
GAAGGCTGCCGGCGTTGCGGCGCGGTGATGCACCGGGAAAAGTTCATGAA
CCGCTCGTCCTTCTATTGCCCTAGATGCCAACCTCGGCCCCGGCGG
>C6
ATGCCTGAACTGCCCGAAGTAGAGGTGGTGCGGCGCGGCCTGCAGGACTA
TATCGTAGGCAAGACGATTACTGCGGTTCGGGTGCACCATCCGCGCGCTG
TGCGCCGCCACGTTGCTGGACCAACTGACCTCACGAACCGGCTGCTCGGC
ACCCGTATTAACGGAATTGATCGGCGCGGCAAATATCTGTGGTTCTTGCT
GGACACAGACATTGCGCTCGTGGTGCACCTCGGCATGAGCGGGCAGATGT
TGCTGGGGACCGTGCCTCGCGTCGATCACGTTAGGATCTCTGCGCTGTTC
GACGACGGGACCGTGTTGAACTTCACGGATCAGCGGACCTTAGGGGGATG
GCTGCTAGCCGATCTAATGACGGTGGACGGCAGTGTGCTGCCGGTGCCTG
TCGCCCACTTGGCGCGTGACCCGTTCGATCCGCGGTTCGATGTCGAAGCT
GTAGTGAAAGTGTTGCGGTGCAAGCATTCCGAGCTCAAGCGCCAGCTCCT
CGATCAACAGACAGTATCTGGAATCGGCAACATTTACGCCGATGAGGCGT
TGTGGCGGGCCGAAGTGCACGGCGCGCGAATTGCTGCCACTCTGACCCGT
CGGCAGCTGGCCGCGGTTCTGGATGCTGCCGCCGATGTGATGCGCGACTC
GTTGGCCAAGGGTGGGACTTCGTTCGATTCGCTGTATGTCAACGTCAACG
GCGAATCGGGGTACTTTGACCGATCTTTGGATGCCTATGGTCGTGAAGGC
GAAGGCTGCCGGCGTTGCGGCGCGGTGATGCACCGGGAAAAGTTCATGAA
CCGCTCGTCCTTCTATTGCCCTAGATGCCAACCTCGGCCCCGGCGG
>C1
MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
>C2
MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
>C3
MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
>C4
MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
>C5
MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
>C6
MPELPEVEVVRRGLQDYIVGKTITAVRVHHPRAVRRHVAGPTDLTNRLLG
TRINGIDRRGKYLWFLLDTDIALVVHLGMSGQMLLGTVPRVDHVRISALF
DDGTVLNFTDQRTLGGWLLADLMTVDGSVLPVPVAHLARDPFDPRFDVEA
VVKVLRCKHSELKRQLLDQQTVSGIGNIYADEALWRAEVHGARIAATLTR
RQLAAVLDAAADVMRDSLAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
EGCRRCGAVMHREKFMNRSSFYCPRCQPRPRR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 846 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579788989
Setting output file names to "/data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 718913410
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0302366721
Seed = 1200415383
Swapseed = 1579788989
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1893.388444 -- -24.965149
Chain 2 -- -1893.388554 -- -24.965149
Chain 3 -- -1893.388554 -- -24.965149
Chain 4 -- -1893.388554 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1893.388266 -- -24.965149
Chain 2 -- -1893.388444 -- -24.965149
Chain 3 -- -1893.388554 -- -24.965149
Chain 4 -- -1893.388266 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1893.388] (-1893.389) (-1893.389) (-1893.389) * [-1893.388] (-1893.388) (-1893.389) (-1893.388)
500 -- (-1161.096) [-1166.989] (-1158.622) (-1160.188) * (-1157.659) [-1162.198] (-1180.525) (-1165.898) -- 0:00:00
1000 -- (-1166.775) [-1172.553] (-1168.516) (-1167.243) * (-1161.551) (-1158.784) [-1168.517] (-1172.091) -- 0:00:00
1500 -- [-1160.925] (-1159.829) (-1162.766) (-1162.906) * (-1164.682) (-1162.647) [-1156.876] (-1166.140) -- 0:00:00
2000 -- (-1160.784) [-1157.845] (-1160.328) (-1164.597) * (-1156.612) (-1159.637) [-1158.279] (-1159.475) -- 0:00:00
2500 -- [-1159.119] (-1162.400) (-1167.712) (-1166.442) * [-1158.348] (-1166.481) (-1157.591) (-1159.553) -- 0:00:00
3000 -- (-1161.664) (-1160.963) [-1159.134] (-1169.521) * [-1159.596] (-1161.465) (-1161.642) (-1171.242) -- 0:00:00
3500 -- (-1164.551) (-1161.157) [-1162.040] (-1157.970) * (-1163.828) (-1162.388) [-1158.864] (-1155.583) -- 0:00:00
4000 -- (-1164.856) (-1159.240) [-1156.105] (-1159.691) * [-1162.133] (-1167.148) (-1161.241) (-1166.658) -- 0:00:00
4500 -- (-1162.370) (-1164.063) (-1163.873) [-1160.294] * [-1156.884] (-1156.186) (-1160.179) (-1163.211) -- 0:00:00
5000 -- (-1163.285) (-1165.512) [-1160.510] (-1157.894) * (-1163.929) (-1163.982) (-1157.078) [-1157.017] -- 0:00:00
Average standard deviation of split frequencies: 0.078567
5500 -- [-1155.286] (-1167.926) (-1159.884) (-1159.618) * (-1160.053) (-1168.519) (-1167.169) [-1163.243] -- 0:00:00
6000 -- (-1156.379) (-1161.698) (-1160.003) [-1167.851] * (-1161.384) [-1160.218] (-1165.846) (-1162.848) -- 0:00:00
6500 -- (-1162.580) (-1156.836) (-1160.063) [-1156.176] * (-1164.063) (-1161.753) (-1155.199) [-1159.906] -- 0:02:32
7000 -- (-1165.768) (-1158.537) (-1161.179) [-1160.613] * (-1164.340) (-1157.973) [-1165.156] (-1154.846) -- 0:02:21
7500 -- (-1159.630) (-1159.179) (-1162.119) [-1161.652] * (-1160.806) (-1166.948) (-1163.477) [-1158.484] -- 0:02:12
8000 -- (-1163.418) (-1159.018) (-1162.938) [-1161.210] * (-1165.996) (-1165.256) (-1170.572) [-1163.961] -- 0:02:04
8500 -- [-1155.609] (-1163.088) (-1158.919) (-1164.144) * (-1162.628) [-1162.226] (-1164.941) (-1163.302) -- 0:01:56
9000 -- [-1161.656] (-1165.394) (-1166.904) (-1162.491) * (-1167.510) (-1157.968) [-1159.590] (-1160.878) -- 0:01:50
9500 -- (-1158.263) (-1161.960) [-1159.012] (-1158.913) * (-1160.671) [-1157.577] (-1158.508) (-1168.015) -- 0:01:44
10000 -- [-1157.499] (-1175.650) (-1157.838) (-1161.466) * (-1167.139) [-1162.451] (-1164.592) (-1162.102) -- 0:01:39
Average standard deviation of split frequencies: 0.062274
10500 -- (-1161.496) [-1160.267] (-1161.547) (-1159.702) * (-1160.137) (-1164.598) [-1158.098] (-1155.749) -- 0:01:34
11000 -- [-1152.699] (-1161.159) (-1156.942) (-1167.353) * [-1160.589] (-1158.132) (-1172.195) (-1164.347) -- 0:01:29
11500 -- [-1159.776] (-1170.785) (-1166.811) (-1159.887) * (-1165.748) (-1172.225) [-1160.601] (-1166.591) -- 0:01:25
12000 -- (-1155.348) (-1158.740) [-1161.480] (-1165.863) * (-1161.279) (-1161.980) (-1155.946) [-1165.801] -- 0:01:22
12500 -- [-1156.302] (-1166.482) (-1168.334) (-1167.240) * [-1160.502] (-1161.037) (-1158.677) (-1157.834) -- 0:01:19
13000 -- (-1160.715) [-1160.210] (-1166.335) (-1157.936) * (-1157.627) [-1158.160] (-1170.155) (-1156.075) -- 0:01:15
13500 -- [-1157.091] (-1166.821) (-1159.254) (-1161.616) * (-1164.478) (-1164.773) (-1167.521) [-1160.651] -- 0:01:13
14000 -- (-1158.085) [-1156.000] (-1168.514) (-1157.762) * (-1162.629) [-1156.603] (-1167.308) (-1157.296) -- 0:01:10
14500 -- (-1159.192) (-1157.446) [-1160.838] (-1161.239) * (-1163.688) [-1160.235] (-1166.372) (-1165.157) -- 0:01:07
15000 -- (-1155.970) [-1158.172] (-1168.889) (-1163.916) * (-1159.404) (-1170.118) (-1169.739) [-1165.414] -- 0:01:05
Average standard deviation of split frequencies: 0.068746
15500 -- [-1161.691] (-1158.993) (-1162.013) (-1159.612) * (-1161.488) [-1157.717] (-1165.338) (-1154.757) -- 0:01:03
16000 -- (-1168.158) (-1166.261) [-1158.350] (-1153.929) * (-1157.109) [-1162.904] (-1159.404) (-1159.475) -- 0:01:01
16500 -- (-1162.864) (-1157.056) [-1161.795] (-1157.298) * (-1161.586) (-1171.975) (-1175.027) [-1161.348] -- 0:00:59
17000 -- (-1168.713) (-1167.320) (-1165.760) [-1159.505] * (-1159.832) (-1159.094) (-1163.743) [-1160.815] -- 0:00:57
17500 -- (-1163.344) (-1162.116) (-1159.624) [-1163.553] * (-1159.927) (-1158.094) (-1162.454) [-1157.412] -- 0:00:56
18000 -- (-1158.051) [-1164.374] (-1157.016) (-1156.407) * [-1158.625] (-1158.819) (-1161.872) (-1162.645) -- 0:00:54
18500 -- (-1158.508) (-1162.523) [-1157.740] (-1161.981) * (-1160.194) (-1156.199) [-1162.780] (-1167.502) -- 0:00:53
19000 -- (-1157.864) (-1164.275) (-1162.154) [-1157.665] * (-1164.529) (-1158.526) [-1158.908] (-1152.513) -- 0:00:51
19500 -- (-1157.938) (-1169.575) [-1162.812] (-1157.981) * [-1161.032] (-1170.214) (-1158.545) (-1152.537) -- 0:00:50
20000 -- [-1160.450] (-1169.342) (-1167.076) (-1161.156) * (-1164.470) (-1155.858) [-1161.476] (-1154.064) -- 0:00:49
Average standard deviation of split frequencies: 0.069630
20500 -- (-1155.043) (-1160.579) (-1167.025) [-1161.566] * (-1158.804) [-1156.736] (-1157.411) (-1152.254) -- 0:00:47
21000 -- (-1161.747) (-1169.545) [-1159.121] (-1158.541) * (-1162.525) (-1163.700) [-1159.384] (-1152.595) -- 0:01:33
21500 -- [-1158.851] (-1166.507) (-1163.894) (-1168.399) * (-1163.231) (-1164.139) (-1165.798) [-1152.940] -- 0:01:31
22000 -- (-1160.797) [-1157.739] (-1159.789) (-1163.291) * [-1159.784] (-1159.874) (-1159.484) (-1152.858) -- 0:01:28
22500 -- [-1162.737] (-1158.546) (-1157.738) (-1157.554) * [-1162.297] (-1164.851) (-1160.410) (-1155.182) -- 0:01:26
23000 -- (-1161.124) [-1159.274] (-1164.129) (-1158.011) * (-1167.240) (-1168.819) (-1163.972) [-1152.758] -- 0:01:24
23500 -- [-1163.386] (-1166.425) (-1164.761) (-1159.004) * (-1166.957) [-1157.040] (-1166.745) (-1150.427) -- 0:01:23
24000 -- (-1171.292) (-1162.897) (-1181.016) [-1158.564] * (-1155.770) (-1159.733) (-1165.636) [-1150.450] -- 0:01:21
24500 -- (-1156.401) [-1156.500] (-1156.469) (-1171.455) * [-1162.767] (-1156.268) (-1157.078) (-1152.870) -- 0:01:19
25000 -- (-1164.683) [-1160.791] (-1154.499) (-1165.288) * (-1156.792) (-1158.579) [-1152.788] (-1153.061) -- 0:01:18
Average standard deviation of split frequencies: 0.052816
25500 -- (-1168.299) (-1164.071) (-1150.675) [-1155.782] * [-1162.113] (-1170.930) (-1163.231) (-1154.026) -- 0:01:16
26000 -- (-1164.361) [-1159.410] (-1154.060) (-1165.197) * (-1163.638) (-1175.124) (-1162.961) [-1154.686] -- 0:01:14
26500 -- [-1156.608] (-1173.918) (-1153.109) (-1159.993) * (-1159.430) (-1163.063) (-1169.181) [-1152.055] -- 0:01:13
27000 -- (-1162.730) (-1157.946) (-1153.426) [-1162.478] * (-1158.771) [-1159.945] (-1175.215) (-1152.996) -- 0:01:12
27500 -- (-1160.935) (-1159.691) [-1152.100] (-1169.066) * (-1163.945) (-1157.627) [-1164.650] (-1153.781) -- 0:01:10
28000 -- (-1160.697) (-1167.732) (-1152.793) [-1156.091] * (-1160.256) [-1161.246] (-1158.789) (-1152.012) -- 0:01:09
28500 -- [-1158.208] (-1159.046) (-1152.662) (-1158.074) * (-1158.758) (-1157.102) (-1177.809) [-1153.237] -- 0:01:08
29000 -- (-1158.270) (-1165.663) (-1150.593) [-1159.016] * [-1156.818] (-1172.655) (-1161.973) (-1154.185) -- 0:01:06
29500 -- [-1156.404] (-1165.398) (-1151.440) (-1161.418) * [-1160.405] (-1163.635) (-1158.494) (-1156.368) -- 0:01:05
30000 -- (-1164.077) [-1165.045] (-1152.918) (-1156.305) * (-1158.227) [-1157.851] (-1159.672) (-1150.814) -- 0:01:04
Average standard deviation of split frequencies: 0.055339
30500 -- [-1162.143] (-1162.721) (-1150.603) (-1161.802) * [-1164.420] (-1160.281) (-1156.167) (-1151.146) -- 0:01:03
31000 -- (-1162.381) (-1156.144) (-1151.858) [-1150.930] * [-1160.723] (-1155.130) (-1164.888) (-1152.192) -- 0:01:02
31500 -- (-1161.015) (-1157.978) (-1150.226) [-1152.149] * (-1159.111) (-1158.525) (-1152.763) [-1155.223] -- 0:01:01
32000 -- (-1163.774) (-1162.129) [-1150.305] (-1153.208) * (-1156.647) [-1163.268] (-1152.751) (-1153.895) -- 0:01:00
32500 -- [-1161.374] (-1166.247) (-1150.994) (-1153.787) * (-1162.110) (-1174.253) [-1150.938] (-1156.461) -- 0:00:59
33000 -- (-1166.035) [-1155.953] (-1149.939) (-1152.449) * (-1168.346) [-1166.660] (-1151.788) (-1153.322) -- 0:00:58
33500 -- (-1161.982) (-1159.569) [-1150.108] (-1153.222) * (-1163.083) (-1162.037) (-1151.112) [-1153.745] -- 0:00:57
34000 -- (-1158.563) (-1160.296) (-1151.391) [-1151.015] * (-1162.727) [-1155.128] (-1151.313) (-1153.430) -- 0:00:56
34500 -- [-1156.672] (-1157.282) (-1154.443) (-1150.790) * (-1170.326) [-1159.738] (-1150.731) (-1150.033) -- 0:00:55
35000 -- (-1169.729) [-1163.122] (-1151.829) (-1150.979) * (-1154.616) (-1161.735) (-1152.285) [-1151.366] -- 0:00:55
Average standard deviation of split frequencies: 0.037413
35500 -- (-1166.435) (-1178.661) (-1154.631) [-1153.695] * (-1165.679) [-1159.217] (-1152.545) (-1155.589) -- 0:00:54
36000 -- (-1166.969) [-1157.830] (-1153.395) (-1153.430) * (-1165.341) [-1160.809] (-1150.565) (-1153.634) -- 0:01:20
36500 -- [-1159.058] (-1155.066) (-1152.666) (-1153.774) * (-1160.270) [-1158.187] (-1150.420) (-1151.597) -- 0:01:19
37000 -- (-1167.524) (-1153.492) [-1152.886] (-1158.737) * (-1151.359) [-1160.250] (-1150.856) (-1152.702) -- 0:01:18
37500 -- (-1160.861) [-1155.569] (-1151.658) (-1151.146) * (-1151.494) [-1161.941] (-1151.336) (-1152.297) -- 0:01:17
38000 -- [-1167.050] (-1150.859) (-1150.745) (-1150.409) * (-1152.687) (-1165.209) [-1151.406] (-1158.011) -- 0:01:15
38500 -- (-1168.273) [-1150.878] (-1149.873) (-1150.083) * [-1152.250] (-1164.566) (-1151.156) (-1156.533) -- 0:01:14
39000 -- (-1160.085) (-1151.887) (-1150.160) [-1151.103] * (-1156.458) (-1167.143) [-1151.834] (-1154.041) -- 0:01:13
39500 -- (-1160.227) (-1158.279) (-1150.018) [-1152.032] * (-1153.207) [-1161.152] (-1151.472) (-1151.744) -- 0:01:12
40000 -- (-1175.633) (-1150.663) [-1151.322] (-1151.614) * [-1152.868] (-1159.903) (-1152.498) (-1154.367) -- 0:01:12
Average standard deviation of split frequencies: 0.033037
40500 -- (-1151.730) (-1151.138) [-1151.264] (-1152.116) * [-1153.265] (-1167.892) (-1150.739) (-1159.149) -- 0:01:11
41000 -- [-1151.715] (-1154.724) (-1151.261) (-1153.050) * [-1152.456] (-1163.751) (-1155.331) (-1154.310) -- 0:01:10
41500 -- [-1152.351] (-1155.865) (-1152.080) (-1151.142) * (-1151.486) (-1163.365) (-1153.890) [-1151.440] -- 0:01:09
42000 -- (-1161.859) (-1154.204) (-1151.408) [-1151.243] * (-1151.746) [-1150.107] (-1150.514) (-1150.913) -- 0:01:08
42500 -- (-1153.279) [-1152.713] (-1151.589) (-1154.512) * [-1151.310] (-1151.597) (-1156.729) (-1150.182) -- 0:01:07
43000 -- (-1152.094) [-1153.271] (-1151.886) (-1151.464) * (-1151.320) (-1152.434) [-1150.394] (-1152.932) -- 0:01:06
43500 -- [-1151.883] (-1155.918) (-1151.411) (-1153.509) * [-1150.312] (-1152.011) (-1150.444) (-1150.681) -- 0:01:05
44000 -- (-1153.405) [-1152.716] (-1150.283) (-1153.225) * (-1150.579) (-1153.504) [-1151.644] (-1154.937) -- 0:01:05
44500 -- [-1151.546] (-1152.077) (-1152.920) (-1153.018) * (-1150.624) (-1152.863) [-1154.208] (-1152.817) -- 0:01:04
45000 -- (-1151.476) (-1151.169) (-1152.904) [-1152.421] * (-1150.624) (-1153.828) (-1154.422) [-1151.572] -- 0:01:03
Average standard deviation of split frequencies: 0.028415
45500 -- (-1155.592) (-1151.239) [-1151.527] (-1157.334) * (-1152.054) (-1152.888) [-1153.000] (-1152.511) -- 0:01:02
46000 -- [-1153.833] (-1154.188) (-1151.045) (-1153.140) * (-1151.274) (-1150.390) [-1154.838] (-1152.510) -- 0:01:02
46500 -- (-1153.803) (-1157.916) (-1150.984) [-1154.688] * [-1150.676] (-1150.070) (-1151.563) (-1152.206) -- 0:01:01
47000 -- [-1152.979] (-1154.075) (-1153.610) (-1152.579) * (-1151.073) [-1150.715] (-1157.308) (-1151.251) -- 0:01:00
47500 -- [-1151.498] (-1151.198) (-1151.596) (-1154.616) * [-1152.416] (-1153.393) (-1153.081) (-1153.000) -- 0:01:00
48000 -- [-1150.066] (-1152.902) (-1151.766) (-1152.118) * [-1153.840] (-1150.861) (-1152.756) (-1151.957) -- 0:00:59
48500 -- (-1150.894) (-1152.306) (-1150.815) [-1150.922] * (-1153.871) (-1151.506) (-1151.614) [-1153.118] -- 0:00:58
49000 -- [-1152.154] (-1152.253) (-1150.685) (-1150.904) * (-1152.130) (-1151.118) (-1150.728) [-1152.385] -- 0:00:58
49500 -- (-1152.400) (-1152.335) [-1151.058] (-1154.115) * (-1151.958) [-1151.894] (-1154.156) (-1151.562) -- 0:00:57
50000 -- (-1153.138) (-1151.943) [-1151.550] (-1153.561) * (-1152.067) (-1150.936) [-1151.689] (-1151.625) -- 0:01:16
Average standard deviation of split frequencies: 0.023725
50500 -- (-1152.172) (-1150.383) [-1152.721] (-1152.660) * (-1153.038) [-1150.385] (-1153.077) (-1152.844) -- 0:01:15
51000 -- (-1152.070) [-1150.566] (-1151.718) (-1161.120) * (-1153.385) (-1153.117) (-1153.194) [-1152.720] -- 0:01:14
51500 -- (-1151.827) [-1150.964] (-1151.226) (-1158.493) * (-1151.970) [-1151.941] (-1151.662) (-1153.276) -- 0:01:13
52000 -- (-1153.423) (-1151.126) (-1152.596) [-1152.472] * (-1157.769) [-1152.353] (-1152.964) (-1153.764) -- 0:01:12
52500 -- [-1152.501] (-1153.894) (-1152.261) (-1153.174) * (-1154.625) (-1152.911) [-1152.077] (-1151.981) -- 0:01:12
53000 -- (-1151.624) (-1150.641) (-1152.242) [-1151.718] * [-1150.634] (-1152.202) (-1151.387) (-1153.589) -- 0:01:11
53500 -- (-1151.502) (-1151.815) [-1150.758] (-1153.546) * [-1151.511] (-1151.701) (-1152.407) (-1155.157) -- 0:01:10
54000 -- (-1154.818) (-1153.643) [-1150.619] (-1157.880) * (-1151.604) [-1151.080] (-1150.620) (-1153.724) -- 0:01:10
54500 -- [-1152.025] (-1156.096) (-1150.040) (-1155.736) * [-1151.354] (-1153.925) (-1151.869) (-1152.918) -- 0:01:09
55000 -- [-1152.690] (-1151.174) (-1150.583) (-1155.106) * [-1152.117] (-1157.018) (-1150.404) (-1151.751) -- 0:01:08
Average standard deviation of split frequencies: 0.018840
55500 -- [-1151.509] (-1151.377) (-1150.754) (-1150.811) * [-1153.069] (-1158.707) (-1151.672) (-1153.953) -- 0:01:08
56000 -- (-1153.012) [-1151.246] (-1150.731) (-1150.200) * (-1152.029) [-1154.408] (-1153.042) (-1153.036) -- 0:01:07
56500 -- (-1151.855) (-1151.290) [-1150.990] (-1150.636) * (-1152.458) (-1152.638) (-1152.326) [-1150.742] -- 0:01:06
57000 -- (-1151.974) (-1152.803) [-1150.522] (-1151.690) * (-1157.075) (-1155.425) (-1152.316) [-1151.193] -- 0:01:06
57500 -- (-1151.972) [-1150.607] (-1150.967) (-1151.416) * [-1150.254] (-1155.124) (-1150.881) (-1152.086) -- 0:01:05
58000 -- (-1151.761) (-1155.841) (-1151.791) [-1153.283] * (-1154.657) (-1151.674) [-1152.272] (-1151.980) -- 0:01:04
58500 -- (-1152.887) (-1151.943) [-1151.244] (-1150.097) * (-1152.966) (-1151.287) (-1150.778) [-1151.490] -- 0:01:04
59000 -- [-1154.277] (-1152.182) (-1155.237) (-1153.648) * (-1151.934) (-1150.441) (-1150.937) [-1152.461] -- 0:01:03
59500 -- (-1153.328) (-1156.607) (-1150.731) [-1150.685] * (-1154.396) (-1151.925) [-1151.098] (-1151.448) -- 0:01:03
60000 -- (-1153.003) (-1154.757) (-1151.260) [-1151.145] * [-1151.200] (-1151.159) (-1152.460) (-1150.867) -- 0:01:02
Average standard deviation of split frequencies: 0.020289
60500 -- [-1152.935] (-1152.425) (-1150.850) (-1156.572) * (-1155.740) [-1150.893] (-1151.135) (-1151.391) -- 0:01:02
61000 -- (-1156.012) (-1152.019) [-1154.194] (-1153.797) * [-1152.876] (-1151.966) (-1153.184) (-1150.412) -- 0:01:01
61500 -- [-1151.370] (-1151.506) (-1153.151) (-1152.949) * (-1154.570) (-1152.503) [-1153.673] (-1151.662) -- 0:01:01
62000 -- (-1150.203) (-1152.940) [-1151.988] (-1153.907) * (-1153.184) (-1151.043) (-1151.135) [-1151.853] -- 0:01:00
62500 -- (-1150.735) [-1151.010] (-1155.248) (-1153.339) * [-1149.895] (-1151.690) (-1150.428) (-1152.364) -- 0:01:00
63000 -- (-1152.009) (-1150.372) (-1153.369) [-1150.764] * (-1149.921) (-1155.687) (-1155.575) [-1153.037] -- 0:00:59
63500 -- (-1153.070) (-1152.272) (-1152.623) [-1151.865] * (-1152.089) (-1152.571) (-1151.268) [-1152.387] -- 0:00:58
64000 -- (-1151.511) (-1154.008) (-1152.692) [-1150.959] * (-1154.465) (-1151.063) (-1152.540) [-1152.328] -- 0:01:13
64500 -- [-1150.146] (-1158.511) (-1151.733) (-1151.735) * (-1154.259) [-1150.887] (-1156.130) (-1153.396) -- 0:01:12
65000 -- (-1151.386) (-1152.142) [-1153.417] (-1154.517) * (-1153.991) (-1150.960) [-1149.968] (-1152.761) -- 0:01:11
Average standard deviation of split frequencies: 0.019727
65500 -- [-1154.034] (-1152.857) (-1151.865) (-1153.774) * (-1152.777) (-1150.968) [-1152.084] (-1158.122) -- 0:01:11
66000 -- [-1150.480] (-1152.759) (-1153.904) (-1151.748) * (-1152.656) [-1153.614] (-1154.365) (-1160.500) -- 0:01:10
66500 -- [-1150.691] (-1154.308) (-1151.097) (-1151.573) * (-1154.244) [-1152.833] (-1155.846) (-1153.383) -- 0:01:10
67000 -- (-1152.755) (-1156.926) [-1151.123] (-1150.283) * (-1151.640) (-1150.655) [-1152.032] (-1151.871) -- 0:01:09
67500 -- [-1155.011] (-1156.865) (-1151.169) (-1151.394) * (-1151.851) (-1151.485) (-1153.097) [-1151.128] -- 0:01:09
68000 -- (-1151.390) (-1154.821) (-1152.991) [-1153.226] * [-1151.995] (-1150.675) (-1159.201) (-1150.918) -- 0:01:08
68500 -- (-1152.196) [-1154.538] (-1154.860) (-1152.714) * (-1151.986) (-1150.647) [-1155.934] (-1151.692) -- 0:01:07
69000 -- (-1151.624) (-1152.247) [-1156.186] (-1150.548) * [-1151.791] (-1151.663) (-1153.814) (-1151.134) -- 0:01:07
69500 -- (-1151.878) [-1153.373] (-1152.401) (-1150.405) * [-1151.132] (-1150.613) (-1155.261) (-1150.866) -- 0:01:06
70000 -- [-1151.179] (-1152.370) (-1151.488) (-1152.935) * (-1150.372) (-1152.170) [-1154.355] (-1151.364) -- 0:01:06
Average standard deviation of split frequencies: 0.019679
70500 -- (-1150.981) (-1160.516) [-1150.039] (-1150.623) * (-1150.898) (-1152.144) [-1154.689] (-1152.196) -- 0:01:05
71000 -- [-1154.040] (-1152.739) (-1151.362) (-1152.824) * (-1154.661) (-1151.616) (-1155.989) [-1150.398] -- 0:01:05
71500 -- (-1157.258) (-1153.832) (-1151.946) [-1152.469] * (-1158.593) [-1152.213] (-1150.883) (-1151.287) -- 0:01:04
72000 -- [-1157.348] (-1152.187) (-1155.602) (-1151.871) * (-1156.056) [-1151.996] (-1152.220) (-1150.905) -- 0:01:04
72500 -- (-1154.270) (-1151.861) [-1154.917] (-1152.215) * (-1160.150) (-1151.709) [-1151.721] (-1153.380) -- 0:01:03
73000 -- [-1151.502] (-1151.630) (-1154.594) (-1152.216) * (-1153.952) (-1151.728) [-1154.967] (-1151.303) -- 0:01:03
73500 -- (-1152.035) (-1152.078) [-1151.795] (-1151.105) * (-1154.795) (-1152.120) (-1152.511) [-1150.976] -- 0:01:03
74000 -- (-1154.721) (-1152.976) [-1151.504] (-1150.588) * [-1153.840] (-1151.348) (-1152.328) (-1154.465) -- 0:01:02
74500 -- (-1151.957) (-1150.717) [-1152.211] (-1150.676) * [-1153.037] (-1154.773) (-1156.560) (-1152.501) -- 0:01:02
75000 -- [-1152.249] (-1151.169) (-1152.943) (-1150.601) * (-1150.139) (-1154.523) (-1154.945) [-1152.703] -- 0:01:01
Average standard deviation of split frequencies: 0.015996
75500 -- (-1152.932) [-1152.094] (-1153.703) (-1150.629) * [-1150.504] (-1149.983) (-1156.964) (-1152.100) -- 0:01:01
76000 -- (-1151.927) [-1150.946] (-1151.343) (-1153.611) * (-1151.963) [-1151.049] (-1151.483) (-1154.627) -- 0:01:00
76500 -- (-1153.961) [-1150.109] (-1152.796) (-1153.613) * (-1150.278) [-1151.130] (-1151.379) (-1152.005) -- 0:01:00
77000 -- (-1151.233) (-1154.755) [-1152.211] (-1152.529) * (-1150.285) (-1150.002) [-1150.474] (-1151.878) -- 0:00:59
77500 -- (-1150.434) [-1152.864] (-1151.628) (-1150.451) * [-1150.545] (-1150.773) (-1152.382) (-1154.897) -- 0:00:59
78000 -- (-1150.223) (-1151.486) [-1151.156] (-1153.111) * [-1150.049] (-1150.385) (-1154.093) (-1154.981) -- 0:00:59
78500 -- (-1153.419) (-1153.399) (-1151.305) [-1152.128] * [-1150.968] (-1152.308) (-1151.673) (-1153.034) -- 0:00:58
79000 -- [-1151.204] (-1151.769) (-1152.032) (-1152.170) * (-1150.465) [-1150.057] (-1151.214) (-1154.157) -- 0:00:58
79500 -- [-1152.965] (-1152.008) (-1150.945) (-1152.182) * (-1151.133) (-1152.106) [-1154.489] (-1153.156) -- 0:00:57
80000 -- (-1152.542) (-1153.838) (-1151.732) [-1151.337] * (-1150.794) (-1152.812) [-1151.179] (-1153.830) -- 0:00:57
Average standard deviation of split frequencies: 0.017839
80500 -- (-1152.909) (-1150.872) (-1151.503) [-1152.028] * (-1152.811) (-1153.026) (-1151.515) [-1153.953] -- 0:01:08
81000 -- (-1151.829) (-1151.277) [-1154.716] (-1150.878) * (-1152.093) (-1150.857) [-1154.400] (-1155.112) -- 0:01:08
81500 -- (-1151.063) (-1150.783) [-1152.212] (-1151.186) * [-1151.538] (-1153.023) (-1153.200) (-1152.322) -- 0:01:07
82000 -- [-1150.495] (-1150.694) (-1154.018) (-1152.328) * (-1152.941) (-1153.166) [-1151.337] (-1152.542) -- 0:01:07
82500 -- (-1150.401) [-1150.875] (-1152.409) (-1150.751) * [-1150.716] (-1153.603) (-1152.296) (-1151.989) -- 0:01:06
83000 -- (-1155.851) [-1152.043] (-1151.301) (-1151.336) * [-1152.150] (-1157.182) (-1151.476) (-1153.374) -- 0:01:06
83500 -- [-1153.624] (-1153.800) (-1150.045) (-1152.640) * (-1151.235) (-1155.151) (-1152.918) [-1150.554] -- 0:01:05
84000 -- [-1152.320] (-1155.248) (-1150.272) (-1156.889) * (-1150.993) (-1153.620) (-1154.769) [-1150.694] -- 0:01:05
84500 -- [-1151.073] (-1150.364) (-1154.063) (-1151.326) * (-1151.610) [-1151.646] (-1152.994) (-1151.073) -- 0:01:05
85000 -- [-1152.980] (-1150.966) (-1151.296) (-1152.284) * (-1152.091) [-1150.673] (-1150.855) (-1156.618) -- 0:01:04
Average standard deviation of split frequencies: 0.017815
85500 -- [-1154.056] (-1151.700) (-1152.050) (-1150.834) * (-1153.195) (-1152.567) (-1150.863) [-1152.376] -- 0:01:04
86000 -- (-1151.448) (-1150.628) (-1151.114) [-1150.579] * (-1154.270) (-1152.856) (-1155.498) [-1152.770] -- 0:01:03
86500 -- [-1153.522] (-1155.418) (-1158.913) (-1151.858) * (-1152.870) (-1153.473) (-1154.446) [-1150.618] -- 0:01:03
87000 -- (-1151.417) (-1150.534) (-1152.422) [-1151.655] * (-1152.899) [-1150.499] (-1153.317) (-1151.596) -- 0:01:02
87500 -- (-1156.883) (-1154.760) [-1151.931] (-1151.031) * (-1151.817) (-1150.546) [-1154.968] (-1150.564) -- 0:01:02
88000 -- (-1151.961) (-1152.483) [-1150.615] (-1152.106) * [-1150.946] (-1151.741) (-1151.286) (-1150.605) -- 0:01:02
88500 -- (-1152.853) (-1156.156) [-1154.553] (-1152.107) * (-1151.297) [-1151.483] (-1152.788) (-1151.643) -- 0:01:01
89000 -- (-1151.877) [-1151.049] (-1152.755) (-1154.120) * (-1150.946) (-1152.245) (-1154.131) [-1150.629] -- 0:01:01
89500 -- (-1151.741) [-1151.788] (-1154.018) (-1150.834) * [-1155.349] (-1153.589) (-1152.263) (-1150.880) -- 0:01:01
90000 -- [-1152.371] (-1150.716) (-1154.203) (-1156.456) * (-1152.442) [-1151.571] (-1151.974) (-1150.877) -- 0:01:00
Average standard deviation of split frequencies: 0.019429
90500 -- (-1150.782) (-1150.007) (-1151.662) [-1152.225] * [-1153.643] (-1150.794) (-1151.121) (-1154.960) -- 0:01:00
91000 -- [-1153.318] (-1149.771) (-1152.796) (-1153.152) * (-1153.658) (-1152.229) [-1151.101] (-1150.887) -- 0:00:59
91500 -- (-1152.001) [-1153.143] (-1150.870) (-1155.265) * (-1152.280) (-1152.614) [-1151.098] (-1152.482) -- 0:00:59
92000 -- (-1150.711) (-1151.777) [-1152.816] (-1156.020) * (-1154.307) [-1154.420] (-1153.911) (-1153.561) -- 0:00:59
92500 -- [-1151.264] (-1150.593) (-1154.155) (-1152.924) * (-1153.838) [-1152.643] (-1153.392) (-1152.571) -- 0:00:58
93000 -- (-1153.513) (-1150.030) (-1151.541) [-1151.303] * [-1153.175] (-1150.945) (-1150.968) (-1152.864) -- 0:00:58
93500 -- (-1151.754) [-1151.018] (-1152.345) (-1152.923) * [-1151.279] (-1151.285) (-1154.066) (-1151.871) -- 0:00:58
94000 -- (-1151.280) [-1150.983] (-1151.826) (-1152.735) * [-1151.808] (-1150.334) (-1151.454) (-1151.912) -- 0:00:57
94500 -- (-1153.597) (-1152.300) (-1154.374) [-1150.838] * (-1152.482) (-1149.964) [-1150.402] (-1152.174) -- 0:00:57
95000 -- (-1154.911) (-1152.721) (-1151.501) [-1155.508] * (-1154.486) [-1152.450] (-1151.635) (-1152.066) -- 0:00:57
Average standard deviation of split frequencies: 0.020869
95500 -- (-1152.941) [-1150.133] (-1150.864) (-1154.058) * (-1152.441) (-1151.118) (-1151.553) [-1152.554] -- 0:00:56
96000 -- (-1157.044) (-1150.205) [-1153.869] (-1150.541) * [-1154.064] (-1152.595) (-1151.289) (-1151.153) -- 0:00:56
96500 -- (-1151.093) [-1150.777] (-1153.790) (-1150.321) * (-1154.009) (-1157.095) (-1152.100) [-1151.386] -- 0:01:05
97000 -- (-1153.560) (-1154.449) (-1152.003) [-1150.050] * (-1152.337) [-1150.518] (-1152.354) (-1155.649) -- 0:01:05
97500 -- (-1152.926) (-1151.345) (-1151.170) [-1156.588] * (-1150.847) [-1151.003] (-1153.799) (-1158.027) -- 0:01:04
98000 -- (-1152.236) [-1156.167] (-1153.130) (-1150.673) * [-1150.683] (-1151.444) (-1154.521) (-1152.324) -- 0:01:04
98500 -- [-1153.118] (-1155.406) (-1154.297) (-1150.602) * (-1151.235) [-1150.572] (-1151.186) (-1153.945) -- 0:01:04
99000 -- (-1155.576) (-1156.598) [-1152.229] (-1150.895) * (-1152.245) [-1149.905] (-1150.443) (-1150.776) -- 0:01:03
99500 -- [-1150.307] (-1152.406) (-1152.689) (-1151.093) * (-1152.681) (-1151.630) [-1151.900] (-1150.871) -- 0:01:03
100000 -- (-1150.789) (-1153.903) (-1152.219) [-1151.877] * (-1154.913) [-1151.428] (-1150.957) (-1152.201) -- 0:01:02
Average standard deviation of split frequencies: 0.022946
100500 -- (-1152.852) (-1154.142) (-1152.803) [-1152.167] * (-1154.269) (-1152.119) (-1152.222) [-1152.285] -- 0:01:02
101000 -- [-1151.553] (-1152.873) (-1151.765) (-1157.010) * (-1152.888) (-1151.260) (-1153.417) [-1149.989] -- 0:01:02
101500 -- (-1153.934) [-1150.674] (-1150.470) (-1150.525) * (-1150.514) (-1151.207) (-1151.977) [-1152.671] -- 0:01:01
102000 -- (-1153.950) [-1152.396] (-1152.687) (-1151.673) * (-1153.996) (-1150.909) (-1152.823) [-1153.492] -- 0:01:01
102500 -- (-1154.908) (-1156.651) (-1153.080) [-1151.701] * (-1154.449) (-1151.800) (-1155.837) [-1153.656] -- 0:01:01
103000 -- [-1155.143] (-1154.854) (-1153.956) (-1152.771) * (-1155.348) (-1151.400) [-1153.750] (-1157.996) -- 0:01:00
103500 -- (-1156.755) (-1153.718) [-1151.032] (-1151.092) * (-1156.095) (-1157.035) [-1150.835] (-1152.534) -- 0:01:00
104000 -- [-1153.198] (-1154.458) (-1150.722) (-1155.217) * (-1154.994) (-1156.402) [-1152.250] (-1155.721) -- 0:01:00
104500 -- (-1155.832) (-1154.725) (-1151.435) [-1151.351] * (-1153.594) (-1150.170) [-1150.644] (-1153.230) -- 0:00:59
105000 -- (-1155.099) (-1151.951) (-1151.176) [-1155.353] * [-1150.650] (-1151.421) (-1151.690) (-1152.059) -- 0:00:59
Average standard deviation of split frequencies: 0.021347
105500 -- (-1155.242) [-1151.218] (-1153.583) (-1151.217) * [-1151.025] (-1152.679) (-1154.408) (-1152.450) -- 0:00:59
106000 -- (-1160.035) (-1152.446) [-1154.290] (-1151.689) * (-1152.296) (-1151.582) (-1153.950) [-1151.939] -- 0:00:59
106500 -- (-1152.097) [-1153.350] (-1153.648) (-1151.767) * (-1152.813) (-1154.189) (-1156.766) [-1153.218] -- 0:00:58
107000 -- (-1150.914) (-1150.057) [-1158.044] (-1151.249) * (-1151.927) (-1155.440) [-1155.003] (-1154.696) -- 0:00:58
107500 -- (-1151.638) (-1151.926) (-1150.966) [-1150.983] * (-1150.678) [-1151.670] (-1153.719) (-1156.000) -- 0:00:58
108000 -- [-1152.318] (-1154.823) (-1149.762) (-1149.985) * (-1154.968) (-1152.312) (-1153.022) [-1156.391] -- 0:00:57
108500 -- (-1151.462) (-1152.457) (-1151.580) [-1154.403] * (-1152.279) [-1150.195] (-1150.514) (-1151.745) -- 0:00:57
109000 -- (-1151.706) [-1151.821] (-1151.719) (-1151.945) * (-1153.190) [-1150.385] (-1151.088) (-1155.581) -- 0:00:57
109500 -- (-1152.625) [-1153.119] (-1153.092) (-1152.827) * (-1152.063) [-1150.025] (-1150.493) (-1151.093) -- 0:00:56
110000 -- (-1153.204) (-1154.101) [-1151.192] (-1156.211) * (-1155.067) (-1150.015) [-1154.355] (-1150.707) -- 0:00:56
Average standard deviation of split frequencies: 0.021937
110500 -- (-1152.770) (-1155.717) [-1152.149] (-1156.946) * (-1155.746) (-1151.505) [-1151.208] (-1152.046) -- 0:00:56
111000 -- [-1152.067] (-1150.657) (-1154.576) (-1151.387) * (-1152.040) (-1151.321) [-1150.618] (-1150.733) -- 0:00:56
111500 -- [-1154.527] (-1151.577) (-1153.547) (-1152.833) * (-1155.304) (-1149.983) (-1151.494) [-1150.182] -- 0:00:55
112000 -- (-1154.440) (-1151.408) [-1151.031] (-1152.833) * (-1151.972) (-1152.296) [-1151.401] (-1151.066) -- 0:00:55
112500 -- (-1156.452) (-1153.152) (-1153.342) [-1151.486] * [-1153.165] (-1154.252) (-1152.580) (-1150.953) -- 0:01:03
113000 -- (-1156.948) [-1153.631] (-1152.241) (-1151.052) * (-1152.924) (-1151.640) [-1152.187] (-1151.832) -- 0:01:02
113500 -- (-1153.411) (-1152.218) [-1151.322] (-1151.262) * (-1153.399) (-1150.464) [-1150.973] (-1151.284) -- 0:01:02
114000 -- [-1152.635] (-1152.730) (-1153.073) (-1149.920) * (-1152.477) (-1151.717) [-1150.764] (-1154.975) -- 0:01:02
114500 -- (-1151.600) [-1154.502] (-1150.808) (-1151.833) * (-1151.354) (-1151.520) (-1153.669) [-1152.476] -- 0:01:01
115000 -- [-1150.369] (-1153.199) (-1153.512) (-1150.065) * (-1151.527) (-1151.867) [-1153.709] (-1150.973) -- 0:01:01
Average standard deviation of split frequencies: 0.021742
115500 -- [-1150.383] (-1153.686) (-1152.008) (-1151.207) * [-1153.297] (-1153.041) (-1153.793) (-1150.415) -- 0:01:01
116000 -- (-1150.198) [-1151.480] (-1150.556) (-1151.262) * (-1155.190) [-1153.444] (-1150.579) (-1150.374) -- 0:01:00
116500 -- [-1150.438] (-1153.192) (-1151.935) (-1151.264) * (-1152.127) (-1150.373) (-1151.415) [-1150.782] -- 0:01:00
117000 -- (-1150.065) [-1155.050] (-1151.406) (-1156.371) * (-1153.268) (-1149.938) [-1151.298] (-1151.197) -- 0:01:00
117500 -- (-1153.711) [-1152.764] (-1151.346) (-1152.601) * (-1151.955) (-1150.256) (-1151.143) [-1150.732] -- 0:01:00
118000 -- (-1152.537) [-1154.309] (-1154.098) (-1153.890) * (-1151.135) [-1151.680] (-1152.240) (-1151.662) -- 0:00:59
118500 -- (-1155.044) [-1149.867] (-1153.448) (-1152.090) * (-1150.883) (-1154.635) [-1151.310] (-1151.702) -- 0:00:59
119000 -- (-1156.129) [-1150.605] (-1151.983) (-1151.707) * (-1151.643) [-1154.547] (-1150.752) (-1153.364) -- 0:00:59
119500 -- (-1152.676) [-1155.918] (-1155.515) (-1156.348) * (-1152.864) (-1155.568) (-1150.832) [-1153.762] -- 0:00:58
120000 -- (-1154.917) (-1152.196) [-1153.183] (-1152.319) * [-1151.551] (-1156.018) (-1151.808) (-1151.690) -- 0:00:58
Average standard deviation of split frequencies: 0.023440
120500 -- (-1151.346) (-1152.193) (-1154.231) [-1152.053] * [-1151.666] (-1158.038) (-1153.561) (-1153.977) -- 0:00:58
121000 -- (-1152.754) (-1151.216) [-1152.475] (-1154.473) * [-1152.006] (-1153.504) (-1152.143) (-1154.429) -- 0:00:58
121500 -- (-1153.150) (-1150.723) (-1152.203) [-1150.581] * (-1153.871) (-1155.825) (-1151.568) [-1153.363] -- 0:00:57
122000 -- (-1152.157) (-1150.913) [-1155.651] (-1155.162) * (-1162.324) (-1152.136) [-1151.390] (-1152.402) -- 0:00:57
122500 -- (-1154.792) [-1152.702] (-1154.653) (-1155.775) * (-1153.348) (-1152.870) (-1153.279) [-1151.690] -- 0:00:57
123000 -- [-1153.339] (-1153.890) (-1154.296) (-1154.621) * (-1150.728) [-1155.870] (-1154.749) (-1153.386) -- 0:00:57
123500 -- (-1153.517) [-1150.983] (-1156.018) (-1151.908) * (-1152.914) [-1152.284] (-1153.270) (-1157.065) -- 0:00:56
124000 -- (-1151.364) (-1153.495) (-1155.493) [-1151.071] * (-1153.935) (-1150.994) (-1152.474) [-1151.442] -- 0:00:56
124500 -- [-1152.791] (-1152.376) (-1152.319) (-1152.400) * [-1151.603] (-1149.996) (-1152.578) (-1151.119) -- 0:00:56
125000 -- (-1151.454) (-1151.768) [-1153.177] (-1155.713) * (-1150.842) (-1150.972) (-1152.126) [-1152.694] -- 0:00:56
Average standard deviation of split frequencies: 0.025833
125500 -- (-1151.307) [-1151.650] (-1155.363) (-1151.617) * (-1152.394) (-1150.670) (-1150.505) [-1155.839] -- 0:00:55
126000 -- (-1155.928) [-1152.830] (-1151.454) (-1155.597) * [-1151.971] (-1150.447) (-1156.857) (-1152.868) -- 0:00:55
126500 -- (-1155.538) [-1151.987] (-1153.820) (-1152.007) * (-1152.999) [-1150.774] (-1154.226) (-1151.625) -- 0:00:55
127000 -- (-1154.290) [-1159.112] (-1153.476) (-1151.871) * (-1155.717) [-1150.703] (-1151.293) (-1151.856) -- 0:00:54
127500 -- (-1151.862) (-1153.993) [-1152.155] (-1154.878) * (-1154.606) [-1152.329] (-1150.703) (-1152.825) -- 0:00:54
128000 -- [-1154.756] (-1151.215) (-1150.875) (-1151.146) * (-1153.745) [-1153.573] (-1153.164) (-1151.755) -- 0:00:54
128500 -- (-1149.665) [-1150.150] (-1153.504) (-1153.310) * (-1154.675) (-1153.306) [-1151.235] (-1152.016) -- 0:00:54
129000 -- (-1151.838) (-1150.917) (-1156.443) [-1156.086] * [-1152.892] (-1152.639) (-1150.166) (-1152.800) -- 0:01:00
129500 -- [-1151.233] (-1151.779) (-1153.579) (-1151.907) * (-1157.288) (-1155.465) [-1150.241] (-1154.080) -- 0:01:00
130000 -- [-1153.672] (-1151.444) (-1153.187) (-1150.877) * (-1155.244) (-1151.443) (-1151.021) [-1152.209] -- 0:01:00
Average standard deviation of split frequencies: 0.022368
130500 -- (-1150.572) (-1153.868) (-1151.799) [-1150.740] * (-1152.990) (-1151.536) [-1151.239] (-1153.267) -- 0:00:59
131000 -- (-1152.121) [-1151.020] (-1156.728) (-1150.883) * (-1152.077) (-1152.556) [-1150.952] (-1153.911) -- 0:00:59
131500 -- (-1150.166) (-1153.636) [-1150.109] (-1156.770) * (-1151.282) (-1152.876) [-1154.504] (-1158.436) -- 0:00:59
132000 -- (-1151.395) (-1153.139) [-1151.972] (-1158.748) * (-1151.587) (-1152.836) (-1153.941) [-1152.503] -- 0:00:59
132500 -- (-1151.345) (-1151.457) (-1154.524) [-1155.888] * [-1155.071] (-1154.324) (-1157.090) (-1154.374) -- 0:00:58
133000 -- (-1152.252) (-1153.417) [-1151.888] (-1156.123) * (-1150.924) (-1152.898) [-1150.967] (-1154.342) -- 0:00:58
133500 -- (-1152.661) (-1151.580) [-1152.402] (-1155.134) * [-1150.936] (-1152.484) (-1151.273) (-1150.965) -- 0:00:58
134000 -- (-1150.786) (-1151.659) (-1152.295) [-1150.235] * (-1151.663) (-1153.176) (-1153.250) [-1151.854] -- 0:00:58
134500 -- (-1151.747) (-1151.213) [-1152.010] (-1150.237) * (-1153.374) [-1151.912] (-1155.615) (-1150.774) -- 0:00:57
135000 -- [-1150.368] (-1152.979) (-1151.464) (-1150.173) * (-1152.691) (-1151.897) [-1159.024] (-1151.539) -- 0:00:57
Average standard deviation of split frequencies: 0.021837
135500 -- (-1151.038) (-1157.086) [-1150.867] (-1156.245) * (-1155.718) (-1150.591) (-1154.981) [-1151.321] -- 0:00:57
136000 -- [-1151.845] (-1150.891) (-1152.194) (-1154.968) * (-1152.833) (-1152.423) [-1153.506] (-1152.030) -- 0:00:57
136500 -- (-1152.483) (-1151.283) (-1151.138) [-1151.472] * (-1153.450) [-1152.946] (-1153.180) (-1151.985) -- 0:00:56
137000 -- (-1150.370) (-1151.340) (-1151.138) [-1151.773] * (-1151.470) (-1152.859) (-1153.411) [-1151.267] -- 0:00:56
137500 -- (-1152.934) [-1151.087] (-1151.518) (-1153.609) * (-1150.247) [-1150.480] (-1156.496) (-1151.920) -- 0:00:56
138000 -- (-1150.345) (-1150.756) [-1151.021] (-1154.769) * (-1151.639) [-1152.045] (-1152.135) (-1150.785) -- 0:00:56
138500 -- [-1150.835] (-1155.602) (-1155.000) (-1151.814) * (-1153.940) (-1152.133) (-1150.206) [-1153.144] -- 0:00:55
139000 -- (-1153.811) [-1152.033] (-1151.724) (-1151.909) * (-1151.205) (-1150.982) [-1152.209] (-1155.159) -- 0:00:55
139500 -- [-1152.287] (-1152.404) (-1151.530) (-1151.608) * (-1151.171) (-1153.945) (-1152.666) [-1151.262] -- 0:00:55
140000 -- (-1153.991) (-1150.743) [-1151.105] (-1151.273) * [-1151.058] (-1153.456) (-1152.270) (-1150.847) -- 0:00:55
Average standard deviation of split frequencies: 0.024129
140500 -- (-1152.335) (-1150.780) [-1156.151] (-1150.647) * (-1153.094) (-1152.310) [-1151.903] (-1152.927) -- 0:00:55
141000 -- [-1157.112] (-1153.255) (-1153.393) (-1150.554) * [-1153.882] (-1151.838) (-1153.118) (-1156.004) -- 0:00:54
141500 -- (-1152.161) (-1150.400) (-1155.564) [-1150.246] * (-1151.069) (-1150.996) (-1152.292) [-1151.189] -- 0:00:54
142000 -- (-1152.964) (-1151.739) [-1154.762] (-1151.754) * (-1150.251) (-1151.201) [-1152.275] (-1151.908) -- 0:00:54
142500 -- (-1153.051) (-1152.032) (-1152.852) [-1151.554] * [-1151.059] (-1153.122) (-1151.812) (-1151.570) -- 0:00:54
143000 -- [-1153.065] (-1151.703) (-1151.926) (-1151.187) * (-1154.498) [-1152.239] (-1151.075) (-1153.506) -- 0:00:53
143500 -- (-1152.849) (-1152.588) [-1155.842] (-1150.953) * (-1153.755) (-1154.702) [-1150.774] (-1151.811) -- 0:00:53
144000 -- (-1152.445) [-1153.333] (-1156.198) (-1154.343) * [-1153.080] (-1151.060) (-1152.813) (-1151.525) -- 0:00:53
144500 -- (-1152.540) (-1152.945) [-1152.646] (-1152.330) * (-1150.618) [-1154.010] (-1152.100) (-1152.888) -- 0:00:53
145000 -- (-1151.858) (-1155.873) [-1149.936] (-1151.805) * (-1152.898) [-1150.733] (-1153.273) (-1151.744) -- 0:00:53
Average standard deviation of split frequencies: 0.025369
145500 -- (-1153.406) (-1154.106) (-1150.486) [-1153.472] * (-1156.175) (-1152.417) (-1150.626) [-1151.688] -- 0:00:58
146000 -- (-1152.741) (-1151.989) [-1151.164] (-1150.355) * (-1158.144) (-1151.546) (-1149.958) [-1152.328] -- 0:00:58
146500 -- [-1153.576] (-1150.893) (-1151.885) (-1152.931) * [-1151.253] (-1151.202) (-1150.006) (-1155.441) -- 0:00:58
147000 -- (-1151.004) [-1151.798] (-1151.059) (-1156.352) * (-1150.172) [-1151.570] (-1153.340) (-1154.062) -- 0:00:58
147500 -- (-1156.319) [-1152.284] (-1151.473) (-1160.342) * (-1150.513) (-1152.105) (-1154.782) [-1150.704] -- 0:00:57
148000 -- (-1151.421) (-1154.337) (-1157.348) [-1156.381] * (-1150.151) (-1151.164) (-1152.167) [-1150.746] -- 0:00:57
148500 -- (-1155.759) (-1153.999) [-1151.519] (-1155.262) * (-1150.827) (-1153.139) (-1150.909) [-1150.157] -- 0:00:57
149000 -- [-1153.501] (-1154.960) (-1154.263) (-1152.753) * (-1151.069) (-1151.708) (-1152.130) [-1150.063] -- 0:00:57
149500 -- [-1151.060] (-1156.773) (-1154.806) (-1152.548) * (-1149.962) (-1152.622) [-1151.228] (-1151.129) -- 0:00:56
150000 -- (-1153.617) (-1153.060) [-1150.134] (-1150.854) * (-1155.841) (-1154.107) (-1150.554) [-1156.415] -- 0:00:56
Average standard deviation of split frequencies: 0.024732
150500 -- (-1157.933) (-1153.698) (-1151.695) [-1154.329] * (-1151.881) (-1152.191) [-1150.717] (-1150.072) -- 0:00:56
151000 -- (-1150.467) (-1151.758) [-1150.854] (-1152.006) * (-1152.470) (-1151.603) [-1152.623] (-1150.055) -- 0:00:56
151500 -- (-1150.586) [-1152.765] (-1150.449) (-1159.009) * (-1152.596) [-1151.001] (-1153.836) (-1151.020) -- 0:00:56
152000 -- (-1151.133) (-1152.489) (-1151.781) [-1155.931] * (-1151.069) (-1151.506) (-1152.014) [-1150.396] -- 0:00:55
152500 -- [-1153.901] (-1151.011) (-1151.541) (-1152.171) * (-1152.325) (-1152.015) (-1150.238) [-1151.043] -- 0:00:55
153000 -- (-1159.838) [-1151.149] (-1151.330) (-1153.865) * (-1152.405) [-1150.783] (-1153.454) (-1151.712) -- 0:00:55
153500 -- (-1152.041) [-1152.185] (-1151.976) (-1155.757) * [-1152.719] (-1150.664) (-1149.868) (-1152.252) -- 0:00:55
154000 -- (-1151.036) (-1150.592) [-1150.053] (-1157.848) * (-1153.360) (-1151.691) (-1154.035) [-1151.254] -- 0:00:54
154500 -- (-1153.827) (-1151.022) [-1150.646] (-1155.163) * (-1149.890) (-1152.016) (-1151.118) [-1151.416] -- 0:00:54
155000 -- (-1158.036) (-1150.425) [-1151.517] (-1154.629) * [-1149.890] (-1152.078) (-1153.119) (-1151.197) -- 0:00:54
Average standard deviation of split frequencies: 0.025901
155500 -- [-1151.713] (-1154.703) (-1150.480) (-1153.540) * [-1151.600] (-1150.106) (-1153.806) (-1154.232) -- 0:00:54
156000 -- (-1150.887) (-1154.338) [-1150.888] (-1151.160) * (-1151.834) (-1150.316) [-1151.024] (-1150.963) -- 0:00:54
156500 -- (-1153.515) (-1153.408) (-1152.279) [-1150.891] * (-1152.755) (-1149.927) (-1153.192) [-1152.614] -- 0:00:53
157000 -- [-1153.012] (-1152.214) (-1152.055) (-1150.495) * [-1152.462] (-1152.653) (-1152.709) (-1151.531) -- 0:00:53
157500 -- [-1154.260] (-1152.800) (-1156.297) (-1150.767) * (-1153.686) (-1155.095) [-1150.767] (-1153.848) -- 0:00:53
158000 -- [-1151.484] (-1154.523) (-1154.011) (-1150.762) * (-1152.733) (-1155.099) [-1150.707] (-1152.985) -- 0:00:53
158500 -- (-1151.506) (-1151.818) (-1153.954) [-1150.842] * (-1153.285) (-1155.217) (-1151.004) [-1151.567] -- 0:00:53
159000 -- (-1155.127) (-1151.770) [-1152.496] (-1152.574) * (-1152.069) (-1151.262) (-1152.509) [-1150.986] -- 0:00:52
159500 -- (-1154.246) (-1151.901) [-1154.137] (-1156.053) * (-1151.038) [-1150.393] (-1152.741) (-1152.150) -- 0:00:52
160000 -- (-1152.085) (-1153.668) [-1156.104] (-1150.565) * (-1151.986) [-1150.417] (-1155.751) (-1151.817) -- 0:00:52
Average standard deviation of split frequencies: 0.026267
160500 -- [-1151.490] (-1152.758) (-1152.325) (-1151.920) * (-1155.075) (-1150.303) [-1151.445] (-1154.654) -- 0:00:52
161000 -- [-1150.465] (-1155.747) (-1150.880) (-1151.703) * [-1150.756] (-1152.469) (-1149.991) (-1152.584) -- 0:00:52
161500 -- [-1151.482] (-1157.882) (-1151.770) (-1151.334) * [-1150.935] (-1157.191) (-1151.444) (-1152.952) -- 0:00:51
162000 -- (-1160.320) (-1159.823) (-1154.900) [-1152.063] * (-1152.929) (-1163.532) [-1152.234] (-1153.019) -- 0:00:56
162500 -- [-1152.129] (-1154.806) (-1154.610) (-1151.949) * (-1151.131) [-1152.248] (-1152.366) (-1155.462) -- 0:00:56
163000 -- [-1152.705] (-1152.182) (-1153.357) (-1158.950) * [-1150.070] (-1150.336) (-1151.489) (-1152.360) -- 0:00:56
163500 -- (-1153.646) [-1154.013] (-1155.042) (-1153.621) * (-1152.655) (-1149.914) [-1154.393] (-1153.242) -- 0:00:56
164000 -- (-1152.242) (-1153.404) (-1152.067) [-1151.319] * (-1150.340) (-1149.730) (-1152.484) [-1154.464] -- 0:00:56
164500 -- (-1153.775) (-1152.867) [-1152.297] (-1151.166) * (-1153.473) (-1151.225) (-1158.371) [-1156.241] -- 0:00:55
165000 -- (-1153.553) (-1155.363) [-1155.839] (-1153.753) * (-1151.447) (-1153.652) (-1159.486) [-1151.402] -- 0:00:55
Average standard deviation of split frequencies: 0.024913
165500 -- [-1152.413] (-1156.515) (-1155.845) (-1151.715) * (-1151.578) (-1153.051) (-1159.617) [-1153.134] -- 0:00:55
166000 -- (-1152.093) (-1154.259) (-1151.597) [-1150.895] * (-1150.685) (-1153.335) [-1154.481] (-1150.707) -- 0:00:55
166500 -- (-1151.063) (-1153.150) [-1153.732] (-1153.454) * [-1150.685] (-1154.038) (-1153.009) (-1150.300) -- 0:00:55
167000 -- [-1153.457] (-1152.423) (-1154.620) (-1152.117) * [-1150.645] (-1151.077) (-1152.575) (-1150.799) -- 0:00:54
167500 -- [-1153.224] (-1152.383) (-1156.712) (-1153.381) * (-1150.578) [-1152.683] (-1150.846) (-1150.407) -- 0:00:54
168000 -- (-1150.718) (-1153.596) [-1153.252] (-1153.867) * (-1154.770) (-1159.904) (-1153.454) [-1150.437] -- 0:00:54
168500 -- (-1152.104) (-1152.103) [-1153.015] (-1153.234) * (-1153.569) [-1150.231] (-1153.653) (-1151.475) -- 0:00:54
169000 -- (-1151.274) (-1150.313) (-1153.233) [-1153.458] * (-1155.794) (-1152.288) (-1154.870) [-1150.419] -- 0:00:54
169500 -- (-1151.906) (-1152.715) (-1150.654) [-1150.900] * (-1150.737) [-1150.422] (-1150.760) (-1150.485) -- 0:00:53
170000 -- [-1155.692] (-1154.438) (-1150.181) (-1152.840) * [-1153.684] (-1150.667) (-1154.895) (-1150.446) -- 0:00:53
Average standard deviation of split frequencies: 0.026043
170500 -- [-1151.294] (-1154.644) (-1151.864) (-1151.396) * (-1155.607) [-1150.139] (-1154.568) (-1151.539) -- 0:00:53
171000 -- [-1151.268] (-1157.157) (-1150.264) (-1150.034) * (-1152.476) [-1151.861] (-1154.807) (-1150.650) -- 0:00:53
171500 -- (-1151.727) [-1152.543] (-1151.747) (-1153.601) * (-1151.619) (-1153.669) [-1154.106] (-1150.065) -- 0:00:53
172000 -- [-1152.786] (-1153.993) (-1151.914) (-1151.775) * (-1149.885) (-1151.280) (-1151.794) [-1151.146] -- 0:00:52
172500 -- (-1152.591) (-1151.619) (-1157.724) [-1151.149] * (-1150.384) (-1151.045) (-1150.082) [-1150.534] -- 0:00:52
173000 -- (-1150.964) (-1152.798) (-1152.103) [-1150.992] * (-1151.860) (-1156.801) (-1156.156) [-1151.576] -- 0:00:52
173500 -- (-1154.807) [-1152.310] (-1154.146) (-1151.100) * [-1151.861] (-1150.741) (-1150.295) (-1152.991) -- 0:00:52
174000 -- [-1151.641] (-1150.852) (-1153.014) (-1152.082) * (-1150.810) [-1150.258] (-1150.241) (-1151.803) -- 0:00:52
174500 -- [-1153.586] (-1151.232) (-1153.562) (-1153.723) * (-1150.815) (-1150.807) (-1151.884) [-1155.492] -- 0:00:52
175000 -- (-1152.744) (-1153.961) (-1152.993) [-1151.723] * (-1150.913) (-1153.987) (-1151.173) [-1156.930] -- 0:00:51
Average standard deviation of split frequencies: 0.023978
175500 -- (-1152.170) (-1151.534) (-1151.820) [-1152.722] * (-1151.818) (-1151.277) (-1153.697) [-1152.471] -- 0:00:51
176000 -- (-1153.187) (-1152.434) (-1156.158) [-1150.647] * [-1152.619] (-1151.227) (-1150.721) (-1152.677) -- 0:00:51
176500 -- [-1150.809] (-1150.740) (-1156.445) (-1151.177) * (-1152.151) (-1151.358) [-1150.805] (-1151.557) -- 0:00:51
177000 -- (-1150.541) (-1151.703) (-1153.089) [-1151.535] * [-1151.288] (-1153.205) (-1151.719) (-1155.142) -- 0:00:51
177500 -- (-1153.801) [-1150.267] (-1152.317) (-1153.820) * (-1151.849) (-1151.913) [-1153.731] (-1152.560) -- 0:00:50
178000 -- (-1151.590) [-1150.693] (-1151.985) (-1151.070) * (-1151.732) (-1155.742) [-1151.406] (-1151.011) -- 0:00:55
178500 -- (-1154.196) [-1153.387] (-1153.380) (-1151.260) * (-1150.646) (-1150.852) (-1157.929) [-1151.449] -- 0:00:55
179000 -- (-1151.181) (-1153.700) [-1154.589] (-1154.864) * (-1150.713) (-1155.110) [-1156.635] (-1151.380) -- 0:00:55
179500 -- (-1150.994) [-1151.454] (-1154.071) (-1151.097) * (-1151.895) (-1155.049) [-1155.179] (-1152.356) -- 0:00:54
180000 -- [-1149.872] (-1151.087) (-1157.570) (-1153.078) * [-1153.347] (-1154.268) (-1151.095) (-1155.715) -- 0:00:54
Average standard deviation of split frequencies: 0.023875
180500 -- [-1150.329] (-1152.706) (-1151.168) (-1153.758) * [-1151.124] (-1152.591) (-1153.454) (-1151.943) -- 0:00:54
181000 -- (-1152.568) [-1150.564] (-1153.992) (-1154.365) * [-1152.441] (-1150.634) (-1152.084) (-1151.830) -- 0:00:54
181500 -- (-1153.177) [-1151.638] (-1156.890) (-1153.029) * (-1152.234) [-1155.647] (-1151.659) (-1154.195) -- 0:00:54
182000 -- (-1154.584) (-1153.612) [-1150.747] (-1157.054) * (-1151.048) (-1153.614) (-1150.821) [-1152.957] -- 0:00:53
182500 -- (-1151.795) [-1156.685] (-1151.871) (-1151.916) * [-1152.300] (-1153.157) (-1151.243) (-1154.101) -- 0:00:53
183000 -- [-1153.119] (-1154.564) (-1154.284) (-1151.261) * (-1151.900) [-1151.066] (-1151.515) (-1154.376) -- 0:00:53
183500 -- [-1153.900] (-1153.288) (-1152.566) (-1151.228) * (-1152.602) [-1151.086] (-1153.067) (-1153.414) -- 0:00:53
184000 -- (-1150.567) (-1151.275) [-1152.724] (-1153.198) * [-1151.717] (-1151.745) (-1153.814) (-1156.195) -- 0:00:53
184500 -- (-1152.385) (-1152.839) (-1152.742) [-1150.247] * (-1154.155) (-1153.417) [-1152.723] (-1155.027) -- 0:00:53
185000 -- (-1156.167) (-1151.952) (-1151.870) [-1153.617] * (-1151.582) [-1152.919] (-1151.142) (-1151.107) -- 0:00:52
Average standard deviation of split frequencies: 0.023413
185500 -- [-1152.230] (-1150.351) (-1151.280) (-1154.527) * (-1152.030) (-1151.468) [-1152.145] (-1155.449) -- 0:00:52
186000 -- [-1150.650] (-1150.793) (-1151.094) (-1152.088) * (-1153.387) [-1150.212] (-1151.315) (-1152.312) -- 0:00:52
186500 -- (-1151.797) [-1150.227] (-1151.021) (-1150.864) * (-1152.162) (-1150.256) [-1153.268] (-1152.853) -- 0:00:52
187000 -- [-1152.032] (-1151.094) (-1151.644) (-1151.142) * (-1152.282) (-1150.855) (-1151.197) [-1150.711] -- 0:00:52
187500 -- [-1150.266] (-1155.908) (-1155.806) (-1150.637) * (-1157.165) (-1152.164) (-1152.274) [-1152.061] -- 0:00:52
188000 -- (-1150.947) [-1152.380] (-1157.269) (-1151.760) * (-1153.262) [-1151.346] (-1151.372) (-1151.053) -- 0:00:51
188500 -- (-1151.712) [-1151.827] (-1152.773) (-1153.102) * [-1152.447] (-1151.340) (-1151.485) (-1151.078) -- 0:00:51
189000 -- (-1151.200) [-1150.855] (-1152.301) (-1156.018) * (-1155.316) (-1150.533) [-1152.212] (-1151.384) -- 0:00:51
189500 -- [-1151.944] (-1150.441) (-1150.644) (-1158.002) * (-1150.633) (-1151.605) (-1151.883) [-1154.320] -- 0:00:51
190000 -- (-1154.590) [-1149.879] (-1150.296) (-1150.178) * [-1151.757] (-1155.755) (-1151.173) (-1155.966) -- 0:00:51
Average standard deviation of split frequencies: 0.022746
190500 -- (-1155.262) [-1149.931] (-1150.731) (-1152.377) * [-1151.385] (-1151.142) (-1151.238) (-1155.387) -- 0:00:50
191000 -- (-1151.712) [-1150.933] (-1158.125) (-1154.031) * (-1153.313) (-1150.528) [-1151.062] (-1152.377) -- 0:00:50
191500 -- [-1153.584] (-1152.651) (-1152.761) (-1159.380) * [-1152.590] (-1152.043) (-1150.801) (-1152.371) -- 0:00:50
192000 -- [-1152.175] (-1154.705) (-1151.381) (-1152.744) * [-1151.456] (-1151.810) (-1151.093) (-1155.563) -- 0:00:50
192500 -- (-1150.687) (-1152.002) (-1150.469) [-1151.106] * (-1153.661) [-1152.054] (-1150.523) (-1152.907) -- 0:00:50
193000 -- (-1150.187) (-1151.064) (-1151.069) [-1153.208] * (-1152.651) (-1151.853) (-1150.994) [-1151.110] -- 0:00:50
193500 -- (-1152.396) [-1150.319] (-1154.632) (-1151.153) * (-1153.064) (-1150.650) [-1151.473] (-1150.825) -- 0:00:50
194000 -- (-1152.758) (-1152.083) (-1154.948) [-1150.907] * (-1152.444) (-1156.645) [-1150.477] (-1151.543) -- 0:00:49
194500 -- (-1154.363) (-1152.001) (-1150.180) [-1151.380] * (-1150.184) (-1153.956) [-1151.827] (-1152.339) -- 0:00:53
195000 -- (-1151.244) (-1152.503) (-1152.987) [-1152.839] * (-1150.960) [-1150.351] (-1154.505) (-1152.165) -- 0:00:53
Average standard deviation of split frequencies: 0.022127
195500 -- [-1151.175] (-1154.631) (-1151.305) (-1154.900) * (-1150.517) [-1151.451] (-1159.458) (-1153.324) -- 0:00:53
196000 -- (-1153.664) (-1152.171) (-1151.499) [-1151.263] * (-1150.886) (-1150.247) [-1151.681] (-1153.631) -- 0:00:53
196500 -- (-1153.152) (-1151.179) [-1151.744] (-1153.975) * [-1151.928] (-1151.418) (-1151.696) (-1153.184) -- 0:00:53
197000 -- (-1152.604) (-1151.407) (-1151.314) [-1153.702] * [-1154.797] (-1150.161) (-1151.672) (-1154.376) -- 0:00:52
197500 -- [-1151.834] (-1151.063) (-1151.930) (-1155.178) * [-1152.486] (-1154.701) (-1152.087) (-1156.614) -- 0:00:52
198000 -- (-1152.918) (-1152.319) (-1152.939) [-1154.045] * [-1152.712] (-1150.814) (-1151.818) (-1150.665) -- 0:00:52
198500 -- (-1150.823) (-1152.353) (-1152.555) [-1151.992] * (-1153.549) (-1152.264) [-1150.486] (-1154.046) -- 0:00:52
199000 -- (-1151.887) (-1152.813) [-1150.403] (-1152.145) * [-1150.708] (-1152.840) (-1153.748) (-1154.200) -- 0:00:52
199500 -- (-1152.325) (-1152.895) (-1150.618) [-1150.912] * (-1151.752) (-1151.546) [-1150.669] (-1153.546) -- 0:00:52
200000 -- (-1151.744) (-1151.879) [-1149.887] (-1156.086) * (-1152.435) [-1150.175] (-1151.150) (-1152.909) -- 0:00:51
Average standard deviation of split frequencies: 0.020772
200500 -- (-1152.222) [-1151.587] (-1150.778) (-1152.670) * (-1156.333) [-1150.956] (-1151.137) (-1150.573) -- 0:00:51
201000 -- [-1151.167] (-1150.916) (-1151.959) (-1150.547) * (-1154.006) [-1152.251] (-1151.164) (-1153.203) -- 0:00:51
201500 -- (-1151.079) (-1150.020) [-1152.195] (-1154.473) * (-1154.159) (-1158.077) (-1150.136) [-1151.806] -- 0:00:51
202000 -- (-1153.785) (-1150.499) (-1152.195) [-1151.294] * (-1152.135) (-1156.260) [-1152.807] (-1155.867) -- 0:00:51
202500 -- (-1151.303) (-1154.924) (-1150.940) [-1152.560] * (-1154.487) [-1153.681] (-1151.691) (-1152.443) -- 0:00:51
203000 -- (-1152.128) (-1152.093) [-1150.998] (-1151.248) * [-1151.465] (-1160.058) (-1151.769) (-1150.914) -- 0:00:51
203500 -- (-1150.787) (-1151.119) [-1151.521] (-1153.238) * (-1151.465) (-1151.442) (-1150.641) [-1151.230] -- 0:00:50
204000 -- (-1150.727) [-1154.246] (-1151.661) (-1153.779) * (-1157.450) [-1150.529] (-1150.646) (-1151.188) -- 0:00:50
204500 -- (-1152.191) [-1153.373] (-1151.126) (-1149.846) * [-1154.979] (-1149.969) (-1153.880) (-1150.937) -- 0:00:50
205000 -- (-1155.310) (-1152.874) [-1152.963] (-1153.402) * (-1151.436) (-1150.249) [-1152.003] (-1152.583) -- 0:00:50
Average standard deviation of split frequencies: 0.018307
205500 -- (-1153.580) [-1153.732] (-1153.575) (-1151.445) * [-1152.002] (-1150.152) (-1151.796) (-1154.333) -- 0:00:50
206000 -- [-1152.589] (-1152.478) (-1153.093) (-1152.909) * [-1152.161] (-1152.304) (-1150.933) (-1151.381) -- 0:00:50
206500 -- (-1152.625) (-1151.650) [-1152.422] (-1151.692) * (-1152.161) [-1150.994] (-1154.911) (-1153.603) -- 0:00:49
207000 -- (-1152.307) [-1151.711] (-1153.474) (-1152.065) * (-1151.235) [-1153.178] (-1151.532) (-1157.175) -- 0:00:49
207500 -- (-1153.451) [-1151.127] (-1152.601) (-1152.161) * [-1152.170] (-1151.964) (-1151.324) (-1152.433) -- 0:00:49
208000 -- (-1150.137) [-1150.588] (-1151.423) (-1150.709) * (-1153.484) (-1151.525) [-1152.402] (-1152.751) -- 0:00:49
208500 -- (-1151.214) (-1155.990) [-1151.617] (-1152.405) * (-1151.153) (-1151.030) [-1150.747] (-1152.366) -- 0:00:49
209000 -- (-1151.188) (-1156.576) (-1154.072) [-1153.365] * [-1150.694] (-1151.253) (-1151.841) (-1152.778) -- 0:00:49
209500 -- (-1151.220) (-1152.896) (-1150.763) [-1154.060] * (-1150.724) (-1151.349) (-1154.832) [-1151.293] -- 0:00:49
210000 -- (-1150.113) [-1150.821] (-1151.684) (-1153.586) * (-1151.237) (-1151.035) [-1154.443] (-1153.451) -- 0:00:48
Average standard deviation of split frequencies: 0.017280
210500 -- (-1151.417) (-1150.510) (-1150.894) [-1152.197] * (-1155.094) (-1152.540) (-1152.193) [-1154.844] -- 0:00:52
211000 -- (-1151.648) (-1152.424) [-1151.178] (-1155.905) * (-1151.335) (-1151.186) [-1153.064] (-1153.174) -- 0:00:52
211500 -- (-1151.145) (-1154.175) (-1153.524) [-1150.895] * (-1151.857) [-1155.108] (-1151.207) (-1152.645) -- 0:00:52
212000 -- (-1152.708) (-1152.257) [-1154.083] (-1151.097) * [-1152.513] (-1151.419) (-1152.846) (-1151.719) -- 0:00:52
212500 -- [-1152.838] (-1151.525) (-1154.389) (-1154.404) * (-1151.898) (-1151.419) (-1152.448) [-1151.719] -- 0:00:51
213000 -- (-1153.317) (-1150.998) (-1151.760) [-1152.295] * [-1151.031] (-1150.563) (-1152.762) (-1154.310) -- 0:00:51
213500 -- (-1151.577) (-1151.971) [-1150.961] (-1151.692) * (-1154.072) (-1152.339) (-1149.944) [-1154.272] -- 0:00:51
214000 -- [-1153.691] (-1150.483) (-1152.664) (-1151.475) * (-1156.105) [-1150.980] (-1151.795) (-1150.944) -- 0:00:51
214500 -- (-1151.145) [-1150.870] (-1151.382) (-1152.910) * (-1155.659) (-1152.505) [-1150.843] (-1150.896) -- 0:00:51
215000 -- (-1151.232) [-1150.217] (-1151.790) (-1153.029) * (-1152.120) [-1151.960] (-1151.981) (-1151.727) -- 0:00:51
Average standard deviation of split frequencies: 0.018066
215500 -- (-1155.222) (-1151.439) [-1154.411] (-1154.242) * (-1150.556) (-1150.338) [-1150.834] (-1151.572) -- 0:00:50
216000 -- (-1156.471) [-1153.346] (-1150.813) (-1152.530) * [-1153.520] (-1152.023) (-1152.715) (-1151.609) -- 0:00:50
216500 -- (-1153.642) (-1154.128) (-1153.055) [-1151.616] * (-1150.442) (-1153.020) [-1151.637] (-1151.410) -- 0:00:50
217000 -- (-1153.975) (-1153.301) (-1151.071) [-1151.569] * (-1157.502) (-1153.398) [-1152.597] (-1153.781) -- 0:00:50
217500 -- [-1151.631] (-1150.455) (-1150.909) (-1153.215) * (-1153.595) (-1151.690) [-1150.990] (-1150.079) -- 0:00:50
218000 -- (-1151.026) (-1151.119) (-1152.189) [-1153.571] * [-1152.232] (-1151.423) (-1153.793) (-1151.851) -- 0:00:50
218500 -- [-1151.657] (-1152.726) (-1153.296) (-1151.658) * (-1153.303) (-1150.735) (-1149.871) [-1151.044] -- 0:00:50
219000 -- (-1153.308) [-1152.701] (-1152.696) (-1152.763) * (-1151.693) (-1157.404) [-1150.157] (-1151.724) -- 0:00:49
219500 -- [-1153.308] (-1153.161) (-1153.173) (-1150.096) * (-1153.217) (-1150.520) [-1152.066] (-1151.568) -- 0:00:49
220000 -- (-1154.021) (-1152.296) (-1154.895) [-1150.864] * (-1154.358) (-1152.060) [-1150.957] (-1152.054) -- 0:00:49
Average standard deviation of split frequencies: 0.017446
220500 -- (-1151.703) [-1152.200] (-1157.603) (-1152.974) * [-1150.843] (-1155.183) (-1150.084) (-1153.256) -- 0:00:49
221000 -- (-1151.137) [-1151.387] (-1155.771) (-1150.969) * (-1153.904) [-1154.548] (-1151.874) (-1153.145) -- 0:00:49
221500 -- (-1151.031) [-1154.136] (-1152.312) (-1150.285) * (-1150.836) (-1155.053) [-1153.988] (-1154.616) -- 0:00:49
222000 -- [-1150.161] (-1152.282) (-1151.795) (-1151.335) * [-1152.665] (-1151.681) (-1155.317) (-1152.334) -- 0:00:49
222500 -- [-1151.509] (-1150.824) (-1151.934) (-1155.078) * (-1151.694) [-1151.671] (-1155.293) (-1154.070) -- 0:00:48
223000 -- (-1151.875) [-1150.875] (-1151.729) (-1151.723) * (-1153.855) [-1153.284] (-1154.067) (-1152.453) -- 0:00:48
223500 -- (-1150.145) (-1152.352) (-1152.216) [-1152.058] * (-1151.176) (-1153.445) (-1150.975) [-1154.362] -- 0:00:48
224000 -- (-1152.057) (-1151.803) [-1151.252] (-1151.164) * [-1151.224] (-1151.223) (-1153.138) (-1153.070) -- 0:00:48
224500 -- (-1153.531) (-1151.768) (-1152.960) [-1150.898] * (-1151.838) [-1149.857] (-1158.073) (-1152.709) -- 0:00:48
225000 -- (-1154.225) [-1151.382] (-1153.619) (-1150.511) * (-1150.207) [-1150.039] (-1154.832) (-1153.465) -- 0:00:48
Average standard deviation of split frequencies: 0.017894
225500 -- (-1156.454) [-1151.080] (-1153.191) (-1151.698) * (-1151.066) [-1149.924] (-1150.433) (-1151.096) -- 0:00:48
226000 -- (-1151.829) [-1152.127] (-1154.746) (-1151.637) * [-1151.766] (-1151.480) (-1154.089) (-1151.649) -- 0:00:47
226500 -- (-1154.675) (-1155.606) (-1152.321) [-1151.117] * (-1150.202) (-1150.495) [-1150.936] (-1152.665) -- 0:00:47
227000 -- (-1154.715) (-1154.381) (-1151.437) [-1151.605] * (-1153.128) (-1150.548) [-1150.554] (-1154.606) -- 0:00:51
227500 -- (-1153.860) (-1151.226) [-1151.635] (-1151.334) * (-1160.954) (-1151.304) [-1151.431] (-1152.643) -- 0:00:50
228000 -- (-1152.845) [-1149.980] (-1151.628) (-1152.629) * (-1160.594) [-1151.230] (-1152.862) (-1156.336) -- 0:00:50
228500 -- (-1157.759) [-1150.616] (-1151.663) (-1150.833) * (-1160.861) [-1150.466] (-1152.287) (-1152.828) -- 0:00:50
229000 -- (-1155.934) (-1152.245) [-1150.061] (-1153.332) * [-1152.312] (-1150.731) (-1155.441) (-1154.909) -- 0:00:50
229500 -- (-1152.770) (-1152.973) [-1152.242] (-1154.045) * (-1153.387) (-1150.806) [-1151.744] (-1152.339) -- 0:00:50
230000 -- (-1153.153) [-1151.557] (-1151.612) (-1158.361) * (-1152.828) (-1153.381) [-1151.590] (-1151.639) -- 0:00:50
Average standard deviation of split frequencies: 0.019576
230500 -- (-1152.619) (-1151.592) (-1150.794) [-1154.012] * (-1154.183) (-1153.188) [-1151.925] (-1150.433) -- 0:00:50
231000 -- (-1155.214) (-1151.342) [-1150.239] (-1152.504) * [-1151.884] (-1153.248) (-1150.920) (-1151.065) -- 0:00:49
231500 -- (-1151.721) (-1151.300) (-1151.513) [-1151.756] * [-1151.136] (-1155.389) (-1153.055) (-1150.881) -- 0:00:49
232000 -- (-1152.238) [-1151.344] (-1155.244) (-1152.398) * (-1151.706) (-1154.461) (-1154.336) [-1150.331] -- 0:00:49
232500 -- (-1155.735) (-1151.880) [-1155.006] (-1150.145) * (-1151.191) (-1150.324) [-1152.612] (-1150.661) -- 0:00:49
233000 -- (-1154.610) (-1154.938) (-1155.663) [-1150.162] * (-1155.224) (-1150.019) (-1151.354) [-1150.188] -- 0:00:49
233500 -- (-1156.206) (-1155.245) (-1151.585) [-1152.571] * (-1152.949) (-1152.049) [-1152.259] (-1151.127) -- 0:00:49
234000 -- (-1152.165) [-1153.967] (-1150.540) (-1150.799) * (-1150.498) (-1152.487) [-1153.651] (-1152.712) -- 0:00:49
234500 -- (-1156.902) (-1150.492) [-1152.318] (-1153.055) * (-1153.385) (-1150.976) [-1151.222] (-1153.115) -- 0:00:48
235000 -- (-1157.808) [-1149.835] (-1151.341) (-1150.430) * (-1152.172) (-1152.776) (-1150.626) [-1152.460] -- 0:00:48
Average standard deviation of split frequencies: 0.020474
235500 -- (-1153.754) [-1151.276] (-1157.875) (-1150.350) * (-1152.561) (-1151.756) (-1150.017) [-1151.399] -- 0:00:48
236000 -- [-1152.009] (-1154.685) (-1155.040) (-1149.991) * (-1151.409) [-1153.100] (-1152.414) (-1152.494) -- 0:00:48
236500 -- (-1149.905) (-1156.001) [-1152.583] (-1151.855) * (-1151.424) [-1154.385] (-1151.036) (-1151.597) -- 0:00:48
237000 -- (-1150.121) [-1151.221] (-1154.253) (-1150.380) * (-1151.601) (-1150.479) [-1151.036] (-1150.786) -- 0:00:48
237500 -- (-1151.245) [-1150.758] (-1151.482) (-1150.460) * (-1154.888) (-1155.246) (-1151.848) [-1150.944] -- 0:00:48
238000 -- [-1151.345] (-1152.056) (-1154.292) (-1150.510) * [-1151.351] (-1152.160) (-1151.010) (-1151.083) -- 0:00:48
238500 -- [-1150.879] (-1150.768) (-1153.187) (-1152.038) * (-1152.287) (-1151.689) (-1151.558) [-1149.917] -- 0:00:47
239000 -- [-1151.373] (-1152.390) (-1150.989) (-1153.945) * (-1152.676) (-1151.641) (-1153.786) [-1151.142] -- 0:00:47
239500 -- (-1151.287) (-1152.411) (-1153.619) [-1153.365] * [-1151.609] (-1153.182) (-1151.075) (-1153.117) -- 0:00:47
240000 -- (-1151.560) (-1153.071) (-1155.951) [-1151.214] * (-1151.706) [-1151.301] (-1150.442) (-1152.515) -- 0:00:47
Average standard deviation of split frequencies: 0.018935
240500 -- (-1150.510) (-1154.388) [-1151.519] (-1154.932) * (-1151.787) (-1154.715) (-1150.778) [-1154.288] -- 0:00:47
241000 -- (-1157.411) (-1150.628) (-1155.142) [-1151.290] * (-1151.787) (-1155.715) [-1150.982] (-1153.253) -- 0:00:47
241500 -- (-1155.491) [-1151.316] (-1153.917) (-1151.908) * [-1151.934] (-1154.042) (-1151.512) (-1155.548) -- 0:00:47
242000 -- (-1151.554) [-1150.857] (-1155.954) (-1151.513) * (-1150.911) (-1152.782) (-1150.291) [-1152.869] -- 0:00:46
242500 -- (-1151.687) (-1150.511) (-1152.958) [-1150.480] * (-1151.280) [-1151.597] (-1152.074) (-1151.032) -- 0:00:46
243000 -- (-1154.365) [-1151.820] (-1153.225) (-1152.017) * (-1153.186) (-1156.986) (-1151.793) [-1151.155] -- 0:00:46
243500 -- [-1152.662] (-1150.636) (-1153.394) (-1154.033) * (-1157.904) [-1151.816] (-1151.700) (-1151.951) -- 0:00:49
244000 -- (-1152.107) (-1151.354) (-1150.489) [-1153.037] * [-1155.002] (-1154.159) (-1155.328) (-1153.552) -- 0:00:49
244500 -- (-1152.186) [-1151.606] (-1151.949) (-1153.560) * (-1154.194) [-1153.691] (-1156.527) (-1152.123) -- 0:00:49
245000 -- (-1151.278) [-1151.233] (-1152.171) (-1154.236) * (-1151.669) (-1153.288) (-1150.255) [-1153.129] -- 0:00:49
Average standard deviation of split frequencies: 0.018759
245500 -- (-1153.764) [-1152.218] (-1150.702) (-1151.523) * (-1151.090) (-1154.917) [-1150.633] (-1152.359) -- 0:00:49
246000 -- (-1151.364) [-1151.601] (-1151.448) (-1153.469) * (-1153.773) (-1153.801) (-1149.875) [-1153.126] -- 0:00:49
246500 -- (-1150.352) [-1151.644] (-1151.548) (-1151.450) * (-1155.626) (-1152.163) [-1152.165] (-1150.180) -- 0:00:48
247000 -- (-1151.638) [-1153.270] (-1152.495) (-1151.464) * (-1154.870) [-1152.109] (-1152.459) (-1151.692) -- 0:00:48
247500 -- [-1151.252] (-1150.671) (-1154.821) (-1153.115) * (-1154.076) [-1151.902] (-1150.953) (-1161.502) -- 0:00:48
248000 -- [-1150.603] (-1151.120) (-1159.681) (-1154.946) * (-1153.211) (-1154.000) [-1151.225] (-1159.224) -- 0:00:48
248500 -- (-1153.740) (-1150.427) [-1154.186] (-1165.168) * (-1153.441) (-1151.037) [-1151.352] (-1151.404) -- 0:00:48
249000 -- (-1154.192) (-1151.143) (-1152.222) [-1152.149] * (-1152.625) (-1151.068) [-1151.467] (-1150.454) -- 0:00:48
249500 -- (-1152.300) (-1150.739) [-1150.484] (-1153.872) * [-1152.661] (-1150.955) (-1151.104) (-1152.151) -- 0:00:48
250000 -- [-1150.660] (-1153.211) (-1154.854) (-1150.048) * (-1151.075) [-1151.592] (-1152.273) (-1152.700) -- 0:00:48
Average standard deviation of split frequencies: 0.017657
250500 -- [-1151.222] (-1151.362) (-1154.859) (-1150.378) * (-1150.461) (-1151.794) [-1151.881] (-1151.005) -- 0:00:47
251000 -- [-1152.471] (-1151.156) (-1152.054) (-1151.863) * (-1157.196) [-1150.194] (-1153.296) (-1159.252) -- 0:00:47
251500 -- [-1151.917] (-1150.915) (-1154.006) (-1151.367) * (-1157.964) (-1150.497) (-1152.213) [-1154.628] -- 0:00:47
252000 -- (-1153.090) [-1152.722] (-1153.307) (-1149.749) * (-1150.987) [-1155.310] (-1155.141) (-1153.188) -- 0:00:47
252500 -- [-1152.930] (-1152.333) (-1153.379) (-1151.197) * (-1150.651) (-1153.766) (-1152.849) [-1152.643] -- 0:00:47
253000 -- (-1151.079) (-1152.499) [-1153.118] (-1151.838) * (-1151.839) (-1150.463) [-1152.678] (-1154.421) -- 0:00:47
253500 -- (-1150.116) (-1153.683) [-1155.658] (-1152.727) * (-1154.708) [-1149.931] (-1150.864) (-1151.901) -- 0:00:47
254000 -- [-1151.962] (-1150.992) (-1155.705) (-1152.867) * (-1150.837) (-1151.126) (-1151.450) [-1153.408] -- 0:00:46
254500 -- (-1155.098) [-1151.728] (-1156.760) (-1151.959) * (-1157.019) [-1151.268] (-1151.820) (-1150.235) -- 0:00:46
255000 -- (-1153.911) (-1152.151) [-1154.494] (-1155.265) * (-1159.066) (-1150.832) (-1151.849) [-1150.232] -- 0:00:46
Average standard deviation of split frequencies: 0.016266
255500 -- (-1158.647) [-1153.077] (-1151.048) (-1153.810) * (-1155.609) (-1150.022) (-1153.000) [-1150.895] -- 0:00:46
256000 -- (-1162.147) (-1156.376) [-1156.680] (-1151.295) * (-1152.822) [-1151.074] (-1151.769) (-1152.231) -- 0:00:46
256500 -- (-1151.717) (-1151.913) [-1152.965] (-1150.752) * (-1154.020) (-1152.806) (-1156.518) [-1149.975] -- 0:00:46
257000 -- (-1150.155) [-1154.322] (-1153.168) (-1153.545) * (-1152.569) [-1150.138] (-1153.278) (-1155.793) -- 0:00:46
257500 -- [-1150.232] (-1153.029) (-1153.132) (-1154.843) * (-1153.655) [-1152.435] (-1152.599) (-1153.545) -- 0:00:46
258000 -- (-1150.326) [-1152.276] (-1152.462) (-1153.253) * (-1153.830) (-1153.613) [-1150.816] (-1150.999) -- 0:00:46
258500 -- [-1149.736] (-1152.084) (-1151.235) (-1157.095) * (-1153.044) (-1152.874) [-1151.178] (-1151.664) -- 0:00:45
259000 -- [-1150.647] (-1154.805) (-1157.798) (-1153.382) * (-1151.189) (-1153.494) [-1151.221] (-1151.185) -- 0:00:45
259500 -- (-1155.524) [-1152.599] (-1151.108) (-1151.453) * (-1152.318) [-1153.295] (-1151.508) (-1151.261) -- 0:00:45
260000 -- (-1151.682) [-1150.643] (-1150.462) (-1152.442) * (-1150.637) [-1150.854] (-1154.171) (-1153.589) -- 0:00:48
Average standard deviation of split frequencies: 0.016808
260500 -- (-1151.198) (-1151.102) [-1151.825] (-1153.253) * (-1154.327) (-1151.347) [-1152.138] (-1150.541) -- 0:00:48
261000 -- (-1151.758) (-1153.771) [-1152.712] (-1154.404) * [-1150.650] (-1150.465) (-1154.600) (-1154.378) -- 0:00:48
261500 -- (-1151.862) (-1153.751) [-1151.361] (-1151.037) * [-1150.925] (-1151.577) (-1153.910) (-1155.677) -- 0:00:48
262000 -- (-1151.422) (-1154.169) (-1149.875) [-1150.016] * (-1151.500) [-1155.198] (-1152.188) (-1156.882) -- 0:00:47
262500 -- [-1151.982] (-1156.086) (-1149.893) (-1150.026) * (-1151.806) [-1150.520] (-1151.747) (-1152.416) -- 0:00:47
263000 -- [-1151.718] (-1155.275) (-1150.383) (-1150.469) * (-1152.790) (-1153.998) (-1152.861) [-1151.363] -- 0:00:47
263500 -- (-1150.667) (-1153.324) (-1152.858) [-1152.400] * [-1153.788] (-1155.889) (-1151.601) (-1151.801) -- 0:00:47
264000 -- [-1151.779] (-1153.326) (-1154.281) (-1153.695) * [-1154.903] (-1153.130) (-1153.194) (-1151.227) -- 0:00:47
264500 -- [-1149.819] (-1152.338) (-1152.550) (-1154.362) * [-1151.293] (-1153.933) (-1151.451) (-1150.981) -- 0:00:47
265000 -- (-1149.815) (-1156.103) (-1150.703) [-1151.503] * (-1151.431) [-1150.789] (-1150.967) (-1153.166) -- 0:00:47
Average standard deviation of split frequencies: 0.016836
265500 -- (-1150.893) (-1152.130) [-1150.816] (-1151.507) * (-1153.729) [-1152.022] (-1152.458) (-1151.078) -- 0:00:47
266000 -- (-1151.575) (-1150.547) [-1158.127] (-1150.138) * (-1152.528) [-1151.118] (-1151.746) (-1151.289) -- 0:00:46
266500 -- (-1152.129) [-1150.102] (-1152.537) (-1150.370) * (-1151.522) [-1152.271] (-1151.697) (-1151.948) -- 0:00:46
267000 -- (-1152.751) [-1150.862] (-1151.517) (-1150.880) * [-1152.077] (-1150.838) (-1155.411) (-1151.238) -- 0:00:46
267500 -- [-1151.641] (-1152.634) (-1151.567) (-1150.041) * (-1154.865) (-1151.331) [-1152.585] (-1151.882) -- 0:00:46
268000 -- (-1152.456) [-1154.641] (-1156.164) (-1150.568) * (-1158.083) (-1154.392) (-1152.346) [-1151.157] -- 0:00:46
268500 -- [-1152.585] (-1155.875) (-1154.793) (-1150.445) * (-1154.527) (-1156.294) (-1152.256) [-1151.545] -- 0:00:46
269000 -- (-1151.830) (-1152.247) (-1154.235) [-1151.737] * (-1154.109) [-1153.313] (-1153.822) (-1152.519) -- 0:00:46
269500 -- (-1151.691) [-1152.876] (-1153.306) (-1151.429) * [-1151.810] (-1155.131) (-1151.771) (-1152.883) -- 0:00:46
270000 -- (-1154.030) (-1151.289) (-1150.744) [-1151.157] * (-1151.501) [-1152.604] (-1153.655) (-1154.554) -- 0:00:45
Average standard deviation of split frequencies: 0.016255
270500 -- (-1153.474) [-1150.788] (-1150.096) (-1150.993) * (-1153.526) (-1151.819) (-1152.782) [-1150.265] -- 0:00:45
271000 -- (-1153.423) [-1150.492] (-1149.860) (-1151.408) * (-1152.286) (-1153.733) (-1151.328) [-1150.256] -- 0:00:45
271500 -- [-1152.459] (-1150.611) (-1151.162) (-1155.204) * (-1152.994) (-1159.382) [-1156.149] (-1150.422) -- 0:00:45
272000 -- (-1150.661) (-1152.500) (-1153.898) [-1150.219] * (-1151.061) [-1153.271] (-1156.842) (-1152.429) -- 0:00:45
272500 -- (-1152.516) [-1151.813] (-1152.987) (-1149.958) * [-1151.697] (-1150.753) (-1153.617) (-1155.028) -- 0:00:45
273000 -- (-1151.010) (-1150.108) (-1150.810) [-1150.264] * (-1152.175) (-1151.438) [-1152.169] (-1153.119) -- 0:00:45
273500 -- [-1151.861] (-1150.299) (-1150.883) (-1150.451) * (-1150.037) (-1150.395) [-1156.225] (-1152.642) -- 0:00:45
274000 -- (-1151.743) (-1150.280) (-1150.789) [-1149.919] * (-1150.271) [-1150.078] (-1152.485) (-1153.652) -- 0:00:45
274500 -- (-1153.532) (-1151.012) [-1155.371] (-1149.917) * (-1150.250) (-1150.449) [-1153.207] (-1153.869) -- 0:00:44
275000 -- (-1152.659) (-1151.314) (-1153.864) [-1153.039] * (-1153.885) (-1150.826) [-1149.983] (-1153.537) -- 0:00:44
Average standard deviation of split frequencies: 0.017080
275500 -- (-1152.246) (-1153.784) [-1150.294] (-1153.042) * (-1153.716) (-1153.150) [-1150.890] (-1153.627) -- 0:00:44
276000 -- (-1152.880) (-1155.261) [-1150.292] (-1150.925) * [-1151.616] (-1153.004) (-1152.147) (-1151.263) -- 0:00:47
276500 -- (-1155.543) (-1150.474) (-1154.296) [-1153.072] * (-1157.109) [-1150.401] (-1155.448) (-1152.017) -- 0:00:47
277000 -- (-1154.713) (-1150.344) (-1153.165) [-1151.302] * (-1151.635) (-1155.048) (-1155.634) [-1150.103] -- 0:00:46
277500 -- (-1151.302) (-1150.875) (-1152.660) [-1152.063] * (-1152.985) (-1150.120) [-1151.712] (-1152.561) -- 0:00:46
278000 -- (-1151.861) [-1155.125] (-1151.663) (-1156.707) * (-1150.862) [-1149.895] (-1152.471) (-1151.689) -- 0:00:46
278500 -- (-1152.707) [-1153.876] (-1152.239) (-1152.916) * (-1150.324) [-1149.891] (-1152.547) (-1152.573) -- 0:00:46
279000 -- (-1153.183) (-1153.699) (-1155.568) [-1151.556] * (-1150.089) (-1150.017) [-1150.612] (-1151.784) -- 0:00:46
279500 -- (-1151.544) [-1152.979] (-1151.672) (-1151.551) * (-1150.102) [-1150.134] (-1151.850) (-1152.379) -- 0:00:46
280000 -- (-1150.766) (-1151.906) (-1154.934) [-1149.870] * (-1151.302) (-1153.647) [-1152.565] (-1151.401) -- 0:00:46
Average standard deviation of split frequencies: 0.018652
280500 -- (-1153.821) (-1151.420) (-1152.488) [-1150.412] * (-1151.484) (-1156.332) [-1150.454] (-1150.262) -- 0:00:46
281000 -- (-1150.132) (-1150.847) (-1154.082) [-1152.817] * (-1151.124) (-1152.576) (-1153.512) [-1151.447] -- 0:00:46
281500 -- (-1150.495) [-1151.723] (-1152.952) (-1152.424) * (-1152.140) [-1153.060] (-1155.668) (-1154.358) -- 0:00:45
282000 -- (-1151.400) (-1150.910) (-1153.141) [-1153.133] * (-1152.901) (-1151.306) [-1152.595] (-1151.842) -- 0:00:45
282500 -- (-1153.005) (-1154.494) [-1151.209] (-1153.617) * (-1152.462) (-1152.210) [-1152.371] (-1150.524) -- 0:00:45
283000 -- (-1152.739) [-1150.646] (-1150.837) (-1150.685) * (-1165.113) (-1152.550) (-1157.445) [-1152.282] -- 0:00:45
283500 -- [-1152.314] (-1151.146) (-1150.837) (-1150.637) * (-1153.017) (-1153.910) [-1155.149] (-1154.666) -- 0:00:45
284000 -- (-1152.270) (-1151.303) (-1157.773) [-1150.576] * (-1150.435) (-1153.451) (-1153.594) [-1152.659] -- 0:00:45
284500 -- [-1150.664] (-1151.584) (-1156.713) (-1150.444) * (-1150.710) [-1150.963] (-1151.987) (-1154.250) -- 0:00:45
285000 -- (-1153.142) [-1151.479] (-1153.619) (-1150.904) * (-1150.409) (-1150.097) [-1152.471] (-1152.679) -- 0:00:45
Average standard deviation of split frequencies: 0.018304
285500 -- [-1150.875] (-1151.201) (-1154.032) (-1151.745) * (-1151.249) [-1151.908] (-1151.464) (-1153.687) -- 0:00:45
286000 -- [-1152.324] (-1151.508) (-1152.815) (-1150.779) * (-1151.759) (-1152.842) [-1153.022] (-1153.339) -- 0:00:44
286500 -- (-1155.369) (-1153.913) [-1150.798] (-1150.503) * [-1152.407] (-1151.945) (-1161.128) (-1151.805) -- 0:00:44
287000 -- (-1152.641) [-1150.578] (-1153.296) (-1153.015) * (-1156.196) (-1151.377) [-1152.651] (-1154.312) -- 0:00:44
287500 -- (-1151.271) [-1151.560] (-1151.761) (-1151.746) * (-1150.928) [-1150.944] (-1153.220) (-1155.546) -- 0:00:44
288000 -- (-1151.160) (-1151.685) (-1152.512) [-1150.674] * [-1150.619] (-1151.403) (-1152.576) (-1154.386) -- 0:00:44
288500 -- [-1151.610] (-1150.883) (-1152.824) (-1150.156) * [-1152.428] (-1151.931) (-1151.935) (-1152.238) -- 0:00:44
289000 -- (-1151.603) (-1151.061) (-1152.711) [-1150.156] * (-1155.021) (-1155.471) [-1155.100] (-1152.099) -- 0:00:44
289500 -- (-1156.888) (-1152.854) [-1151.425] (-1150.936) * (-1155.150) [-1154.158] (-1152.857) (-1155.603) -- 0:00:44
290000 -- (-1153.398) [-1152.005] (-1151.661) (-1151.928) * (-1154.045) (-1155.093) (-1153.247) [-1150.973] -- 0:00:44
Average standard deviation of split frequencies: 0.017750
290500 -- (-1150.602) (-1154.831) [-1152.148] (-1150.985) * (-1156.037) [-1153.787] (-1153.267) (-1157.185) -- 0:00:43
291000 -- (-1153.654) (-1153.409) [-1153.985] (-1150.954) * [-1149.982] (-1155.449) (-1151.575) (-1158.574) -- 0:00:43
291500 -- (-1156.033) (-1151.383) (-1150.939) [-1150.141] * [-1149.898] (-1155.832) (-1153.394) (-1157.446) -- 0:00:43
292000 -- (-1153.083) (-1151.071) [-1151.140] (-1154.009) * (-1152.227) [-1154.407] (-1153.195) (-1154.753) -- 0:00:46
292500 -- (-1155.186) [-1150.577] (-1150.694) (-1152.434) * (-1150.280) [-1153.924] (-1149.893) (-1157.169) -- 0:00:45
293000 -- (-1152.238) (-1151.964) (-1150.070) [-1152.130] * (-1149.988) (-1153.652) [-1150.874] (-1156.919) -- 0:00:45
293500 -- (-1151.740) (-1156.709) [-1150.238] (-1153.507) * (-1156.906) (-1152.841) (-1152.592) [-1152.560] -- 0:00:45
294000 -- (-1152.907) (-1156.547) [-1150.624] (-1155.129) * (-1151.091) (-1153.304) (-1155.562) [-1153.130] -- 0:00:45
294500 -- (-1150.423) [-1151.848] (-1153.146) (-1150.156) * [-1151.756] (-1150.570) (-1154.430) (-1152.131) -- 0:00:45
295000 -- (-1150.591) (-1161.306) (-1154.806) [-1150.304] * [-1152.057] (-1150.133) (-1154.428) (-1153.357) -- 0:00:45
Average standard deviation of split frequencies: 0.017341
295500 -- (-1151.064) (-1150.650) (-1155.010) [-1153.600] * (-1153.381) (-1150.618) (-1151.922) [-1154.787] -- 0:00:45
296000 -- [-1150.852] (-1151.972) (-1155.424) (-1150.809) * (-1159.429) [-1151.899] (-1153.786) (-1151.264) -- 0:00:45
296500 -- (-1153.484) [-1150.745] (-1150.483) (-1151.717) * (-1155.461) (-1153.142) [-1151.540] (-1151.433) -- 0:00:45
297000 -- (-1154.013) [-1151.306] (-1150.236) (-1151.961) * (-1151.640) (-1157.374) (-1151.223) [-1151.573] -- 0:00:44
297500 -- (-1155.965) [-1152.152] (-1150.858) (-1152.040) * [-1151.472] (-1153.289) (-1151.185) (-1151.495) -- 0:00:44
298000 -- (-1154.224) (-1151.769) (-1153.741) [-1150.636] * (-1151.346) (-1153.569) [-1150.731] (-1154.135) -- 0:00:44
298500 -- (-1151.116) [-1153.802] (-1155.937) (-1151.173) * [-1150.644] (-1153.778) (-1150.851) (-1156.912) -- 0:00:44
299000 -- [-1153.297] (-1151.626) (-1155.925) (-1153.556) * [-1150.846] (-1151.608) (-1154.652) (-1155.836) -- 0:00:44
299500 -- (-1153.190) (-1150.556) (-1157.341) [-1152.024] * (-1152.604) (-1151.364) [-1154.015] (-1154.804) -- 0:00:44
300000 -- (-1150.041) [-1149.979] (-1155.803) (-1150.259) * [-1154.425] (-1153.117) (-1151.898) (-1154.668) -- 0:00:44
Average standard deviation of split frequencies: 0.017247
300500 -- (-1151.421) (-1151.418) (-1156.989) [-1150.947] * (-1151.042) (-1152.404) [-1151.547] (-1151.531) -- 0:00:44
301000 -- (-1150.883) (-1153.356) (-1151.453) [-1151.226] * (-1154.663) (-1152.858) (-1154.013) [-1151.379] -- 0:00:44
301500 -- (-1150.671) (-1152.963) (-1152.159) [-1151.494] * (-1152.718) (-1152.526) [-1153.888] (-1154.655) -- 0:00:44
302000 -- [-1151.797] (-1154.152) (-1152.046) (-1152.786) * (-1152.496) (-1150.634) [-1155.086] (-1149.885) -- 0:00:43
302500 -- (-1152.088) (-1158.217) (-1149.847) [-1153.273] * (-1154.216) [-1150.782] (-1151.546) (-1151.739) -- 0:00:43
303000 -- [-1150.541] (-1157.737) (-1150.154) (-1153.963) * (-1152.674) (-1150.277) (-1151.428) [-1154.363] -- 0:00:43
303500 -- [-1150.472] (-1151.061) (-1151.627) (-1151.012) * [-1152.230] (-1149.922) (-1154.215) (-1153.162) -- 0:00:43
304000 -- (-1150.356) (-1152.327) (-1153.102) [-1152.762] * (-1150.057) [-1150.531] (-1151.920) (-1154.660) -- 0:00:43
304500 -- (-1150.702) (-1152.069) [-1154.354] (-1151.650) * [-1154.467] (-1151.831) (-1151.574) (-1153.209) -- 0:00:43
305000 -- (-1156.935) (-1150.476) [-1154.371] (-1151.528) * (-1156.102) (-1154.613) [-1151.542] (-1150.688) -- 0:00:43
Average standard deviation of split frequencies: 0.017331
305500 -- (-1153.005) (-1151.081) (-1152.642) [-1152.716] * (-1150.594) (-1156.794) [-1150.704] (-1153.435) -- 0:00:43
306000 -- (-1151.429) (-1152.206) (-1154.080) [-1153.309] * [-1151.980] (-1154.970) (-1151.897) (-1154.986) -- 0:00:43
306500 -- (-1150.712) (-1149.913) [-1151.018] (-1157.008) * [-1155.658] (-1153.655) (-1151.090) (-1152.006) -- 0:00:42
307000 -- (-1150.394) (-1152.024) [-1150.487] (-1150.707) * (-1152.685) (-1152.372) [-1151.947] (-1154.168) -- 0:00:42
307500 -- (-1150.294) (-1151.396) (-1153.301) [-1153.657] * (-1154.560) (-1153.627) (-1152.598) [-1153.139] -- 0:00:42
308000 -- (-1150.194) [-1152.266] (-1153.056) (-1154.273) * (-1153.255) (-1152.499) (-1153.047) [-1153.613] -- 0:00:44
308500 -- (-1151.385) [-1152.791] (-1152.883) (-1153.252) * [-1154.525] (-1153.432) (-1152.217) (-1152.943) -- 0:00:44
309000 -- (-1152.615) (-1150.455) [-1153.712] (-1151.565) * (-1152.389) (-1151.903) (-1153.911) [-1150.509] -- 0:00:44
309500 -- (-1152.494) (-1150.803) [-1152.591] (-1151.613) * (-1151.309) [-1151.180] (-1152.873) (-1152.246) -- 0:00:44
310000 -- (-1153.713) [-1150.402] (-1152.338) (-1154.436) * [-1152.454] (-1153.512) (-1154.403) (-1151.177) -- 0:00:44
Average standard deviation of split frequencies: 0.018304
310500 -- (-1153.740) (-1150.972) [-1151.436] (-1151.141) * [-1150.753] (-1150.209) (-1152.456) (-1151.674) -- 0:00:44
311000 -- [-1150.550] (-1151.018) (-1155.399) (-1150.207) * (-1153.985) (-1150.625) (-1154.939) [-1150.481] -- 0:00:44
311500 -- (-1150.498) [-1151.355] (-1153.498) (-1152.777) * (-1156.357) [-1150.727] (-1154.433) (-1151.946) -- 0:00:44
312000 -- (-1150.456) [-1151.272] (-1153.160) (-1154.048) * (-1152.184) (-1152.495) (-1151.495) [-1154.269] -- 0:00:44
312500 -- (-1151.388) (-1150.661) [-1150.100] (-1154.576) * (-1152.518) (-1152.661) [-1151.222] (-1152.675) -- 0:00:44
313000 -- (-1151.209) (-1151.052) (-1151.259) [-1150.428] * (-1152.112) (-1153.706) (-1150.263) [-1151.974] -- 0:00:43
313500 -- (-1154.592) (-1151.753) [-1152.300] (-1152.065) * (-1153.972) (-1153.828) [-1152.730] (-1150.965) -- 0:00:43
314000 -- [-1150.559] (-1151.714) (-1151.761) (-1150.161) * (-1151.482) (-1154.143) (-1151.114) [-1150.741] -- 0:00:43
314500 -- (-1150.983) [-1152.281] (-1153.808) (-1152.439) * (-1152.784) (-1152.353) [-1152.627] (-1150.776) -- 0:00:43
315000 -- [-1152.289] (-1152.543) (-1152.306) (-1160.069) * (-1150.567) [-1152.684] (-1152.127) (-1150.783) -- 0:00:43
Average standard deviation of split frequencies: 0.019020
315500 -- [-1153.562] (-1152.307) (-1150.291) (-1151.041) * (-1150.453) (-1152.657) (-1151.084) [-1152.868] -- 0:00:43
316000 -- [-1155.286] (-1153.468) (-1159.569) (-1157.484) * (-1155.910) (-1153.950) (-1153.510) [-1150.577] -- 0:00:43
316500 -- (-1155.121) [-1158.109] (-1151.069) (-1154.388) * (-1150.520) [-1153.849] (-1152.081) (-1151.616) -- 0:00:43
317000 -- (-1151.715) (-1159.784) (-1150.085) [-1151.074] * (-1152.479) [-1151.898] (-1150.592) (-1151.452) -- 0:00:43
317500 -- [-1151.734] (-1159.214) (-1152.217) (-1153.462) * (-1149.906) [-1151.064] (-1153.175) (-1150.716) -- 0:00:42
318000 -- (-1153.178) (-1157.822) [-1150.570] (-1153.140) * (-1151.637) (-1152.023) [-1154.382] (-1151.390) -- 0:00:42
318500 -- [-1154.853] (-1152.115) (-1153.084) (-1150.755) * (-1151.757) (-1152.257) [-1153.921] (-1152.115) -- 0:00:42
319000 -- (-1157.184) (-1151.835) (-1154.290) [-1152.900] * (-1151.384) (-1151.762) (-1150.645) [-1151.562] -- 0:00:42
319500 -- (-1155.124) (-1153.372) (-1154.540) [-1151.737] * (-1152.113) (-1152.678) [-1152.312] (-1152.240) -- 0:00:42
320000 -- [-1152.048] (-1153.554) (-1154.295) (-1152.143) * [-1150.785] (-1156.262) (-1151.626) (-1152.939) -- 0:00:42
Average standard deviation of split frequencies: 0.018376
320500 -- (-1152.960) (-1155.369) (-1152.056) [-1152.708] * [-1153.332] (-1151.465) (-1152.057) (-1152.772) -- 0:00:42
321000 -- (-1152.167) [-1152.269] (-1152.435) (-1153.921) * [-1153.721] (-1150.788) (-1153.802) (-1154.835) -- 0:00:42
321500 -- (-1151.513) (-1151.250) (-1151.578) [-1153.109] * (-1151.895) (-1151.228) [-1153.129] (-1154.294) -- 0:00:42
322000 -- [-1149.825] (-1151.576) (-1154.374) (-1152.787) * (-1151.910) [-1153.868] (-1156.083) (-1150.751) -- 0:00:42
322500 -- [-1149.704] (-1153.240) (-1151.484) (-1152.493) * [-1152.098] (-1151.837) (-1151.799) (-1154.381) -- 0:00:42
323000 -- (-1150.276) (-1152.768) (-1150.839) [-1150.113] * (-1157.973) [-1151.075] (-1152.175) (-1150.769) -- 0:00:41
323500 -- (-1153.420) (-1157.378) [-1155.628] (-1149.744) * (-1149.995) [-1151.512] (-1151.623) (-1152.351) -- 0:00:43
324000 -- (-1150.839) (-1150.966) [-1150.562] (-1149.825) * [-1151.563] (-1153.102) (-1151.344) (-1156.272) -- 0:00:43
324500 -- (-1153.518) (-1153.475) [-1151.414] (-1149.828) * (-1152.801) (-1152.205) [-1151.919] (-1152.122) -- 0:00:43
325000 -- [-1151.689] (-1152.668) (-1151.501) (-1151.337) * (-1150.644) [-1154.963] (-1153.101) (-1151.864) -- 0:00:43
Average standard deviation of split frequencies: 0.018713
325500 -- (-1151.137) (-1153.649) [-1152.247] (-1150.725) * (-1152.143) (-1152.842) (-1153.876) [-1155.162] -- 0:00:43
326000 -- (-1150.913) (-1151.866) [-1150.291] (-1151.735) * (-1151.790) [-1153.592] (-1151.331) (-1153.754) -- 0:00:43
326500 -- (-1153.367) (-1150.849) (-1150.865) [-1155.612] * [-1152.782] (-1151.931) (-1151.182) (-1151.340) -- 0:00:43
327000 -- (-1152.622) (-1154.576) [-1151.867] (-1155.761) * (-1152.474) [-1151.259] (-1154.428) (-1151.599) -- 0:00:43
327500 -- (-1151.958) [-1153.327] (-1152.377) (-1153.962) * (-1152.034) [-1151.500] (-1153.639) (-1151.585) -- 0:00:43
328000 -- [-1151.860] (-1152.342) (-1152.085) (-1152.481) * (-1157.486) (-1154.516) (-1151.742) [-1152.114] -- 0:00:43
328500 -- [-1152.832] (-1150.876) (-1152.449) (-1153.265) * (-1153.547) [-1153.195] (-1151.458) (-1151.318) -- 0:00:42
329000 -- (-1150.506) (-1152.368) [-1154.387] (-1152.441) * (-1152.154) (-1150.577) [-1151.805] (-1150.631) -- 0:00:42
329500 -- [-1151.603] (-1153.834) (-1155.240) (-1151.113) * (-1151.225) [-1152.347] (-1155.791) (-1151.270) -- 0:00:42
330000 -- (-1151.447) (-1152.126) (-1155.159) [-1151.750] * (-1153.055) [-1152.093] (-1158.426) (-1150.577) -- 0:00:42
Average standard deviation of split frequencies: 0.018449
330500 -- (-1151.634) (-1151.870) (-1151.659) [-1151.763] * (-1152.735) [-1152.399] (-1157.090) (-1152.757) -- 0:00:42
331000 -- (-1152.038) (-1159.422) (-1150.380) [-1152.097] * (-1152.077) [-1155.364] (-1151.151) (-1151.131) -- 0:00:42
331500 -- (-1150.458) (-1150.414) [-1151.370] (-1153.383) * (-1153.671) [-1151.595] (-1152.932) (-1157.316) -- 0:00:42
332000 -- (-1151.659) (-1150.106) (-1151.108) [-1155.040] * [-1151.478] (-1151.952) (-1152.517) (-1151.443) -- 0:00:42
332500 -- (-1152.172) [-1152.834] (-1150.857) (-1155.041) * [-1152.236] (-1149.861) (-1152.923) (-1151.513) -- 0:00:42
333000 -- [-1151.196] (-1150.717) (-1153.234) (-1161.170) * (-1151.798) (-1152.401) (-1151.653) [-1151.506] -- 0:00:42
333500 -- (-1152.340) [-1150.636] (-1153.035) (-1150.185) * [-1151.346] (-1151.021) (-1151.048) (-1150.195) -- 0:00:41
334000 -- (-1151.256) (-1151.134) (-1150.537) [-1150.502] * (-1150.755) [-1151.132] (-1152.408) (-1153.088) -- 0:00:41
334500 -- [-1154.737] (-1153.677) (-1153.904) (-1151.070) * [-1150.297] (-1152.286) (-1152.084) (-1154.157) -- 0:00:41
335000 -- (-1151.930) (-1150.331) (-1152.579) [-1150.597] * (-1151.023) [-1151.911] (-1152.149) (-1154.941) -- 0:00:41
Average standard deviation of split frequencies: 0.018151
335500 -- (-1150.168) (-1150.680) (-1152.258) [-1150.279] * (-1151.538) (-1157.560) [-1152.143] (-1153.402) -- 0:00:41
336000 -- (-1151.592) (-1150.865) [-1155.020] (-1150.776) * (-1152.535) (-1152.783) [-1153.390] (-1153.469) -- 0:00:41
336500 -- (-1154.493) (-1150.735) (-1154.553) [-1154.112] * [-1149.924] (-1150.580) (-1154.519) (-1151.563) -- 0:00:41
337000 -- (-1153.913) [-1154.157] (-1157.766) (-1155.380) * (-1149.960) [-1150.971] (-1154.007) (-1152.276) -- 0:00:41
337500 -- (-1151.066) (-1153.481) [-1153.844] (-1151.491) * (-1150.460) [-1152.685] (-1152.175) (-1153.715) -- 0:00:41
338000 -- [-1150.769] (-1154.778) (-1155.541) (-1150.082) * (-1150.467) [-1150.559] (-1150.180) (-1152.831) -- 0:00:41
338500 -- (-1150.698) [-1152.365] (-1151.203) (-1152.120) * (-1149.898) (-1150.492) (-1156.057) [-1154.227] -- 0:00:42
339000 -- [-1151.423] (-1150.834) (-1152.634) (-1151.714) * (-1152.834) (-1153.181) [-1154.825] (-1153.154) -- 0:00:42
339500 -- (-1153.705) (-1150.275) [-1151.105] (-1151.602) * (-1157.114) (-1152.840) (-1150.372) [-1150.866] -- 0:00:42
340000 -- (-1151.451) [-1150.400] (-1151.327) (-1152.781) * (-1152.255) [-1152.701] (-1152.659) (-1151.748) -- 0:00:42
Average standard deviation of split frequencies: 0.017989
340500 -- (-1151.332) (-1151.245) (-1154.146) [-1152.832] * [-1153.362] (-1152.036) (-1151.409) (-1156.011) -- 0:00:42
341000 -- (-1151.264) (-1150.757) [-1152.896] (-1155.552) * (-1151.888) (-1152.342) (-1151.737) [-1153.774] -- 0:00:42
341500 -- [-1151.679] (-1150.644) (-1152.528) (-1152.900) * (-1150.287) (-1152.806) [-1151.159] (-1151.237) -- 0:00:42
342000 -- [-1153.292] (-1151.605) (-1150.513) (-1152.931) * [-1150.311] (-1153.252) (-1151.514) (-1150.418) -- 0:00:42
342500 -- (-1153.723) [-1152.068] (-1152.476) (-1152.512) * (-1151.555) (-1153.848) [-1155.389] (-1153.199) -- 0:00:42
343000 -- (-1154.791) [-1152.245] (-1153.328) (-1155.138) * (-1150.962) [-1152.985] (-1156.581) (-1152.030) -- 0:00:42
343500 -- (-1151.551) [-1152.057] (-1154.345) (-1154.559) * [-1152.579] (-1151.966) (-1155.240) (-1150.789) -- 0:00:42
344000 -- [-1152.917] (-1152.648) (-1152.898) (-1153.963) * (-1151.389) (-1152.981) [-1151.536] (-1150.869) -- 0:00:41
344500 -- (-1152.946) [-1154.163] (-1150.670) (-1152.933) * [-1152.102] (-1150.525) (-1152.287) (-1155.456) -- 0:00:41
345000 -- (-1152.073) (-1150.977) [-1154.504] (-1152.352) * (-1156.367) (-1152.253) [-1150.745] (-1154.407) -- 0:00:41
Average standard deviation of split frequencies: 0.017541
345500 -- (-1151.301) (-1154.055) (-1151.277) [-1152.885] * (-1153.953) (-1149.906) [-1154.361] (-1151.598) -- 0:00:41
346000 -- (-1152.706) [-1151.845] (-1150.644) (-1152.205) * (-1150.449) (-1150.036) (-1153.223) [-1152.027] -- 0:00:41
346500 -- (-1152.283) (-1152.758) (-1155.127) [-1152.922] * (-1150.092) (-1149.991) [-1154.085] (-1151.646) -- 0:00:41
347000 -- (-1152.771) (-1151.418) [-1150.693] (-1151.604) * (-1151.470) (-1152.139) [-1151.684] (-1157.253) -- 0:00:41
347500 -- (-1161.877) [-1151.681] (-1154.235) (-1151.617) * (-1151.039) (-1152.402) [-1152.974] (-1153.079) -- 0:00:41
348000 -- [-1159.818] (-1151.646) (-1153.461) (-1151.108) * (-1150.559) (-1150.872) [-1153.761] (-1152.279) -- 0:00:41
348500 -- [-1152.773] (-1153.182) (-1153.347) (-1151.674) * [-1150.542] (-1151.491) (-1151.867) (-1153.533) -- 0:00:41
349000 -- (-1153.845) (-1157.601) (-1154.661) [-1151.508] * (-1155.054) [-1155.030] (-1152.418) (-1153.211) -- 0:00:41
349500 -- (-1154.254) (-1154.586) [-1150.661] (-1152.730) * (-1152.538) (-1150.638) (-1152.979) [-1151.122] -- 0:00:40
350000 -- (-1152.538) (-1153.810) (-1150.666) [-1151.534] * (-1152.932) (-1151.342) [-1151.854] (-1151.757) -- 0:00:40
Average standard deviation of split frequencies: 0.015894
350500 -- (-1153.920) [-1152.473] (-1153.129) (-1152.226) * (-1150.401) (-1152.095) [-1152.368] (-1160.485) -- 0:00:40
351000 -- (-1154.192) (-1154.125) (-1153.013) [-1151.923] * (-1150.462) (-1153.882) [-1154.227] (-1152.404) -- 0:00:40
351500 -- (-1153.339) (-1154.897) (-1153.658) [-1155.857] * (-1151.460) (-1151.797) [-1150.326] (-1152.274) -- 0:00:40
352000 -- (-1153.124) [-1150.767] (-1153.206) (-1154.802) * (-1151.373) (-1153.188) (-1150.074) [-1151.820] -- 0:00:40
352500 -- (-1150.525) (-1154.584) (-1152.520) [-1153.258] * (-1151.948) (-1154.432) (-1151.296) [-1152.862] -- 0:00:40
353000 -- [-1151.536] (-1152.585) (-1152.545) (-1152.911) * (-1152.235) (-1152.025) (-1151.081) [-1152.717] -- 0:00:40
353500 -- (-1150.271) (-1153.134) [-1152.595] (-1151.878) * (-1150.934) (-1156.420) [-1151.440] (-1153.070) -- 0:00:40
354000 -- (-1152.146) (-1153.112) (-1151.686) [-1153.143] * [-1150.992] (-1154.474) (-1156.296) (-1154.057) -- 0:00:40
354500 -- [-1150.857] (-1152.282) (-1150.021) (-1152.673) * (-1154.066) (-1152.353) [-1152.645] (-1153.310) -- 0:00:40
355000 -- [-1151.774] (-1156.515) (-1149.999) (-1151.229) * (-1156.110) [-1151.955] (-1150.957) (-1153.069) -- 0:00:41
Average standard deviation of split frequencies: 0.016435
355500 -- [-1151.519] (-1152.892) (-1150.077) (-1152.022) * (-1152.695) [-1153.313] (-1154.888) (-1151.406) -- 0:00:41
356000 -- [-1151.879] (-1155.304) (-1150.299) (-1152.655) * (-1151.549) (-1154.777) (-1151.516) [-1150.804] -- 0:00:41
356500 -- [-1152.072] (-1155.200) (-1157.149) (-1153.485) * [-1150.771] (-1153.658) (-1154.442) (-1157.343) -- 0:00:41
357000 -- [-1151.634] (-1153.441) (-1156.304) (-1155.312) * [-1151.347] (-1151.597) (-1150.853) (-1153.103) -- 0:00:41
357500 -- (-1151.984) (-1153.707) [-1156.325] (-1150.688) * (-1151.839) (-1150.922) [-1150.313] (-1152.076) -- 0:00:41
358000 -- (-1152.586) (-1151.822) [-1151.646] (-1150.753) * (-1153.312) (-1151.349) (-1151.036) [-1152.527] -- 0:00:41
358500 -- (-1150.726) (-1153.633) [-1152.951] (-1152.291) * [-1150.736] (-1150.402) (-1152.316) (-1150.867) -- 0:00:41
359000 -- (-1153.050) (-1152.739) [-1151.466] (-1150.480) * (-1156.264) (-1150.473) [-1150.413] (-1151.172) -- 0:00:41
359500 -- (-1151.531) [-1151.783] (-1151.979) (-1150.966) * (-1159.021) (-1150.669) [-1151.719] (-1152.216) -- 0:00:40
360000 -- (-1150.118) (-1150.086) [-1151.057] (-1151.824) * (-1155.075) (-1151.090) (-1151.114) [-1152.416] -- 0:00:40
Average standard deviation of split frequencies: 0.016684
360500 -- [-1154.448] (-1150.596) (-1150.465) (-1155.788) * (-1157.345) (-1152.322) (-1154.055) [-1151.836] -- 0:00:40
361000 -- (-1149.686) [-1152.101] (-1150.820) (-1156.281) * (-1157.366) (-1154.346) (-1154.139) [-1150.933] -- 0:00:40
361500 -- (-1150.659) (-1150.425) [-1151.171] (-1157.041) * (-1151.294) (-1150.829) [-1150.479] (-1150.031) -- 0:00:40
362000 -- (-1152.649) (-1154.362) (-1150.562) [-1152.195] * (-1150.598) (-1156.048) [-1151.471] (-1153.598) -- 0:00:40
362500 -- (-1150.573) (-1152.760) [-1149.885] (-1159.145) * (-1152.122) [-1152.861] (-1151.841) (-1155.093) -- 0:00:40
363000 -- [-1151.961] (-1154.412) (-1150.426) (-1154.132) * [-1150.668] (-1151.835) (-1154.979) (-1151.595) -- 0:00:40
363500 -- [-1150.375] (-1155.802) (-1152.914) (-1151.040) * (-1151.067) [-1151.796] (-1154.138) (-1153.974) -- 0:00:40
364000 -- (-1153.130) (-1154.107) [-1152.111] (-1154.844) * (-1152.352) [-1151.750] (-1152.229) (-1156.684) -- 0:00:40
364500 -- (-1154.875) [-1154.497] (-1151.909) (-1150.971) * [-1150.780] (-1153.064) (-1154.206) (-1155.344) -- 0:00:40
365000 -- [-1151.307] (-1155.518) (-1153.109) (-1152.709) * (-1150.703) (-1155.342) (-1153.283) [-1153.136] -- 0:00:40
Average standard deviation of split frequencies: 0.016138
365500 -- (-1150.934) (-1150.370) (-1151.475) [-1151.884] * (-1150.284) (-1154.068) (-1153.775) [-1150.508] -- 0:00:39
366000 -- (-1150.274) [-1152.195] (-1152.130) (-1150.291) * (-1152.456) (-1152.094) [-1152.487] (-1150.543) -- 0:00:39
366500 -- [-1150.988] (-1153.516) (-1155.665) (-1151.625) * [-1153.138] (-1153.223) (-1152.318) (-1153.682) -- 0:00:39
367000 -- (-1154.052) [-1154.494] (-1153.583) (-1152.251) * (-1152.796) (-1154.694) [-1151.043] (-1150.739) -- 0:00:39
367500 -- (-1152.137) (-1155.338) (-1150.794) [-1152.215] * [-1152.010] (-1153.594) (-1152.248) (-1150.900) -- 0:00:39
368000 -- (-1153.128) [-1152.164] (-1150.904) (-1153.942) * (-1150.093) (-1152.080) (-1153.775) [-1151.812] -- 0:00:39
368500 -- [-1151.279] (-1150.562) (-1150.486) (-1153.063) * (-1150.068) [-1153.999] (-1151.040) (-1152.103) -- 0:00:39
369000 -- (-1150.707) [-1150.223] (-1151.333) (-1153.844) * (-1150.173) [-1153.328] (-1150.049) (-1153.322) -- 0:00:39
369500 -- (-1151.318) (-1152.290) [-1150.680] (-1154.909) * (-1150.521) (-1152.234) [-1156.623] (-1152.086) -- 0:00:39
370000 -- (-1151.102) (-1151.361) [-1152.646] (-1152.499) * (-1151.930) (-1151.696) (-1150.821) [-1150.926] -- 0:00:39
Average standard deviation of split frequencies: 0.015037
370500 -- [-1150.755] (-1154.448) (-1150.350) (-1154.880) * [-1150.169] (-1153.514) (-1153.272) (-1151.076) -- 0:00:39
371000 -- (-1154.328) (-1157.614) (-1150.350) [-1155.063] * (-1151.131) (-1151.469) [-1150.739] (-1150.560) -- 0:00:38
371500 -- (-1153.609) (-1153.792) [-1151.906] (-1151.483) * (-1150.692) (-1152.491) [-1151.360] (-1150.443) -- 0:00:40
372000 -- (-1155.394) (-1151.538) [-1152.802] (-1151.511) * (-1150.724) [-1150.343] (-1150.805) (-1153.654) -- 0:00:40
372500 -- (-1153.829) [-1150.780] (-1150.761) (-1150.063) * (-1150.097) (-1153.251) [-1150.290] (-1155.524) -- 0:00:40
373000 -- (-1149.815) (-1152.844) (-1151.457) [-1150.052] * (-1151.731) [-1154.048] (-1154.417) (-1153.451) -- 0:00:40
373500 -- [-1150.485] (-1151.356) (-1154.079) (-1151.867) * (-1150.836) (-1149.848) (-1150.738) [-1153.014] -- 0:00:40
374000 -- (-1150.665) (-1152.792) (-1153.163) [-1153.267] * (-1150.356) (-1150.005) [-1151.255] (-1155.027) -- 0:00:40
374500 -- (-1150.744) (-1153.269) (-1153.027) [-1150.515] * (-1155.638) (-1150.764) [-1154.346] (-1151.586) -- 0:00:40
375000 -- (-1151.412) [-1154.553] (-1152.175) (-1151.441) * (-1154.880) (-1149.968) [-1149.788] (-1153.393) -- 0:00:40
Average standard deviation of split frequencies: 0.015266
375500 -- (-1156.654) [-1155.035] (-1153.674) (-1152.814) * (-1155.636) [-1150.272] (-1151.189) (-1152.664) -- 0:00:39
376000 -- (-1162.328) [-1151.686] (-1152.165) (-1155.321) * (-1150.737) [-1151.420] (-1152.063) (-1151.837) -- 0:00:39
376500 -- (-1164.982) [-1153.254] (-1152.573) (-1152.673) * (-1151.227) (-1152.284) [-1151.149] (-1151.307) -- 0:00:39
377000 -- (-1152.019) [-1150.521] (-1153.095) (-1156.369) * (-1151.321) (-1152.980) [-1150.307] (-1153.187) -- 0:00:39
377500 -- (-1151.129) (-1156.351) [-1155.161] (-1153.832) * [-1151.954] (-1150.759) (-1151.538) (-1154.320) -- 0:00:39
378000 -- (-1151.660) [-1156.401] (-1155.618) (-1152.851) * [-1151.200] (-1158.029) (-1152.433) (-1151.861) -- 0:00:39
378500 -- (-1150.718) (-1162.578) [-1152.411] (-1152.723) * (-1152.515) [-1150.691] (-1153.707) (-1154.454) -- 0:00:39
379000 -- (-1150.985) (-1152.727) [-1153.214] (-1151.891) * [-1153.923] (-1149.981) (-1165.269) (-1157.426) -- 0:00:39
379500 -- (-1152.342) [-1152.811] (-1154.040) (-1151.997) * (-1151.552) (-1153.020) [-1151.563] (-1153.571) -- 0:00:39
380000 -- (-1152.826) (-1153.029) (-1151.175) [-1153.018] * [-1155.270] (-1153.289) (-1151.651) (-1153.966) -- 0:00:39
Average standard deviation of split frequencies: 0.015712
380500 -- (-1151.371) [-1151.490] (-1150.186) (-1153.776) * (-1152.222) (-1151.301) [-1153.193] (-1151.907) -- 0:00:39
381000 -- (-1151.241) (-1152.257) [-1150.644] (-1151.240) * (-1150.165) (-1152.168) (-1151.418) [-1150.358] -- 0:00:38
381500 -- (-1151.797) (-1150.924) [-1155.123] (-1153.522) * [-1153.469] (-1154.989) (-1151.836) (-1152.493) -- 0:00:38
382000 -- (-1152.773) (-1150.863) [-1152.265] (-1153.166) * (-1152.105) (-1153.074) [-1154.287] (-1152.501) -- 0:00:38
382500 -- (-1152.664) (-1154.592) (-1152.297) [-1155.149] * (-1153.083) [-1150.952] (-1151.847) (-1157.292) -- 0:00:38
383000 -- (-1152.991) [-1151.247] (-1151.245) (-1152.026) * (-1152.222) [-1149.965] (-1152.467) (-1151.449) -- 0:00:38
383500 -- [-1152.251] (-1153.329) (-1151.361) (-1155.106) * (-1153.263) (-1155.497) (-1151.631) [-1151.842] -- 0:00:38
384000 -- (-1157.274) [-1153.393] (-1151.437) (-1150.889) * (-1153.439) (-1154.866) (-1152.327) [-1152.911] -- 0:00:38
384500 -- [-1156.168] (-1154.768) (-1155.529) (-1154.749) * (-1151.833) (-1151.296) (-1155.251) [-1155.551] -- 0:00:38
385000 -- (-1154.163) [-1152.364] (-1152.834) (-1152.570) * (-1152.621) [-1150.382] (-1156.621) (-1151.846) -- 0:00:38
Average standard deviation of split frequencies: 0.016029
385500 -- (-1151.096) [-1151.666] (-1151.217) (-1151.829) * (-1152.917) (-1152.417) (-1155.757) [-1152.681] -- 0:00:38
386000 -- (-1152.265) (-1151.098) (-1151.575) [-1151.157] * (-1152.198) (-1152.949) (-1155.509) [-1152.401] -- 0:00:38
386500 -- (-1152.062) (-1150.974) [-1150.921] (-1151.178) * [-1151.681] (-1152.655) (-1154.160) (-1150.684) -- 0:00:38
387000 -- (-1152.336) (-1151.728) (-1151.379) [-1150.669] * [-1150.825] (-1155.458) (-1151.477) (-1150.011) -- 0:00:38
387500 -- [-1152.852] (-1153.961) (-1155.718) (-1151.762) * (-1151.227) [-1154.211] (-1151.894) (-1150.996) -- 0:00:37
388000 -- [-1151.632] (-1153.027) (-1151.750) (-1150.828) * (-1151.641) [-1152.357] (-1151.421) (-1153.787) -- 0:00:39
388500 -- (-1153.448) [-1150.186] (-1157.393) (-1150.836) * (-1154.620) [-1151.144] (-1151.658) (-1153.805) -- 0:00:39
389000 -- (-1151.450) (-1152.406) [-1151.584] (-1152.025) * (-1152.316) (-1153.966) [-1153.972] (-1152.455) -- 0:00:39
389500 -- (-1152.410) [-1151.149] (-1150.317) (-1153.406) * (-1153.449) [-1152.792] (-1157.006) (-1154.005) -- 0:00:39
390000 -- (-1151.231) (-1150.941) (-1153.059) [-1151.902] * (-1153.111) (-1150.999) (-1156.647) [-1153.806] -- 0:00:39
Average standard deviation of split frequencies: 0.015611
390500 -- (-1153.492) [-1152.325] (-1152.222) (-1153.338) * (-1153.082) (-1151.254) [-1150.677] (-1152.888) -- 0:00:39
391000 -- (-1151.588) (-1153.600) (-1152.669) [-1157.091] * (-1151.755) [-1150.442] (-1152.571) (-1153.985) -- 0:00:38
391500 -- (-1150.918) [-1152.194] (-1151.435) (-1154.301) * (-1152.049) (-1150.139) (-1152.294) [-1153.258] -- 0:00:38
392000 -- (-1153.756) [-1151.022] (-1153.088) (-1154.184) * (-1151.685) (-1150.472) (-1151.693) [-1151.276] -- 0:00:38
392500 -- (-1154.068) (-1151.371) (-1154.791) [-1151.259] * (-1151.572) [-1151.021] (-1150.380) (-1150.937) -- 0:00:38
393000 -- (-1158.758) [-1152.890] (-1150.925) (-1152.428) * (-1152.685) [-1151.640] (-1150.862) (-1151.115) -- 0:00:38
393500 -- (-1152.621) (-1152.325) (-1150.871) [-1150.991] * [-1152.188] (-1154.121) (-1151.873) (-1151.105) -- 0:00:38
394000 -- [-1150.849] (-1153.433) (-1150.197) (-1156.105) * [-1152.299] (-1154.848) (-1151.488) (-1151.167) -- 0:00:38
394500 -- (-1151.480) [-1150.073] (-1152.141) (-1155.112) * (-1151.107) (-1151.846) (-1150.427) [-1150.848] -- 0:00:38
395000 -- (-1150.576) [-1151.610] (-1151.364) (-1152.337) * (-1151.753) (-1156.626) (-1153.314) [-1150.621] -- 0:00:38
Average standard deviation of split frequencies: 0.014806
395500 -- [-1150.567] (-1153.948) (-1150.809) (-1151.023) * (-1151.840) [-1154.884] (-1152.193) (-1153.467) -- 0:00:38
396000 -- [-1154.629] (-1152.367) (-1150.735) (-1152.462) * (-1153.630) (-1156.525) [-1156.065] (-1151.206) -- 0:00:38
396500 -- [-1155.135] (-1150.800) (-1153.342) (-1152.060) * (-1152.913) [-1153.071] (-1154.096) (-1153.050) -- 0:00:38
397000 -- (-1151.021) (-1151.586) [-1151.816] (-1150.543) * (-1151.786) (-1152.643) (-1157.706) [-1152.075] -- 0:00:37
397500 -- (-1150.971) (-1151.924) [-1152.363] (-1151.403) * (-1154.426) (-1150.345) (-1153.909) [-1155.701] -- 0:00:37
398000 -- (-1151.600) [-1152.445] (-1151.243) (-1152.168) * (-1151.731) (-1152.406) [-1153.301] (-1154.977) -- 0:00:37
398500 -- (-1150.222) (-1150.558) [-1153.767] (-1152.023) * (-1153.628) [-1151.544] (-1153.839) (-1153.297) -- 0:00:37
399000 -- (-1153.255) (-1151.392) (-1156.937) [-1151.903] * [-1153.343] (-1151.645) (-1150.127) (-1154.277) -- 0:00:37
399500 -- (-1150.869) (-1151.130) [-1150.458] (-1151.061) * (-1151.788) (-1150.650) (-1149.823) [-1152.468] -- 0:00:37
400000 -- (-1152.290) (-1152.587) (-1151.820) [-1151.256] * (-1152.759) [-1150.521] (-1150.286) (-1152.513) -- 0:00:37
Average standard deviation of split frequencies: 0.013773
400500 -- [-1152.572] (-1152.578) (-1149.791) (-1152.634) * (-1151.621) [-1150.421] (-1151.160) (-1152.234) -- 0:00:37
401000 -- (-1150.658) (-1152.717) [-1151.596] (-1151.285) * (-1150.790) (-1150.432) [-1151.343] (-1151.749) -- 0:00:37
401500 -- [-1151.212] (-1152.030) (-1151.785) (-1155.829) * [-1150.793] (-1153.687) (-1152.219) (-1153.144) -- 0:00:37
402000 -- (-1155.294) [-1153.495] (-1151.627) (-1154.094) * [-1150.588] (-1154.583) (-1152.121) (-1152.604) -- 0:00:37
402500 -- (-1151.596) [-1152.137] (-1152.612) (-1151.329) * (-1150.734) (-1154.071) (-1150.075) [-1152.242] -- 0:00:37
403000 -- (-1151.755) (-1155.995) (-1151.097) [-1152.845] * (-1150.185) (-1153.673) [-1152.625] (-1151.961) -- 0:00:37
403500 -- [-1151.373] (-1151.337) (-1151.195) (-1152.346) * [-1150.920] (-1152.452) (-1157.717) (-1151.114) -- 0:00:38
404000 -- (-1152.592) (-1155.581) [-1152.193] (-1150.691) * (-1152.467) (-1152.648) [-1152.145] (-1151.830) -- 0:00:38
404500 -- (-1150.973) [-1151.479] (-1154.374) (-1150.915) * (-1151.365) (-1150.688) (-1154.628) [-1150.550] -- 0:00:38
405000 -- [-1151.709] (-1153.724) (-1151.119) (-1152.021) * (-1152.392) [-1149.906] (-1154.575) (-1151.814) -- 0:00:38
Average standard deviation of split frequencies: 0.013546
405500 -- (-1150.871) (-1153.175) (-1153.362) [-1151.793] * [-1152.830] (-1153.591) (-1151.275) (-1154.670) -- 0:00:38
406000 -- (-1152.798) (-1151.855) [-1151.628] (-1150.817) * (-1153.236) (-1152.223) [-1152.180] (-1151.769) -- 0:00:38
406500 -- [-1153.525] (-1152.131) (-1151.270) (-1150.997) * (-1151.093) [-1150.561] (-1152.231) (-1152.946) -- 0:00:37
407000 -- (-1151.127) [-1151.471] (-1150.283) (-1152.272) * [-1151.813] (-1154.048) (-1153.768) (-1150.869) -- 0:00:37
407500 -- (-1152.919) [-1157.035] (-1151.058) (-1150.836) * (-1152.292) [-1152.028] (-1150.858) (-1154.049) -- 0:00:37
408000 -- (-1151.920) [-1154.675] (-1151.574) (-1150.973) * [-1150.179] (-1153.952) (-1150.406) (-1153.167) -- 0:00:37
408500 -- (-1155.221) (-1153.861) (-1151.012) [-1150.254] * (-1151.875) (-1155.218) [-1152.161] (-1154.183) -- 0:00:37
409000 -- [-1155.411] (-1154.591) (-1152.189) (-1153.600) * (-1155.062) (-1152.789) [-1150.171] (-1152.165) -- 0:00:37
409500 -- (-1152.765) (-1151.878) [-1152.904] (-1154.440) * (-1151.215) (-1151.874) (-1153.204) [-1151.017] -- 0:00:37
410000 -- (-1153.501) (-1153.361) [-1150.843] (-1152.060) * (-1151.851) [-1151.197] (-1156.994) (-1150.880) -- 0:00:37
Average standard deviation of split frequencies: 0.014277
410500 -- (-1150.692) (-1152.503) [-1152.742] (-1152.795) * (-1151.388) [-1150.729] (-1150.518) (-1152.694) -- 0:00:37
411000 -- (-1150.688) (-1151.819) [-1154.347] (-1150.974) * [-1153.381] (-1150.523) (-1151.770) (-1151.821) -- 0:00:37
411500 -- (-1155.119) (-1150.740) [-1151.639] (-1151.344) * [-1152.922] (-1152.303) (-1151.938) (-1152.691) -- 0:00:37
412000 -- [-1151.821] (-1151.857) (-1153.114) (-1151.421) * (-1155.820) [-1153.751] (-1155.433) (-1151.883) -- 0:00:37
412500 -- [-1156.488] (-1152.528) (-1152.528) (-1150.771) * (-1150.953) (-1150.832) (-1155.892) [-1153.697] -- 0:00:37
413000 -- (-1152.567) [-1153.142] (-1151.183) (-1152.223) * (-1155.867) (-1151.030) (-1152.619) [-1154.737] -- 0:00:36
413500 -- (-1153.215) (-1150.487) (-1153.938) [-1152.616] * (-1151.498) [-1151.008] (-1153.754) (-1153.254) -- 0:00:36
414000 -- [-1152.140] (-1150.649) (-1151.617) (-1152.336) * (-1154.772) (-1155.754) [-1152.014] (-1150.993) -- 0:00:36
414500 -- (-1150.816) (-1150.649) (-1153.434) [-1151.409] * (-1157.443) (-1151.105) (-1151.348) [-1151.006] -- 0:00:36
415000 -- (-1150.499) (-1150.476) [-1154.099] (-1151.171) * [-1152.308] (-1152.011) (-1149.881) (-1156.696) -- 0:00:36
Average standard deviation of split frequencies: 0.014731
415500 -- (-1152.739) [-1151.766] (-1151.476) (-1150.929) * (-1154.588) (-1154.980) (-1150.776) [-1153.813] -- 0:00:36
416000 -- (-1153.926) (-1156.062) [-1154.313] (-1150.783) * (-1151.159) (-1151.499) (-1149.715) [-1152.714] -- 0:00:36
416500 -- (-1154.805) (-1157.010) (-1154.272) [-1150.390] * [-1154.429] (-1152.913) (-1149.986) (-1152.176) -- 0:00:36
417000 -- (-1157.052) (-1151.141) [-1151.136] (-1150.403) * (-1152.739) [-1151.917] (-1153.395) (-1150.403) -- 0:00:36
417500 -- (-1154.994) [-1150.504] (-1150.585) (-1152.649) * (-1150.178) (-1153.761) (-1155.759) [-1151.824] -- 0:00:36
418000 -- (-1153.662) (-1154.008) [-1151.962] (-1152.860) * (-1150.470) (-1151.809) (-1153.407) [-1151.716] -- 0:00:36
418500 -- [-1154.734] (-1152.156) (-1155.094) (-1151.880) * (-1151.724) (-1151.429) [-1152.356] (-1152.648) -- 0:00:36
419000 -- (-1152.590) (-1153.349) [-1151.825] (-1152.822) * [-1149.765] (-1154.296) (-1154.001) (-1152.621) -- 0:00:36
419500 -- (-1151.588) (-1151.174) [-1151.565] (-1151.428) * [-1150.953] (-1153.682) (-1162.334) (-1151.021) -- 0:00:37
420000 -- (-1152.098) (-1151.293) (-1151.490) [-1152.223] * [-1151.633] (-1152.571) (-1151.496) (-1151.439) -- 0:00:37
Average standard deviation of split frequencies: 0.014634
420500 -- (-1151.518) (-1151.146) [-1150.581] (-1150.553) * [-1151.279] (-1157.415) (-1152.339) (-1151.351) -- 0:00:37
421000 -- (-1152.011) [-1152.114] (-1151.117) (-1151.260) * (-1151.904) (-1155.882) [-1151.335] (-1154.577) -- 0:00:37
421500 -- [-1155.876] (-1150.724) (-1151.631) (-1150.854) * (-1155.719) (-1151.163) [-1153.640] (-1154.917) -- 0:00:37
422000 -- (-1151.616) (-1150.717) (-1153.135) [-1151.056] * [-1152.188] (-1152.516) (-1151.935) (-1153.412) -- 0:00:36
422500 -- (-1150.826) [-1150.891] (-1156.585) (-1154.222) * (-1150.372) [-1150.509] (-1151.631) (-1155.107) -- 0:00:36
423000 -- [-1150.349] (-1150.714) (-1152.463) (-1153.298) * [-1153.155] (-1150.047) (-1151.193) (-1152.747) -- 0:00:36
423500 -- (-1152.875) [-1150.507] (-1158.503) (-1151.449) * (-1150.997) [-1151.921] (-1156.402) (-1151.053) -- 0:00:36
424000 -- (-1152.176) (-1151.085) (-1158.964) [-1152.958] * (-1150.926) [-1150.726] (-1156.197) (-1153.224) -- 0:00:36
424500 -- (-1151.105) (-1150.567) (-1151.743) [-1152.861] * (-1151.512) (-1154.071) (-1151.833) [-1150.614] -- 0:00:36
425000 -- (-1151.231) [-1153.723] (-1150.038) (-1150.844) * [-1151.059] (-1151.277) (-1155.959) (-1155.913) -- 0:00:36
Average standard deviation of split frequencies: 0.013709
425500 -- (-1150.449) (-1155.398) (-1150.118) [-1154.047] * [-1150.479] (-1151.314) (-1152.431) (-1150.851) -- 0:00:36
426000 -- [-1151.806] (-1155.933) (-1154.583) (-1154.107) * (-1154.955) [-1152.223] (-1152.954) (-1151.889) -- 0:00:36
426500 -- (-1151.512) [-1152.009] (-1152.641) (-1152.551) * (-1151.393) [-1150.146] (-1152.514) (-1150.011) -- 0:00:36
427000 -- [-1152.379] (-1152.156) (-1155.139) (-1152.350) * [-1152.106] (-1152.472) (-1151.573) (-1149.851) -- 0:00:36
427500 -- (-1152.787) (-1152.104) [-1152.956] (-1156.401) * (-1151.591) (-1151.593) (-1153.110) [-1151.853] -- 0:00:36
428000 -- (-1151.819) (-1151.551) (-1152.188) [-1152.647] * (-1151.941) (-1151.793) [-1150.004] (-1151.353) -- 0:00:36
428500 -- (-1151.759) [-1152.341] (-1153.568) (-1156.988) * (-1152.499) (-1152.929) (-1150.504) [-1155.027] -- 0:00:36
429000 -- (-1153.623) (-1152.775) [-1152.712] (-1153.012) * (-1154.046) (-1153.089) [-1150.492] (-1154.480) -- 0:00:35
429500 -- [-1153.190] (-1153.895) (-1155.731) (-1152.901) * [-1152.702] (-1151.458) (-1150.814) (-1152.732) -- 0:00:35
430000 -- (-1154.028) (-1155.120) (-1155.764) [-1150.991] * [-1151.442] (-1151.782) (-1152.506) (-1152.693) -- 0:00:35
Average standard deviation of split frequencies: 0.012942
430500 -- [-1151.068] (-1151.583) (-1152.563) (-1151.336) * (-1152.475) (-1151.058) [-1152.228] (-1153.611) -- 0:00:35
431000 -- [-1151.381] (-1150.427) (-1151.677) (-1151.080) * (-1152.179) [-1152.047] (-1151.076) (-1157.040) -- 0:00:35
431500 -- (-1158.446) (-1150.411) (-1151.303) [-1151.795] * (-1153.300) (-1150.941) (-1153.408) [-1153.804] -- 0:00:35
432000 -- (-1153.618) (-1151.549) (-1151.086) [-1150.778] * (-1152.479) [-1150.295] (-1154.311) (-1152.928) -- 0:00:35
432500 -- [-1151.595] (-1152.422) (-1152.157) (-1150.800) * (-1155.245) (-1151.712) (-1150.759) [-1150.721] -- 0:00:35
433000 -- (-1151.568) (-1152.454) (-1150.997) [-1150.802] * (-1151.652) [-1155.582] (-1150.977) (-1151.063) -- 0:00:35
433500 -- (-1152.757) (-1152.409) (-1151.836) [-1150.104] * (-1153.470) (-1155.999) [-1154.683] (-1151.121) -- 0:00:35
434000 -- [-1152.270] (-1152.190) (-1151.291) (-1150.517) * (-1156.681) [-1153.040] (-1153.868) (-1151.342) -- 0:00:35
434500 -- (-1152.928) (-1151.880) [-1151.648] (-1150.570) * [-1153.721] (-1152.535) (-1151.305) (-1153.922) -- 0:00:35
435000 -- [-1152.844] (-1150.981) (-1151.279) (-1151.145) * (-1152.037) [-1150.840] (-1151.539) (-1150.256) -- 0:00:35
Average standard deviation of split frequencies: 0.013674
435500 -- (-1151.016) [-1152.648] (-1150.312) (-1154.918) * [-1151.466] (-1150.766) (-1157.397) (-1153.382) -- 0:00:34
436000 -- [-1158.830] (-1153.252) (-1151.914) (-1154.578) * (-1151.796) (-1153.401) [-1155.232] (-1153.495) -- 0:00:36
436500 -- (-1155.424) (-1152.073) [-1151.733] (-1150.894) * (-1153.624) [-1150.664] (-1154.011) (-1153.981) -- 0:00:36
437000 -- [-1155.648] (-1152.905) (-1154.345) (-1150.726) * (-1151.014) (-1150.991) (-1153.933) [-1151.770] -- 0:00:36
437500 -- (-1155.985) (-1159.843) [-1150.862] (-1150.831) * [-1152.685] (-1150.839) (-1151.725) (-1153.477) -- 0:00:36
438000 -- (-1150.689) (-1155.469) (-1151.416) [-1152.052] * [-1152.963] (-1151.055) (-1150.834) (-1150.884) -- 0:00:35
438500 -- (-1150.887) (-1153.249) [-1151.328] (-1151.794) * (-1153.450) (-1150.969) [-1151.174] (-1151.662) -- 0:00:35
439000 -- (-1151.878) (-1150.635) (-1154.376) [-1150.501] * [-1151.223] (-1150.248) (-1151.944) (-1151.512) -- 0:00:35
439500 -- (-1153.218) (-1150.809) [-1152.927] (-1151.467) * (-1153.393) [-1150.363] (-1150.513) (-1151.737) -- 0:00:35
440000 -- [-1150.675] (-1151.195) (-1150.206) (-1150.211) * [-1153.082] (-1150.757) (-1150.868) (-1152.645) -- 0:00:35
Average standard deviation of split frequencies: 0.013639
440500 -- (-1151.620) [-1154.300] (-1153.220) (-1152.200) * [-1151.115] (-1153.343) (-1151.637) (-1151.172) -- 0:00:35
441000 -- (-1151.598) (-1152.735) [-1150.223] (-1155.672) * [-1152.276] (-1152.574) (-1151.198) (-1152.220) -- 0:00:35
441500 -- (-1152.542) [-1150.203] (-1153.662) (-1153.992) * (-1155.048) (-1152.125) [-1151.025] (-1151.785) -- 0:00:35
442000 -- [-1150.871] (-1150.462) (-1153.104) (-1152.367) * (-1152.018) (-1152.852) (-1151.552) [-1150.555] -- 0:00:35
442500 -- (-1150.407) (-1152.112) (-1152.421) [-1153.734] * (-1154.618) [-1154.001] (-1150.507) (-1159.276) -- 0:00:35
443000 -- [-1150.628] (-1155.837) (-1149.946) (-1150.678) * (-1151.880) [-1152.105] (-1151.207) (-1156.163) -- 0:00:35
443500 -- [-1150.138] (-1155.638) (-1154.401) (-1152.567) * (-1149.992) (-1151.322) [-1150.278] (-1153.622) -- 0:00:35
444000 -- [-1152.475] (-1152.826) (-1151.407) (-1152.328) * [-1149.992] (-1157.390) (-1151.022) (-1154.401) -- 0:00:35
444500 -- (-1151.474) (-1152.354) (-1149.869) [-1151.463] * (-1149.858) (-1155.147) (-1151.785) [-1153.115] -- 0:00:34
445000 -- (-1150.922) (-1150.235) [-1151.105] (-1151.256) * (-1149.963) (-1158.791) (-1150.970) [-1153.201] -- 0:00:34
Average standard deviation of split frequencies: 0.013181
445500 -- [-1152.818] (-1151.578) (-1152.277) (-1159.119) * (-1150.989) [-1151.623] (-1151.361) (-1151.139) -- 0:00:34
446000 -- (-1152.119) (-1152.608) (-1151.238) [-1152.535] * (-1157.138) [-1150.883] (-1151.411) (-1150.467) -- 0:00:34
446500 -- (-1153.207) [-1154.412] (-1151.557) (-1155.935) * (-1150.660) (-1154.395) (-1152.072) [-1152.317] -- 0:00:34
447000 -- (-1157.115) [-1152.760] (-1152.602) (-1154.490) * (-1154.599) (-1151.299) (-1151.733) [-1153.633] -- 0:00:34
447500 -- [-1158.646] (-1150.403) (-1154.134) (-1151.210) * (-1153.355) (-1152.856) [-1151.925] (-1155.557) -- 0:00:34
448000 -- (-1150.966) (-1154.204) (-1152.490) [-1151.101] * [-1154.076] (-1154.016) (-1152.283) (-1155.842) -- 0:00:34
448500 -- [-1150.738] (-1152.807) (-1153.650) (-1154.244) * (-1154.116) (-1151.424) [-1151.311] (-1153.632) -- 0:00:34
449000 -- (-1153.153) (-1150.590) (-1152.288) [-1150.936] * [-1152.158] (-1152.052) (-1152.675) (-1153.740) -- 0:00:34
449500 -- [-1151.892] (-1152.032) (-1151.122) (-1150.233) * (-1152.393) [-1152.049] (-1151.820) (-1154.525) -- 0:00:34
450000 -- (-1153.188) [-1153.424] (-1150.216) (-1150.225) * (-1155.622) (-1152.810) (-1152.320) [-1153.545] -- 0:00:34
Average standard deviation of split frequencies: 0.013459
450500 -- (-1152.269) (-1150.166) [-1149.910] (-1152.116) * (-1152.393) (-1153.215) (-1151.202) [-1150.712] -- 0:00:34
451000 -- [-1152.136] (-1151.283) (-1151.639) (-1150.808) * (-1158.374) (-1153.201) [-1150.093] (-1150.200) -- 0:00:34
451500 -- (-1152.161) (-1150.605) [-1153.971] (-1151.346) * (-1151.147) [-1153.837] (-1151.097) (-1151.212) -- 0:00:34
452000 -- (-1153.060) [-1150.286] (-1152.044) (-1154.346) * (-1155.761) (-1153.809) (-1150.425) [-1151.939] -- 0:00:33
452500 -- (-1158.336) (-1151.330) [-1149.791] (-1156.823) * (-1154.105) (-1153.221) (-1149.971) [-1150.454] -- 0:00:35
453000 -- (-1151.607) [-1151.835] (-1151.314) (-1155.918) * (-1158.646) (-1151.422) [-1152.748] (-1150.468) -- 0:00:35
453500 -- (-1153.990) [-1151.305] (-1155.422) (-1152.490) * (-1150.573) [-1150.080] (-1153.961) (-1151.898) -- 0:00:34
454000 -- (-1153.564) [-1152.663] (-1155.668) (-1152.096) * (-1158.398) (-1150.694) [-1154.879] (-1151.766) -- 0:00:34
454500 -- (-1152.867) (-1154.480) [-1155.221] (-1155.764) * (-1151.662) (-1158.413) [-1151.948] (-1152.271) -- 0:00:34
455000 -- (-1154.664) (-1155.927) (-1154.624) [-1150.889] * (-1150.787) (-1152.590) (-1154.403) [-1152.832] -- 0:00:34
Average standard deviation of split frequencies: 0.013784
455500 -- (-1154.206) (-1154.718) [-1152.180] (-1154.874) * (-1150.830) [-1152.124] (-1152.446) (-1155.709) -- 0:00:34
456000 -- [-1151.445] (-1152.724) (-1153.128) (-1152.708) * (-1151.391) (-1150.792) [-1150.528] (-1151.563) -- 0:00:34
456500 -- (-1152.332) [-1153.504] (-1155.151) (-1150.748) * [-1151.198] (-1154.360) (-1155.212) (-1153.298) -- 0:00:34
457000 -- [-1151.415] (-1156.286) (-1151.103) (-1153.194) * [-1150.184] (-1152.402) (-1153.085) (-1152.377) -- 0:00:34
457500 -- [-1151.344] (-1151.949) (-1150.358) (-1151.090) * (-1151.351) (-1153.403) (-1151.464) [-1150.841] -- 0:00:34
458000 -- [-1152.472] (-1152.586) (-1152.733) (-1150.348) * (-1154.502) (-1151.751) (-1151.969) [-1150.597] -- 0:00:34
458500 -- (-1152.229) (-1152.936) (-1151.994) [-1152.574] * (-1153.982) (-1151.995) [-1151.849] (-1150.709) -- 0:00:34
459000 -- (-1151.113) [-1151.408] (-1151.956) (-1155.038) * (-1151.567) [-1150.730] (-1151.208) (-1155.803) -- 0:00:34
459500 -- [-1152.138] (-1151.469) (-1154.348) (-1155.133) * (-1150.207) (-1150.756) [-1150.260] (-1159.545) -- 0:00:34
460000 -- (-1153.129) (-1150.724) [-1151.520] (-1151.256) * (-1151.196) [-1152.566] (-1151.650) (-1150.978) -- 0:00:34
Average standard deviation of split frequencies: 0.013712
460500 -- (-1154.008) (-1150.363) (-1154.738) [-1150.438] * (-1156.321) (-1152.627) [-1152.269] (-1152.366) -- 0:00:33
461000 -- (-1151.586) [-1151.590] (-1152.604) (-1153.473) * (-1154.854) (-1150.816) [-1154.507] (-1153.168) -- 0:00:33
461500 -- (-1153.063) (-1150.256) (-1152.141) [-1151.800] * (-1153.837) (-1154.713) [-1151.080] (-1159.065) -- 0:00:33
462000 -- (-1151.395) (-1151.831) [-1150.186] (-1156.753) * (-1151.299) [-1154.045] (-1152.161) (-1150.980) -- 0:00:33
462500 -- (-1152.837) (-1150.503) (-1150.641) [-1150.470] * (-1150.580) [-1151.467] (-1151.671) (-1151.064) -- 0:00:33
463000 -- (-1152.794) (-1155.150) (-1151.936) [-1151.742] * (-1150.954) [-1158.659] (-1155.618) (-1151.103) -- 0:00:33
463500 -- (-1153.441) [-1149.998] (-1151.258) (-1159.328) * [-1150.846] (-1150.549) (-1154.093) (-1151.838) -- 0:00:33
464000 -- [-1151.743] (-1151.414) (-1151.351) (-1153.426) * (-1151.928) [-1150.494] (-1153.283) (-1150.428) -- 0:00:33
464500 -- (-1150.259) (-1158.144) [-1150.312] (-1152.718) * (-1152.125) (-1151.909) (-1151.930) [-1150.337] -- 0:00:33
465000 -- (-1150.623) (-1151.670) (-1151.286) [-1153.170] * (-1153.948) (-1150.242) (-1150.806) [-1151.913] -- 0:00:33
Average standard deviation of split frequencies: 0.014297
465500 -- (-1152.530) [-1154.785] (-1152.675) (-1151.733) * (-1153.521) (-1153.505) (-1151.606) [-1151.252] -- 0:00:33
466000 -- [-1151.960] (-1154.316) (-1152.993) (-1152.953) * (-1152.660) (-1153.831) (-1153.495) [-1153.235] -- 0:00:33
466500 -- [-1154.317] (-1152.551) (-1152.784) (-1150.920) * (-1152.772) (-1152.949) [-1155.157] (-1150.913) -- 0:00:33
467000 -- (-1151.536) (-1153.165) [-1152.347] (-1151.817) * (-1149.945) (-1151.871) [-1152.873] (-1153.402) -- 0:00:33
467500 -- (-1154.943) [-1150.942] (-1151.294) (-1153.040) * [-1151.004] (-1152.898) (-1159.399) (-1150.822) -- 0:00:33
468000 -- (-1151.089) (-1151.836) [-1151.338] (-1151.544) * (-1150.392) [-1153.014] (-1152.714) (-1151.324) -- 0:00:32
468500 -- (-1151.288) (-1152.085) [-1150.387] (-1152.651) * (-1153.115) (-1151.735) [-1153.254] (-1154.313) -- 0:00:34
469000 -- (-1155.039) (-1152.789) [-1150.140] (-1152.326) * (-1151.297) (-1153.596) [-1152.631] (-1152.328) -- 0:00:33
469500 -- [-1151.430] (-1152.065) (-1150.463) (-1154.998) * (-1154.552) (-1151.385) (-1150.264) [-1152.170] -- 0:00:33
470000 -- (-1150.227) (-1151.854) [-1151.837] (-1151.871) * (-1151.838) (-1152.198) [-1153.880] (-1153.515) -- 0:00:33
Average standard deviation of split frequencies: 0.013888
470500 -- (-1150.517) (-1152.019) [-1151.862] (-1155.184) * (-1153.339) (-1151.243) (-1154.701) [-1153.505] -- 0:00:33
471000 -- (-1150.302) [-1153.244] (-1153.064) (-1154.332) * [-1152.482] (-1151.959) (-1153.484) (-1158.036) -- 0:00:33
471500 -- (-1152.073) (-1159.942) [-1151.138] (-1155.666) * [-1152.391] (-1152.901) (-1153.955) (-1154.504) -- 0:00:33
472000 -- (-1153.434) (-1152.967) [-1153.505] (-1152.675) * (-1150.482) (-1151.834) (-1152.511) [-1156.819] -- 0:00:33
472500 -- (-1151.568) (-1152.806) [-1152.274] (-1153.989) * (-1150.551) (-1154.679) [-1154.548] (-1157.916) -- 0:00:33
473000 -- (-1154.714) [-1150.700] (-1152.189) (-1150.454) * [-1150.595] (-1151.742) (-1151.076) (-1155.275) -- 0:00:33
473500 -- (-1151.280) (-1150.259) (-1152.276) [-1150.414] * [-1150.651] (-1151.818) (-1154.381) (-1154.298) -- 0:00:33
474000 -- (-1152.070) [-1150.483] (-1151.716) (-1151.958) * [-1151.048] (-1154.610) (-1153.382) (-1150.051) -- 0:00:33
474500 -- [-1151.724] (-1150.282) (-1155.399) (-1152.102) * (-1150.038) [-1152.816] (-1150.944) (-1151.721) -- 0:00:33
475000 -- [-1151.659] (-1150.958) (-1156.275) (-1151.959) * [-1150.214] (-1158.420) (-1150.774) (-1151.228) -- 0:00:33
Average standard deviation of split frequencies: 0.014393
475500 -- [-1150.364] (-1150.825) (-1153.287) (-1151.396) * (-1152.053) [-1152.900] (-1151.662) (-1150.829) -- 0:00:33
476000 -- (-1153.582) [-1151.122] (-1152.675) (-1151.779) * [-1152.871] (-1152.137) (-1150.785) (-1150.826) -- 0:00:33
476500 -- (-1152.716) (-1154.977) (-1156.525) [-1150.577] * (-1150.287) (-1153.009) [-1151.025] (-1150.182) -- 0:00:32
477000 -- (-1156.468) [-1151.613] (-1150.932) (-1153.063) * (-1151.045) (-1158.170) (-1150.739) [-1151.633] -- 0:00:32
477500 -- (-1151.734) [-1150.124] (-1155.509) (-1152.260) * (-1153.155) (-1151.120) (-1150.775) [-1152.145] -- 0:00:32
478000 -- (-1151.331) (-1153.457) (-1157.309) [-1154.362] * (-1154.545) (-1153.750) [-1152.404] (-1152.442) -- 0:00:32
478500 -- (-1152.017) [-1151.633] (-1153.000) (-1152.373) * (-1150.781) (-1154.379) [-1153.283] (-1155.868) -- 0:00:32
479000 -- (-1152.548) (-1153.715) [-1150.357] (-1152.616) * (-1150.270) (-1154.843) (-1150.964) [-1151.095] -- 0:00:32
479500 -- [-1151.013] (-1156.378) (-1150.355) (-1153.024) * (-1149.742) [-1151.007] (-1152.498) (-1151.300) -- 0:00:32
480000 -- [-1151.987] (-1154.777) (-1151.184) (-1152.693) * (-1151.363) [-1152.060] (-1152.316) (-1151.398) -- 0:00:32
Average standard deviation of split frequencies: 0.014580
480500 -- (-1150.680) (-1154.672) (-1152.303) [-1150.434] * (-1151.242) (-1150.910) [-1150.841] (-1152.296) -- 0:00:32
481000 -- [-1150.942] (-1152.797) (-1150.970) (-1151.370) * (-1151.070) [-1152.645] (-1151.105) (-1152.421) -- 0:00:32
481500 -- [-1150.479] (-1150.915) (-1151.844) (-1153.052) * (-1152.514) (-1155.079) (-1150.697) [-1154.646] -- 0:00:32
482000 -- (-1154.482) [-1150.852] (-1151.767) (-1153.555) * [-1150.492] (-1152.560) (-1150.356) (-1154.520) -- 0:00:32
482500 -- (-1150.534) (-1152.741) (-1151.201) [-1153.513] * (-1150.431) (-1152.426) [-1151.114] (-1152.691) -- 0:00:32
483000 -- [-1151.760] (-1156.488) (-1156.552) (-1150.928) * (-1150.635) (-1152.629) [-1151.127] (-1150.714) -- 0:00:32
483500 -- (-1151.192) (-1152.734) [-1153.501] (-1150.617) * (-1150.969) (-1151.242) (-1151.958) [-1150.738] -- 0:00:32
484000 -- [-1152.351] (-1152.376) (-1152.540) (-1151.434) * (-1155.091) (-1151.913) (-1157.374) [-1150.973] -- 0:00:31
484500 -- (-1153.072) (-1151.180) [-1152.792] (-1153.012) * (-1152.969) (-1152.686) (-1155.093) [-1150.132] -- 0:00:31
485000 -- (-1151.076) (-1151.704) [-1151.095] (-1152.475) * [-1154.125] (-1151.702) (-1150.829) (-1153.058) -- 0:00:32
Average standard deviation of split frequencies: 0.013398
485500 -- (-1151.639) (-1151.786) [-1150.934] (-1151.691) * (-1153.536) (-1151.978) (-1150.973) [-1153.624] -- 0:00:32
486000 -- (-1155.242) (-1150.751) [-1157.811] (-1152.450) * (-1154.534) (-1153.038) (-1154.151) [-1151.959] -- 0:00:32
486500 -- (-1153.570) (-1150.931) [-1150.815] (-1152.318) * [-1152.007] (-1157.420) (-1150.011) (-1150.954) -- 0:00:32
487000 -- (-1153.300) [-1151.447] (-1152.821) (-1150.856) * (-1150.770) [-1151.454] (-1151.054) (-1152.718) -- 0:00:32
487500 -- (-1151.673) [-1150.956] (-1152.492) (-1151.848) * (-1152.929) (-1150.283) (-1153.418) [-1152.166] -- 0:00:32
488000 -- (-1153.110) [-1151.342] (-1153.673) (-1152.606) * (-1151.041) (-1153.517) (-1153.859) [-1152.370] -- 0:00:32
488500 -- (-1152.373) [-1153.084] (-1153.397) (-1154.118) * (-1151.209) (-1150.598) [-1151.450] (-1152.524) -- 0:00:32
489000 -- (-1151.570) (-1152.758) (-1153.588) [-1151.053] * (-1152.035) (-1153.106) [-1151.917] (-1153.131) -- 0:00:32
489500 -- [-1151.723] (-1153.763) (-1153.666) (-1151.952) * (-1155.045) (-1152.001) (-1154.657) [-1153.289] -- 0:00:32
490000 -- (-1151.271) (-1154.470) [-1151.534] (-1151.829) * (-1152.695) (-1152.613) (-1151.089) [-1152.349] -- 0:00:32
Average standard deviation of split frequencies: 0.013510
490500 -- (-1150.324) (-1154.092) (-1150.619) [-1150.929] * (-1153.670) (-1151.802) (-1151.922) [-1152.482] -- 0:00:32
491000 -- (-1151.753) [-1151.828] (-1152.214) (-1151.330) * (-1151.359) [-1153.264] (-1152.186) (-1152.326) -- 0:00:32
491500 -- (-1150.744) (-1152.949) (-1155.966) [-1151.096] * (-1150.266) (-1150.208) [-1152.603] (-1153.294) -- 0:00:32
492000 -- [-1150.444] (-1149.753) (-1151.076) (-1154.468) * [-1151.587] (-1152.926) (-1150.904) (-1153.310) -- 0:00:32
492500 -- (-1153.678) (-1150.040) [-1154.279] (-1151.397) * (-1152.085) [-1151.468] (-1151.650) (-1151.600) -- 0:00:31
493000 -- [-1153.772] (-1152.157) (-1151.485) (-1150.612) * [-1150.769] (-1152.367) (-1150.760) (-1153.600) -- 0:00:31
493500 -- [-1152.312] (-1151.027) (-1152.827) (-1150.974) * (-1157.207) (-1156.029) [-1152.504] (-1159.603) -- 0:00:31
494000 -- (-1150.299) [-1150.282] (-1152.546) (-1151.559) * (-1150.998) (-1157.218) (-1152.658) [-1154.131] -- 0:00:31
494500 -- (-1151.792) (-1151.190) (-1154.726) [-1150.730] * [-1150.209] (-1151.560) (-1152.825) (-1153.701) -- 0:00:31
495000 -- (-1150.772) [-1150.200] (-1152.895) (-1151.083) * (-1151.713) (-1152.222) (-1152.871) [-1151.374] -- 0:00:31
Average standard deviation of split frequencies: 0.013068
495500 -- (-1150.854) (-1151.020) (-1151.314) [-1152.574] * (-1151.408) [-1152.628] (-1155.575) (-1151.876) -- 0:00:31
496000 -- [-1152.765] (-1150.380) (-1150.433) (-1155.853) * (-1153.143) (-1149.898) (-1152.762) [-1152.996] -- 0:00:31
496500 -- (-1150.856) (-1150.203) [-1150.835] (-1151.867) * [-1151.791] (-1151.112) (-1157.059) (-1152.286) -- 0:00:31
497000 -- [-1151.820] (-1151.257) (-1153.552) (-1152.912) * (-1151.754) [-1152.115] (-1155.694) (-1151.032) -- 0:00:31
497500 -- (-1154.244) (-1154.545) [-1153.054] (-1153.731) * [-1153.249] (-1154.542) (-1153.626) (-1150.654) -- 0:00:31
498000 -- (-1154.589) [-1151.388] (-1151.349) (-1154.882) * [-1151.981] (-1155.806) (-1155.586) (-1151.228) -- 0:00:31
498500 -- (-1151.272) (-1151.892) (-1154.156) [-1152.456] * (-1156.192) (-1158.130) (-1152.634) [-1152.805] -- 0:00:31
499000 -- (-1150.645) (-1153.643) [-1151.627] (-1150.761) * (-1153.477) (-1151.722) [-1151.232] (-1151.346) -- 0:00:31
499500 -- (-1150.791) (-1151.419) (-1152.440) [-1150.031] * [-1151.536] (-1151.980) (-1153.755) (-1151.571) -- 0:00:31
500000 -- (-1152.605) (-1153.224) [-1151.645] (-1150.574) * (-1150.205) (-1153.547) [-1151.804] (-1151.222) -- 0:00:31
Average standard deviation of split frequencies: 0.012652
500500 -- (-1154.366) [-1150.877] (-1153.939) (-1151.639) * (-1150.878) (-1154.469) (-1153.651) [-1152.168] -- 0:00:30
501000 -- [-1152.910] (-1151.378) (-1157.385) (-1150.889) * (-1152.986) (-1153.305) (-1152.408) [-1153.980] -- 0:00:30
501500 -- (-1151.444) (-1152.305) [-1155.543] (-1150.542) * [-1153.090] (-1152.822) (-1153.569) (-1150.208) -- 0:00:31
502000 -- (-1152.571) (-1156.869) [-1151.658] (-1150.443) * [-1153.524] (-1156.779) (-1150.128) (-1150.381) -- 0:00:31
502500 -- (-1150.097) (-1154.346) [-1153.325] (-1152.154) * (-1154.814) (-1152.218) (-1152.990) [-1149.951] -- 0:00:31
503000 -- (-1150.552) (-1153.087) [-1155.339] (-1155.229) * (-1151.800) (-1157.079) (-1151.320) [-1151.252] -- 0:00:31
503500 -- (-1152.532) (-1151.282) [-1155.344] (-1153.706) * (-1152.759) (-1152.040) (-1150.753) [-1155.166] -- 0:00:31
504000 -- (-1150.905) (-1153.178) (-1156.222) [-1153.835] * [-1152.432] (-1150.180) (-1150.678) (-1152.788) -- 0:00:31
504500 -- (-1151.540) (-1149.894) [-1150.474] (-1153.624) * (-1153.762) (-1153.054) (-1150.965) [-1151.473] -- 0:00:31
505000 -- (-1151.920) (-1155.107) [-1150.424] (-1151.248) * (-1153.239) (-1152.757) (-1149.662) [-1151.215] -- 0:00:31
Average standard deviation of split frequencies: 0.012985
505500 -- (-1153.725) (-1150.616) [-1150.693] (-1160.307) * (-1152.702) (-1151.374) [-1150.921] (-1152.418) -- 0:00:31
506000 -- (-1153.536) (-1151.063) [-1152.576] (-1153.350) * (-1152.942) (-1153.540) [-1151.791] (-1150.640) -- 0:00:31
506500 -- (-1150.939) (-1151.206) (-1153.951) [-1153.471] * (-1152.240) (-1151.293) (-1152.469) [-1151.544] -- 0:00:31
507000 -- (-1151.220) (-1151.049) [-1154.429] (-1151.007) * (-1153.722) [-1151.695] (-1152.667) (-1154.480) -- 0:00:31
507500 -- [-1154.914] (-1154.133) (-1156.980) (-1152.118) * (-1151.599) (-1154.845) [-1152.441] (-1151.992) -- 0:00:31
508000 -- (-1153.515) (-1151.592) [-1157.021] (-1153.381) * (-1151.187) (-1153.054) (-1155.547) [-1151.987] -- 0:00:30
508500 -- (-1152.372) (-1150.991) [-1152.511] (-1152.268) * (-1152.468) [-1152.299] (-1156.010) (-1151.970) -- 0:00:30
509000 -- [-1150.982] (-1153.181) (-1152.659) (-1151.508) * (-1154.868) (-1154.368) [-1151.592] (-1151.630) -- 0:00:30
509500 -- (-1152.709) (-1152.114) [-1150.330] (-1150.446) * (-1153.862) [-1152.178] (-1155.324) (-1150.765) -- 0:00:30
510000 -- (-1153.351) [-1150.079] (-1152.504) (-1152.081) * (-1153.002) (-1151.078) (-1151.321) [-1150.328] -- 0:00:30
Average standard deviation of split frequencies: 0.012866
510500 -- (-1151.814) [-1150.298] (-1150.713) (-1154.084) * (-1153.593) (-1150.207) [-1156.395] (-1151.672) -- 0:00:30
511000 -- [-1151.183] (-1152.909) (-1150.485) (-1151.914) * (-1153.964) (-1150.659) (-1150.860) [-1150.394] -- 0:00:30
511500 -- (-1151.314) (-1159.379) (-1152.102) [-1151.469] * (-1150.136) [-1155.885] (-1151.275) (-1152.637) -- 0:00:30
512000 -- (-1154.352) [-1154.188] (-1151.644) (-1149.981) * (-1158.305) (-1151.467) [-1151.103] (-1151.773) -- 0:00:30
512500 -- (-1150.944) [-1151.999] (-1151.451) (-1151.322) * (-1153.814) (-1154.217) (-1152.426) [-1151.773] -- 0:00:30
513000 -- (-1153.955) (-1152.585) (-1152.759) [-1151.010] * (-1151.693) [-1153.421] (-1156.439) (-1154.762) -- 0:00:30
513500 -- [-1151.441] (-1151.625) (-1153.772) (-1152.036) * (-1153.779) (-1154.352) (-1158.049) [-1153.977] -- 0:00:30
514000 -- (-1150.715) (-1151.113) (-1153.507) [-1151.489] * (-1152.497) (-1152.963) [-1150.986] (-1151.467) -- 0:00:30
514500 -- [-1150.368] (-1152.086) (-1151.404) (-1152.579) * (-1153.276) [-1153.009] (-1151.006) (-1153.858) -- 0:00:30
515000 -- (-1151.755) [-1152.083] (-1151.977) (-1154.838) * (-1157.234) (-1151.523) (-1151.510) [-1152.386] -- 0:00:30
Average standard deviation of split frequencies: 0.012790
515500 -- [-1153.798] (-1155.851) (-1153.629) (-1155.834) * (-1155.746) (-1151.619) (-1152.771) [-1153.304] -- 0:00:30
516000 -- (-1151.889) (-1151.603) (-1151.521) [-1154.306] * (-1153.233) (-1150.573) [-1151.888] (-1152.456) -- 0:00:30
516500 -- (-1150.808) [-1150.489] (-1153.678) (-1152.810) * (-1153.455) [-1152.695] (-1154.995) (-1151.148) -- 0:00:29
517000 -- [-1151.901] (-1151.459) (-1150.814) (-1151.801) * (-1151.068) [-1152.751] (-1151.979) (-1150.705) -- 0:00:29
517500 -- (-1154.906) (-1151.195) [-1151.782] (-1152.165) * [-1152.315] (-1151.501) (-1151.122) (-1151.437) -- 0:00:30
518000 -- (-1158.478) (-1150.437) (-1152.856) [-1153.533] * (-1151.243) (-1153.927) (-1151.111) [-1153.876] -- 0:00:30
518500 -- (-1154.661) [-1152.908] (-1155.680) (-1150.125) * (-1154.016) (-1150.212) [-1153.302] (-1153.775) -- 0:00:30
519000 -- (-1149.874) (-1154.665) (-1151.250) [-1150.761] * (-1151.405) [-1150.115] (-1150.648) (-1150.748) -- 0:00:30
519500 -- (-1151.158) [-1150.706] (-1150.775) (-1150.867) * (-1151.682) [-1152.436] (-1150.219) (-1151.477) -- 0:00:30
520000 -- [-1150.160] (-1150.611) (-1150.688) (-1150.890) * [-1154.983] (-1152.591) (-1151.916) (-1150.773) -- 0:00:30
Average standard deviation of split frequencies: 0.011996
520500 -- (-1151.533) (-1151.825) (-1155.130) [-1150.349] * (-1150.910) (-1153.760) (-1153.387) [-1151.334] -- 0:00:30
521000 -- (-1153.126) (-1152.167) [-1153.627] (-1151.120) * (-1153.980) (-1150.482) [-1152.110] (-1150.918) -- 0:00:30
521500 -- (-1155.869) (-1151.943) (-1154.311) [-1151.857] * (-1151.489) [-1152.593] (-1150.182) (-1152.501) -- 0:00:30
522000 -- (-1151.890) (-1152.700) [-1152.561] (-1153.923) * (-1150.838) [-1152.374] (-1153.734) (-1153.207) -- 0:00:30
522500 -- (-1150.443) (-1150.606) (-1151.564) [-1152.085] * [-1151.794] (-1151.184) (-1152.237) (-1150.886) -- 0:00:30
523000 -- [-1151.967] (-1151.501) (-1151.989) (-1151.914) * [-1152.232] (-1151.603) (-1152.975) (-1150.332) -- 0:00:30
523500 -- (-1154.187) [-1152.981] (-1153.232) (-1150.969) * (-1152.085) (-1150.873) (-1151.294) [-1150.103] -- 0:00:30
524000 -- (-1153.710) (-1152.195) [-1151.610] (-1155.013) * (-1150.669) (-1151.763) [-1150.548] (-1150.210) -- 0:00:29
524500 -- (-1153.908) (-1150.855) (-1151.253) [-1158.946] * (-1151.415) (-1155.302) [-1150.941] (-1153.242) -- 0:00:29
525000 -- (-1154.238) (-1152.053) (-1156.470) [-1152.842] * (-1150.761) (-1150.513) (-1152.974) [-1152.497] -- 0:00:29
Average standard deviation of split frequencies: 0.012547
525500 -- (-1150.848) [-1151.244] (-1153.904) (-1151.980) * (-1151.445) (-1150.830) (-1155.521) [-1151.230] -- 0:00:29
526000 -- (-1152.650) (-1151.175) (-1151.843) [-1155.585] * (-1150.542) [-1150.747] (-1153.387) (-1151.830) -- 0:00:29
526500 -- [-1151.067] (-1153.802) (-1152.216) (-1153.481) * [-1152.038] (-1153.461) (-1155.031) (-1151.857) -- 0:00:29
527000 -- (-1151.204) [-1152.166] (-1151.395) (-1154.515) * (-1153.433) [-1158.530] (-1155.950) (-1151.586) -- 0:00:29
527500 -- (-1152.851) (-1150.373) [-1152.218] (-1157.556) * (-1152.940) (-1153.974) [-1151.322] (-1155.901) -- 0:00:29
528000 -- (-1150.591) [-1153.216] (-1157.007) (-1150.232) * (-1151.691) (-1151.439) [-1154.940] (-1154.199) -- 0:00:29
528500 -- (-1150.591) (-1155.780) (-1151.835) [-1154.294] * (-1151.811) [-1151.487] (-1153.248) (-1151.372) -- 0:00:29
529000 -- [-1151.548] (-1152.105) (-1155.649) (-1154.899) * (-1154.121) (-1152.082) [-1152.235] (-1153.015) -- 0:00:29
529500 -- (-1151.268) [-1153.913] (-1150.474) (-1153.552) * (-1152.573) [-1150.228] (-1153.903) (-1156.475) -- 0:00:29
530000 -- (-1152.902) (-1154.588) (-1156.533) [-1152.549] * (-1150.046) (-1151.316) (-1151.509) [-1153.113] -- 0:00:29
Average standard deviation of split frequencies: 0.011715
530500 -- [-1152.699] (-1152.716) (-1150.912) (-1152.011) * (-1151.104) (-1152.648) [-1149.969] (-1156.659) -- 0:00:29
531000 -- (-1151.709) (-1153.047) [-1151.994] (-1151.594) * (-1153.572) [-1152.532] (-1150.648) (-1150.368) -- 0:00:29
531500 -- (-1159.656) (-1150.731) [-1151.956] (-1151.039) * (-1150.572) (-1151.528) (-1153.972) [-1155.639] -- 0:00:29
532000 -- [-1156.548] (-1150.462) (-1151.816) (-1150.904) * (-1153.119) (-1151.780) [-1150.119] (-1157.481) -- 0:00:29
532500 -- (-1153.748) [-1150.943] (-1152.973) (-1152.927) * (-1150.634) [-1149.917] (-1152.495) (-1152.898) -- 0:00:28
533000 -- (-1155.535) [-1151.623] (-1151.183) (-1152.011) * (-1154.109) (-1150.912) [-1156.583] (-1152.737) -- 0:00:28
533500 -- (-1156.768) (-1151.864) [-1151.899] (-1152.472) * (-1153.716) [-1150.278] (-1152.462) (-1151.026) -- 0:00:28
534000 -- (-1152.296) [-1151.494] (-1156.815) (-1151.910) * (-1152.408) (-1151.822) [-1155.067] (-1152.152) -- 0:00:29
534500 -- (-1154.640) [-1151.941] (-1150.525) (-1151.919) * (-1151.828) (-1151.555) [-1155.059] (-1150.184) -- 0:00:29
535000 -- (-1150.842) [-1152.676] (-1151.323) (-1150.925) * (-1153.723) (-1154.996) [-1151.124] (-1152.088) -- 0:00:29
Average standard deviation of split frequencies: 0.012313
535500 -- (-1150.719) (-1153.260) [-1151.914] (-1150.224) * (-1153.186) [-1152.353] (-1153.417) (-1152.566) -- 0:00:29
536000 -- [-1150.259] (-1151.987) (-1151.773) (-1151.085) * (-1153.870) [-1150.284] (-1151.345) (-1152.173) -- 0:00:29
536500 -- (-1150.967) (-1152.061) (-1151.409) [-1155.957] * (-1152.744) (-1150.284) (-1151.294) [-1156.448] -- 0:00:29
537000 -- (-1152.458) (-1150.999) [-1151.060] (-1153.741) * [-1153.963] (-1156.126) (-1152.359) (-1155.908) -- 0:00:29
537500 -- (-1150.544) (-1150.193) (-1153.150) [-1151.021] * (-1152.786) (-1150.597) (-1150.444) [-1153.238] -- 0:00:29
538000 -- (-1150.364) (-1150.432) (-1153.914) [-1151.185] * (-1152.690) (-1151.099) (-1151.197) [-1152.203] -- 0:00:29
538500 -- (-1150.242) [-1153.403] (-1150.441) (-1150.946) * (-1152.034) (-1154.148) (-1152.603) [-1151.639] -- 0:00:29
539000 -- [-1151.981] (-1155.743) (-1150.520) (-1151.770) * (-1151.254) (-1154.051) (-1150.480) [-1154.245] -- 0:00:29
539500 -- (-1153.590) [-1152.657] (-1153.755) (-1155.718) * (-1152.011) (-1151.980) (-1150.649) [-1151.214] -- 0:00:29
540000 -- (-1151.642) (-1153.742) [-1155.863] (-1151.118) * (-1153.839) (-1153.157) (-1153.576) [-1154.197] -- 0:00:28
Average standard deviation of split frequencies: 0.012207
540500 -- (-1151.847) (-1151.344) (-1159.537) [-1151.253] * (-1154.245) (-1156.108) (-1156.814) [-1151.706] -- 0:00:28
541000 -- [-1151.244] (-1151.511) (-1153.962) (-1151.252) * (-1152.870) (-1154.108) [-1150.997] (-1151.204) -- 0:00:28
541500 -- (-1150.608) [-1151.040] (-1150.164) (-1150.830) * (-1156.583) (-1150.916) (-1152.605) [-1151.804] -- 0:00:28
542000 -- [-1150.977] (-1152.887) (-1152.976) (-1155.107) * (-1154.698) [-1151.785] (-1159.099) (-1158.850) -- 0:00:28
542500 -- [-1151.402] (-1153.547) (-1151.859) (-1155.628) * [-1152.639] (-1152.043) (-1152.770) (-1149.986) -- 0:00:28
543000 -- (-1152.036) (-1153.193) [-1153.332] (-1153.724) * [-1152.091] (-1151.747) (-1156.916) (-1151.448) -- 0:00:28
543500 -- (-1152.344) (-1154.601) (-1155.992) [-1150.683] * (-1152.799) [-1151.463] (-1154.288) (-1151.854) -- 0:00:28
544000 -- (-1152.651) (-1153.053) (-1152.201) [-1149.731] * (-1152.169) (-1151.852) (-1152.530) [-1153.241] -- 0:00:28
544500 -- [-1152.622] (-1155.185) (-1156.839) (-1149.814) * (-1154.717) (-1153.173) [-1151.702] (-1151.136) -- 0:00:28
545000 -- [-1151.164] (-1152.757) (-1153.134) (-1150.040) * (-1151.598) (-1153.049) [-1149.876] (-1152.914) -- 0:00:28
Average standard deviation of split frequencies: 0.011764
545500 -- [-1150.931] (-1152.168) (-1151.732) (-1155.008) * (-1153.593) (-1150.545) [-1149.833] (-1150.131) -- 0:00:28
546000 -- (-1150.743) [-1152.110] (-1151.026) (-1152.218) * (-1155.449) (-1150.868) (-1151.222) [-1151.281] -- 0:00:28
546500 -- [-1151.958] (-1150.607) (-1152.124) (-1152.011) * (-1152.019) [-1150.901] (-1152.807) (-1151.336) -- 0:00:28
547000 -- (-1151.437) [-1150.186] (-1152.308) (-1153.525) * (-1150.668) (-1152.003) [-1153.281] (-1151.348) -- 0:00:28
547500 -- (-1152.562) (-1152.803) (-1156.034) [-1152.979] * (-1154.537) (-1152.049) (-1155.225) [-1151.865] -- 0:00:28
548000 -- (-1152.531) (-1152.189) (-1152.759) [-1156.696] * (-1155.333) (-1150.728) [-1153.856] (-1157.279) -- 0:00:28
548500 -- (-1151.167) (-1151.943) (-1152.678) [-1152.440] * (-1152.318) (-1150.787) (-1151.405) [-1154.059] -- 0:00:27
549000 -- (-1153.199) [-1151.672] (-1150.908) (-1152.422) * (-1153.717) [-1151.323] (-1152.398) (-1153.347) -- 0:00:27
549500 -- (-1152.385) (-1154.107) [-1151.620] (-1154.442) * [-1152.199] (-1151.557) (-1153.182) (-1151.065) -- 0:00:27
550000 -- (-1151.916) [-1152.973] (-1152.569) (-1151.163) * (-1155.261) (-1151.684) [-1154.143] (-1151.107) -- 0:00:27
Average standard deviation of split frequencies: 0.011450
550500 -- (-1151.766) (-1153.889) (-1151.333) [-1151.250] * [-1154.143] (-1150.433) (-1150.839) (-1153.028) -- 0:00:28
551000 -- (-1155.227) (-1151.974) [-1153.503] (-1154.249) * (-1154.684) (-1151.273) [-1152.176] (-1150.623) -- 0:00:28
551500 -- [-1150.465] (-1155.209) (-1153.639) (-1150.948) * (-1160.691) (-1150.853) [-1151.541] (-1150.287) -- 0:00:28
552000 -- (-1151.146) [-1151.549] (-1155.053) (-1153.656) * (-1161.365) (-1153.850) (-1151.342) [-1153.886] -- 0:00:28
552500 -- [-1154.919] (-1152.722) (-1152.582) (-1153.460) * [-1151.603] (-1152.929) (-1152.913) (-1153.286) -- 0:00:28
553000 -- (-1155.465) (-1150.403) (-1150.855) [-1156.214] * [-1151.676] (-1151.722) (-1152.715) (-1154.534) -- 0:00:28
553500 -- (-1154.736) [-1150.449] (-1150.544) (-1155.789) * (-1152.405) (-1151.306) [-1153.628] (-1154.627) -- 0:00:28
554000 -- [-1152.657] (-1151.259) (-1151.774) (-1151.086) * (-1153.679) (-1151.441) [-1152.641] (-1150.749) -- 0:00:28
554500 -- (-1152.446) (-1151.064) (-1151.367) [-1151.310] * (-1155.869) (-1154.493) [-1151.907] (-1150.228) -- 0:00:28
555000 -- (-1152.592) [-1151.324] (-1151.740) (-1152.781) * (-1155.430) (-1152.652) (-1152.377) [-1150.244] -- 0:00:28
Average standard deviation of split frequencies: 0.011075
555500 -- (-1152.320) [-1151.191] (-1154.600) (-1155.118) * [-1152.635] (-1150.617) (-1150.552) (-1150.386) -- 0:00:28
556000 -- (-1155.482) (-1153.305) (-1153.017) [-1149.829] * (-1154.256) [-1151.071] (-1152.903) (-1150.494) -- 0:00:27
556500 -- (-1151.370) (-1157.307) [-1152.292] (-1155.742) * (-1150.863) [-1153.045] (-1150.143) (-1152.757) -- 0:00:27
557000 -- (-1150.716) (-1150.566) (-1150.772) [-1151.376] * (-1151.617) [-1156.498] (-1150.189) (-1152.249) -- 0:00:27
557500 -- (-1151.374) [-1152.392] (-1150.074) (-1151.484) * (-1152.271) (-1154.771) (-1150.140) [-1152.676] -- 0:00:27
558000 -- [-1151.535] (-1152.113) (-1150.014) (-1152.438) * [-1150.357] (-1150.995) (-1152.295) (-1157.005) -- 0:00:27
558500 -- (-1151.541) (-1151.941) (-1152.240) [-1152.993] * (-1155.372) (-1151.009) [-1152.392] (-1152.240) -- 0:00:27
559000 -- (-1152.826) (-1152.816) [-1151.421] (-1152.065) * (-1151.554) (-1152.805) [-1151.279] (-1153.750) -- 0:00:27
559500 -- (-1151.278) [-1153.475] (-1154.475) (-1152.229) * (-1152.946) (-1153.830) [-1153.189] (-1153.984) -- 0:00:27
560000 -- [-1152.991] (-1150.735) (-1153.889) (-1152.424) * (-1151.643) [-1152.173] (-1158.484) (-1152.436) -- 0:00:27
Average standard deviation of split frequencies: 0.010930
560500 -- (-1152.550) (-1152.337) [-1152.306] (-1152.063) * [-1153.245] (-1151.794) (-1153.946) (-1151.894) -- 0:00:27
561000 -- (-1151.407) (-1151.947) [-1153.968] (-1155.750) * (-1151.328) (-1154.143) (-1151.590) [-1151.739] -- 0:00:27
561500 -- (-1151.494) [-1152.132] (-1152.533) (-1156.429) * (-1153.008) [-1149.999] (-1151.955) (-1152.009) -- 0:00:27
562000 -- [-1152.191] (-1151.676) (-1152.571) (-1155.532) * (-1150.191) (-1150.791) [-1150.767] (-1151.106) -- 0:00:27
562500 -- [-1151.062] (-1151.744) (-1154.113) (-1150.687) * (-1150.898) (-1153.271) (-1150.530) [-1154.935] -- 0:00:27
563000 -- (-1152.501) [-1151.447] (-1153.590) (-1150.227) * [-1151.795] (-1154.937) (-1151.891) (-1151.897) -- 0:00:27
563500 -- (-1152.659) (-1151.653) (-1150.091) [-1150.187] * [-1152.578] (-1151.386) (-1150.368) (-1152.789) -- 0:00:27
564000 -- (-1149.948) (-1150.509) [-1152.833] (-1151.033) * [-1152.120] (-1151.059) (-1150.441) (-1153.014) -- 0:00:27
564500 -- (-1154.628) [-1150.434] (-1153.241) (-1151.569) * (-1151.034) (-1150.588) (-1152.773) [-1151.371] -- 0:00:27
565000 -- (-1153.657) [-1150.262] (-1150.544) (-1150.507) * [-1152.183] (-1151.574) (-1151.719) (-1150.726) -- 0:00:26
Average standard deviation of split frequencies: 0.011504
565500 -- (-1151.526) (-1154.946) (-1152.224) [-1155.598] * [-1151.672] (-1150.016) (-1154.227) (-1153.107) -- 0:00:26
566000 -- (-1152.093) (-1153.755) (-1151.615) [-1152.797] * (-1155.392) (-1154.941) [-1151.157] (-1152.617) -- 0:00:26
566500 -- [-1150.683] (-1153.310) (-1151.345) (-1154.220) * (-1152.791) [-1150.807] (-1152.274) (-1154.715) -- 0:00:26
567000 -- (-1152.218) [-1151.171] (-1155.673) (-1150.820) * (-1154.161) [-1150.647] (-1150.776) (-1153.327) -- 0:00:27
567500 -- (-1151.361) (-1151.188) [-1151.415] (-1152.448) * [-1152.417] (-1157.326) (-1154.963) (-1155.549) -- 0:00:27
568000 -- [-1152.666] (-1151.890) (-1150.970) (-1152.332) * [-1153.147] (-1152.953) (-1154.108) (-1154.515) -- 0:00:27
568500 -- (-1153.790) (-1153.981) (-1151.716) [-1150.349] * (-1153.017) (-1150.149) [-1150.721] (-1151.171) -- 0:00:27
569000 -- (-1153.471) (-1151.125) (-1158.628) [-1150.255] * [-1152.211] (-1151.895) (-1153.741) (-1152.308) -- 0:00:27
569500 -- (-1150.914) [-1151.662] (-1160.312) (-1153.078) * (-1150.597) [-1153.374] (-1153.609) (-1150.371) -- 0:00:27
570000 -- (-1151.470) (-1152.124) [-1151.233] (-1151.896) * (-1151.710) (-1153.478) (-1152.560) [-1150.803] -- 0:00:27
Average standard deviation of split frequencies: 0.011307
570500 -- (-1153.084) (-1153.444) (-1150.190) [-1154.134] * (-1150.516) (-1152.066) (-1150.415) [-1151.768] -- 0:00:27
571000 -- [-1152.112] (-1151.687) (-1151.522) (-1150.740) * (-1150.364) [-1153.141] (-1150.779) (-1152.030) -- 0:00:27
571500 -- (-1155.732) (-1152.598) (-1155.099) [-1151.797] * (-1150.275) (-1153.077) [-1151.923] (-1152.345) -- 0:00:26
572000 -- (-1151.624) (-1152.426) (-1151.070) [-1151.399] * [-1154.494] (-1151.838) (-1153.484) (-1152.051) -- 0:00:26
572500 -- (-1150.194) [-1151.596] (-1151.084) (-1153.580) * (-1151.345) [-1152.206] (-1154.633) (-1151.925) -- 0:00:26
573000 -- (-1153.357) (-1152.290) [-1152.611] (-1151.367) * (-1151.462) [-1153.075] (-1151.501) (-1151.293) -- 0:00:26
573500 -- (-1150.417) (-1152.368) [-1150.486] (-1153.166) * (-1151.782) (-1153.198) (-1153.074) [-1151.745] -- 0:00:26
574000 -- (-1152.550) (-1153.596) (-1153.920) [-1150.860] * (-1153.056) [-1153.145] (-1151.780) (-1150.639) -- 0:00:26
574500 -- (-1153.835) (-1154.245) [-1150.827] (-1151.161) * (-1151.907) (-1154.023) [-1153.532] (-1154.496) -- 0:00:26
575000 -- [-1156.102] (-1151.924) (-1152.918) (-1150.903) * (-1150.609) [-1153.787] (-1153.499) (-1151.946) -- 0:00:26
Average standard deviation of split frequencies: 0.011100
575500 -- (-1150.352) (-1151.569) [-1153.325] (-1152.835) * (-1151.243) [-1153.025] (-1151.110) (-1154.655) -- 0:00:26
576000 -- (-1151.082) (-1154.106) [-1154.884] (-1151.111) * (-1152.983) [-1150.465] (-1154.415) (-1151.068) -- 0:00:26
576500 -- (-1154.332) (-1153.713) (-1151.985) [-1153.319] * [-1150.925] (-1151.775) (-1153.835) (-1152.672) -- 0:00:26
577000 -- (-1152.653) (-1152.249) [-1151.444] (-1151.563) * (-1154.313) [-1152.505] (-1152.709) (-1149.759) -- 0:00:26
577500 -- [-1152.204] (-1153.474) (-1151.300) (-1152.513) * (-1153.344) (-1151.566) [-1150.503] (-1158.314) -- 0:00:26
578000 -- (-1151.448) [-1161.511] (-1150.766) (-1154.145) * [-1152.918] (-1150.790) (-1151.494) (-1151.574) -- 0:00:26
578500 -- (-1152.778) (-1155.327) (-1150.145) [-1151.130] * [-1151.046] (-1152.282) (-1152.090) (-1151.358) -- 0:00:26
579000 -- [-1151.300] (-1155.172) (-1152.029) (-1158.455) * (-1152.918) [-1153.207] (-1151.378) (-1153.181) -- 0:00:26
579500 -- (-1151.251) (-1153.297) [-1150.126] (-1153.719) * (-1155.110) [-1150.268] (-1151.145) (-1150.530) -- 0:00:26
580000 -- (-1151.150) [-1152.928] (-1150.331) (-1149.971) * (-1157.618) [-1151.655] (-1151.904) (-1150.770) -- 0:00:26
Average standard deviation of split frequencies: 0.010554
580500 -- (-1161.847) (-1152.387) [-1149.984] (-1153.836) * (-1155.535) [-1152.926] (-1151.098) (-1150.015) -- 0:00:26
581000 -- (-1150.968) (-1151.395) (-1151.265) [-1151.154] * (-1153.000) (-1152.736) (-1151.545) [-1151.769] -- 0:00:25
581500 -- (-1152.386) [-1152.110] (-1151.152) (-1149.944) * (-1152.018) (-1151.249) [-1151.294] (-1152.757) -- 0:00:25
582000 -- [-1150.222] (-1152.276) (-1154.077) (-1154.996) * (-1151.384) [-1151.003] (-1151.014) (-1149.972) -- 0:00:25
582500 -- (-1151.049) (-1151.883) [-1151.464] (-1153.777) * (-1150.328) (-1153.126) (-1157.267) [-1153.469] -- 0:00:25
583000 -- (-1151.845) (-1150.518) [-1151.851] (-1158.171) * (-1155.071) [-1154.674] (-1153.003) (-1150.448) -- 0:00:25
583500 -- [-1152.770] (-1151.860) (-1153.248) (-1160.265) * (-1157.630) (-1151.829) (-1153.111) [-1150.497] -- 0:00:26
584000 -- (-1152.044) [-1150.868] (-1155.182) (-1151.710) * (-1151.165) (-1150.924) (-1152.234) [-1152.683] -- 0:00:26
584500 -- (-1154.833) (-1151.060) (-1154.372) [-1154.314] * (-1150.340) (-1151.915) [-1151.169] (-1153.374) -- 0:00:26
585000 -- (-1150.103) (-1150.824) [-1154.949] (-1155.572) * [-1152.295] (-1153.860) (-1151.753) (-1153.465) -- 0:00:26
Average standard deviation of split frequencies: 0.010709
585500 -- (-1150.185) (-1154.037) (-1152.315) [-1152.062] * (-1155.510) [-1152.140] (-1150.529) (-1155.407) -- 0:00:26
586000 -- (-1152.528) (-1152.714) [-1150.652] (-1154.472) * (-1154.133) (-1151.262) [-1154.731] (-1153.840) -- 0:00:26
586500 -- (-1152.817) (-1153.551) (-1151.842) [-1154.077] * (-1154.710) (-1154.111) (-1151.251) [-1151.465] -- 0:00:26
587000 -- (-1155.053) [-1152.578] (-1150.331) (-1150.791) * [-1155.104] (-1152.197) (-1151.246) (-1150.603) -- 0:00:26
587500 -- [-1151.395] (-1153.161) (-1151.023) (-1151.917) * (-1152.369) (-1152.898) [-1153.386] (-1154.175) -- 0:00:25
588000 -- (-1154.098) (-1155.401) (-1149.972) [-1153.164] * (-1152.837) (-1151.239) [-1152.744] (-1152.488) -- 0:00:25
588500 -- [-1150.647] (-1153.412) (-1150.431) (-1153.505) * (-1152.472) (-1150.598) [-1151.339] (-1151.681) -- 0:00:25
589000 -- (-1150.838) [-1152.038] (-1154.926) (-1152.778) * (-1153.542) [-1151.718] (-1150.525) (-1152.160) -- 0:00:25
589500 -- (-1153.154) (-1151.082) [-1153.980] (-1154.775) * [-1154.466] (-1151.258) (-1153.617) (-1152.592) -- 0:00:25
590000 -- (-1152.583) (-1154.139) (-1152.310) [-1151.943] * (-1155.310) (-1150.662) (-1150.945) [-1150.139] -- 0:00:25
Average standard deviation of split frequencies: 0.010724
590500 -- (-1152.966) (-1151.221) [-1150.627] (-1150.861) * [-1152.981] (-1150.662) (-1154.220) (-1152.254) -- 0:00:25
591000 -- (-1157.419) (-1151.566) [-1150.536] (-1152.618) * (-1152.149) (-1150.651) [-1151.805] (-1152.924) -- 0:00:25
591500 -- (-1157.811) (-1152.632) [-1151.177] (-1151.791) * (-1150.995) (-1154.708) (-1152.754) [-1152.883] -- 0:00:25
592000 -- (-1153.486) (-1156.967) (-1152.400) [-1153.059] * (-1150.924) (-1151.225) (-1152.435) [-1152.392] -- 0:00:25
592500 -- (-1151.178) [-1152.996] (-1154.830) (-1151.597) * [-1153.126] (-1151.682) (-1152.928) (-1150.703) -- 0:00:25
593000 -- (-1151.383) (-1152.682) (-1157.120) [-1152.269] * (-1153.664) (-1150.155) [-1153.259] (-1152.294) -- 0:00:25
593500 -- (-1152.136) (-1153.243) (-1153.056) [-1155.822] * [-1151.736] (-1153.004) (-1150.475) (-1154.113) -- 0:00:25
594000 -- (-1151.631) [-1151.989] (-1156.750) (-1156.577) * (-1150.467) (-1152.156) [-1150.088] (-1156.241) -- 0:00:25
594500 -- (-1150.008) (-1154.657) (-1155.389) [-1156.433] * (-1150.200) [-1154.126] (-1151.559) (-1158.988) -- 0:00:25
595000 -- [-1150.849] (-1152.184) (-1155.895) (-1153.681) * (-1152.000) [-1152.436] (-1154.086) (-1152.251) -- 0:00:25
Average standard deviation of split frequencies: 0.010701
595500 -- [-1150.249] (-1153.441) (-1154.919) (-1150.562) * (-1153.249) (-1150.709) [-1153.208] (-1153.204) -- 0:00:25
596000 -- (-1150.141) (-1152.281) [-1154.680] (-1150.393) * (-1153.689) (-1152.682) (-1151.635) [-1151.277] -- 0:00:25
596500 -- (-1153.133) (-1151.802) [-1155.155] (-1153.111) * (-1151.800) [-1154.389] (-1154.988) (-1153.267) -- 0:00:25
597000 -- (-1152.468) (-1152.335) (-1153.734) [-1151.728] * (-1156.417) (-1154.677) [-1152.742] (-1158.137) -- 0:00:24
597500 -- (-1151.995) (-1150.500) (-1150.794) [-1151.616] * (-1155.430) [-1151.601] (-1153.702) (-1150.620) -- 0:00:24
598000 -- (-1151.760) [-1151.828] (-1155.300) (-1155.116) * [-1151.389] (-1154.006) (-1154.367) (-1158.458) -- 0:00:24
598500 -- (-1156.168) (-1151.469) (-1151.076) [-1151.591] * [-1151.982] (-1151.526) (-1153.170) (-1154.001) -- 0:00:24
599000 -- (-1156.271) (-1153.613) (-1152.277) [-1151.435] * [-1151.243] (-1153.083) (-1151.694) (-1151.902) -- 0:00:24
599500 -- [-1151.415] (-1155.174) (-1150.653) (-1150.205) * (-1152.692) (-1152.986) (-1154.025) [-1151.464] -- 0:00:24
600000 -- [-1151.411] (-1151.284) (-1150.221) (-1150.187) * [-1150.703] (-1154.210) (-1152.354) (-1150.655) -- 0:00:25
Average standard deviation of split frequencies: 0.010497
600500 -- (-1151.171) (-1151.469) [-1150.577] (-1156.892) * (-1150.132) (-1156.756) [-1151.850] (-1155.014) -- 0:00:25
601000 -- [-1151.763] (-1152.761) (-1151.150) (-1151.188) * (-1151.342) (-1156.602) (-1153.747) [-1152.015] -- 0:00:25
601500 -- (-1153.199) (-1155.680) (-1153.852) [-1150.150] * (-1150.839) (-1155.548) [-1151.317] (-1150.620) -- 0:00:25
602000 -- [-1150.675] (-1151.914) (-1151.671) (-1150.959) * (-1152.856) [-1151.875] (-1152.639) (-1152.513) -- 0:00:25
602500 -- [-1150.806] (-1152.765) (-1152.337) (-1151.325) * (-1152.244) (-1152.456) [-1151.116] (-1151.485) -- 0:00:25
603000 -- (-1151.620) (-1151.496) (-1153.592) [-1153.256] * (-1152.519) (-1155.753) (-1151.341) [-1151.018] -- 0:00:25
603500 -- (-1153.528) (-1151.087) (-1151.331) [-1153.407] * [-1150.818] (-1164.276) (-1152.656) (-1152.499) -- 0:00:24
604000 -- (-1153.506) (-1150.146) (-1151.178) [-1153.581] * (-1153.016) (-1156.362) [-1150.072] (-1154.389) -- 0:00:24
604500 -- [-1153.012] (-1151.107) (-1151.673) (-1153.024) * [-1152.699] (-1155.093) (-1152.354) (-1154.958) -- 0:00:24
605000 -- [-1152.968] (-1152.160) (-1151.186) (-1152.039) * (-1154.087) [-1150.566] (-1153.600) (-1156.462) -- 0:00:24
Average standard deviation of split frequencies: 0.010793
605500 -- (-1152.225) [-1152.602] (-1156.981) (-1153.350) * (-1151.629) [-1152.184] (-1150.262) (-1162.198) -- 0:00:24
606000 -- [-1151.869] (-1151.126) (-1155.597) (-1155.752) * (-1153.789) (-1150.005) [-1151.816] (-1152.955) -- 0:00:24
606500 -- [-1151.083] (-1151.656) (-1165.376) (-1154.183) * [-1156.418] (-1152.669) (-1150.644) (-1154.003) -- 0:00:24
607000 -- (-1150.691) (-1151.921) (-1150.966) [-1150.469] * (-1152.886) [-1150.999] (-1150.456) (-1152.722) -- 0:00:24
607500 -- [-1151.775] (-1153.097) (-1151.521) (-1151.987) * (-1153.831) (-1157.006) (-1152.607) [-1150.667] -- 0:00:24
608000 -- (-1151.093) [-1150.804] (-1152.789) (-1151.727) * [-1152.107] (-1151.955) (-1151.361) (-1151.303) -- 0:00:24
608500 -- [-1153.659] (-1151.157) (-1150.174) (-1153.925) * (-1151.137) (-1151.854) (-1150.969) [-1151.562] -- 0:00:24
609000 -- (-1151.552) (-1150.625) [-1150.967] (-1150.860) * [-1152.474] (-1151.629) (-1152.490) (-1151.511) -- 0:00:24
609500 -- (-1157.018) [-1151.727] (-1153.880) (-1151.902) * (-1156.260) (-1152.310) (-1154.097) [-1149.934] -- 0:00:24
610000 -- [-1150.758] (-1151.583) (-1153.181) (-1155.167) * (-1152.213) (-1151.495) (-1153.275) [-1150.849] -- 0:00:24
Average standard deviation of split frequencies: 0.010489
610500 -- (-1153.155) (-1153.474) [-1150.480] (-1156.827) * (-1154.018) (-1149.744) [-1154.176] (-1151.402) -- 0:00:24
611000 -- [-1154.055] (-1152.188) (-1151.625) (-1154.752) * (-1153.729) [-1151.291] (-1150.823) (-1153.348) -- 0:00:24
611500 -- (-1152.253) (-1152.463) (-1151.789) [-1151.089] * (-1151.311) (-1150.677) (-1151.022) [-1152.885] -- 0:00:24
612000 -- [-1151.846] (-1152.158) (-1153.504) (-1152.639) * (-1151.313) (-1152.772) (-1150.172) [-1153.117] -- 0:00:24
612500 -- (-1153.780) (-1150.812) (-1156.263) [-1151.446] * (-1154.507) (-1150.439) [-1150.988] (-1151.976) -- 0:00:24
613000 -- (-1152.310) (-1151.249) (-1153.331) [-1150.437] * [-1150.973] (-1151.582) (-1151.563) (-1152.761) -- 0:00:23
613500 -- (-1151.001) [-1150.571] (-1152.873) (-1150.605) * (-1152.994) [-1150.398] (-1150.482) (-1150.691) -- 0:00:23
614000 -- [-1151.866] (-1150.724) (-1153.978) (-1153.726) * (-1153.818) [-1150.712] (-1150.751) (-1152.339) -- 0:00:23
614500 -- (-1150.930) (-1152.067) (-1152.962) [-1152.386] * (-1153.674) [-1153.781] (-1150.572) (-1151.450) -- 0:00:23
615000 -- [-1150.360] (-1150.146) (-1150.373) (-1155.763) * (-1152.134) (-1153.234) (-1152.072) [-1151.834] -- 0:00:23
Average standard deviation of split frequencies: 0.009768
615500 -- [-1150.544] (-1150.156) (-1152.443) (-1155.616) * (-1152.494) [-1151.114] (-1157.384) (-1151.925) -- 0:00:23
616000 -- (-1151.207) (-1150.172) [-1153.435] (-1151.796) * (-1152.680) (-1152.700) [-1151.075] (-1151.443) -- 0:00:24
616500 -- [-1152.922] (-1150.885) (-1152.554) (-1157.997) * (-1151.949) [-1153.664] (-1155.658) (-1151.576) -- 0:00:24
617000 -- (-1153.839) (-1153.678) (-1152.519) [-1150.819] * [-1152.507] (-1152.414) (-1150.932) (-1151.030) -- 0:00:24
617500 -- (-1152.113) [-1151.216] (-1153.503) (-1152.650) * (-1160.956) [-1150.366] (-1150.846) (-1152.441) -- 0:00:24
618000 -- [-1150.649] (-1153.859) (-1154.317) (-1150.446) * [-1154.801] (-1153.455) (-1153.532) (-1155.030) -- 0:00:24
618500 -- (-1150.664) (-1155.498) (-1157.807) [-1152.351] * (-1156.970) (-1152.857) (-1151.968) [-1151.407] -- 0:00:24
619000 -- (-1150.580) (-1150.519) (-1154.042) [-1152.339] * (-1157.333) (-1152.871) (-1151.447) [-1151.169] -- 0:00:24
619500 -- (-1149.881) [-1153.388] (-1152.619) (-1151.453) * (-1151.215) (-1152.118) [-1154.069] (-1151.341) -- 0:00:23
620000 -- [-1152.444] (-1151.633) (-1152.660) (-1153.542) * (-1151.178) (-1154.530) (-1151.544) [-1150.499] -- 0:00:23
Average standard deviation of split frequencies: 0.009541
620500 -- [-1152.464] (-1152.107) (-1152.107) (-1150.835) * (-1151.619) [-1152.054] (-1154.260) (-1151.816) -- 0:00:23
621000 -- (-1155.251) [-1151.617] (-1151.455) (-1152.461) * (-1150.038) (-1151.466) (-1154.820) [-1149.988] -- 0:00:23
621500 -- (-1152.937) [-1153.273] (-1156.796) (-1154.946) * (-1150.358) [-1151.951] (-1151.953) (-1150.830) -- 0:00:23
622000 -- (-1153.313) [-1150.402] (-1152.268) (-1156.318) * (-1155.034) [-1151.654] (-1152.515) (-1149.831) -- 0:00:23
622500 -- [-1150.240] (-1150.965) (-1151.824) (-1153.092) * (-1154.643) (-1151.922) (-1151.449) [-1150.787] -- 0:00:23
623000 -- [-1152.591] (-1150.573) (-1150.741) (-1152.528) * [-1154.143] (-1152.081) (-1152.558) (-1150.392) -- 0:00:23
623500 -- [-1158.982] (-1150.971) (-1151.769) (-1150.368) * [-1152.087] (-1153.506) (-1151.206) (-1150.286) -- 0:00:23
624000 -- [-1150.690] (-1154.640) (-1153.199) (-1150.853) * (-1154.208) (-1154.401) [-1153.262] (-1153.896) -- 0:00:23
624500 -- (-1153.424) [-1154.750] (-1153.423) (-1155.058) * [-1153.651] (-1151.655) (-1152.903) (-1151.318) -- 0:00:23
625000 -- [-1158.021] (-1155.513) (-1153.188) (-1152.096) * (-1152.099) (-1151.655) (-1152.315) [-1151.039] -- 0:00:23
Average standard deviation of split frequencies: 0.009137
625500 -- (-1151.932) [-1153.125] (-1151.621) (-1151.208) * (-1154.736) (-1152.672) (-1152.623) [-1150.116] -- 0:00:23
626000 -- [-1150.244] (-1156.193) (-1151.019) (-1151.171) * (-1152.336) (-1153.664) [-1156.102] (-1152.580) -- 0:00:23
626500 -- (-1151.576) (-1153.472) [-1150.549] (-1154.823) * (-1150.256) [-1153.814] (-1152.014) (-1151.288) -- 0:00:23
627000 -- (-1151.037) (-1155.430) [-1150.870] (-1152.782) * (-1153.909) [-1153.274] (-1152.160) (-1156.247) -- 0:00:23
627500 -- [-1151.798] (-1151.604) (-1150.757) (-1151.475) * (-1151.003) (-1151.992) [-1152.232] (-1152.001) -- 0:00:23
628000 -- [-1155.063] (-1150.991) (-1150.837) (-1151.780) * [-1151.003] (-1153.146) (-1152.671) (-1151.492) -- 0:00:23
628500 -- [-1151.341] (-1151.853) (-1150.787) (-1152.206) * (-1153.596) (-1159.109) (-1152.805) [-1150.054] -- 0:00:23
629000 -- (-1151.778) (-1151.692) [-1150.668] (-1156.739) * (-1151.076) (-1153.308) (-1153.142) [-1150.543] -- 0:00:23
629500 -- (-1154.857) (-1152.782) [-1151.392] (-1151.934) * (-1151.750) [-1152.951] (-1153.732) (-1151.012) -- 0:00:22
630000 -- (-1156.530) [-1153.005] (-1151.514) (-1150.498) * (-1154.022) [-1150.842] (-1151.902) (-1152.358) -- 0:00:22
Average standard deviation of split frequencies: 0.008621
630500 -- [-1152.441] (-1150.197) (-1152.419) (-1150.877) * (-1152.008) [-1154.107] (-1157.564) (-1151.746) -- 0:00:22
631000 -- [-1150.123] (-1151.576) (-1154.090) (-1154.177) * (-1151.657) (-1150.451) [-1153.673] (-1151.910) -- 0:00:22
631500 -- (-1150.392) (-1151.851) (-1150.814) [-1151.651] * [-1150.097] (-1150.267) (-1152.615) (-1152.002) -- 0:00:22
632000 -- (-1150.981) (-1154.069) (-1152.945) [-1151.282] * (-1150.670) [-1151.976] (-1153.219) (-1152.318) -- 0:00:22
632500 -- (-1151.461) (-1151.200) (-1152.880) [-1151.570] * [-1151.315] (-1151.102) (-1150.391) (-1152.216) -- 0:00:23
633000 -- (-1155.326) (-1152.977) [-1154.091] (-1150.471) * [-1157.210] (-1154.543) (-1150.086) (-1153.239) -- 0:00:23
633500 -- (-1149.840) [-1150.558] (-1155.971) (-1152.222) * [-1150.921] (-1153.838) (-1154.366) (-1153.914) -- 0:00:23
634000 -- (-1150.062) (-1151.104) (-1158.490) [-1151.463] * (-1155.153) (-1153.211) [-1151.361] (-1153.917) -- 0:00:23
634500 -- [-1152.800] (-1152.083) (-1154.212) (-1156.792) * (-1152.492) (-1155.304) [-1153.329] (-1152.685) -- 0:00:23
635000 -- (-1151.218) (-1153.890) (-1156.411) [-1152.715] * (-1150.615) (-1153.367) (-1150.940) [-1152.643] -- 0:00:22
Average standard deviation of split frequencies: 0.008746
635500 -- (-1151.594) [-1152.815] (-1152.691) (-1153.325) * [-1150.097] (-1154.798) (-1150.096) (-1155.087) -- 0:00:22
636000 -- [-1151.298] (-1153.368) (-1151.972) (-1154.456) * (-1151.455) (-1153.003) (-1151.098) [-1153.902] -- 0:00:22
636500 -- (-1151.239) (-1152.591) [-1151.461] (-1154.064) * (-1152.770) (-1152.190) [-1152.057] (-1156.683) -- 0:00:22
637000 -- (-1154.956) (-1151.863) [-1152.324] (-1153.620) * (-1151.903) (-1151.502) [-1153.393] (-1156.362) -- 0:00:22
637500 -- (-1152.752) (-1155.594) (-1153.283) [-1152.468] * (-1152.294) (-1152.962) (-1152.632) [-1152.661] -- 0:00:22
638000 -- (-1155.531) (-1157.624) (-1156.093) [-1153.263] * (-1149.798) [-1151.293] (-1156.515) (-1151.751) -- 0:00:22
638500 -- [-1163.523] (-1156.580) (-1156.433) (-1156.779) * (-1150.107) [-1151.101] (-1155.353) (-1152.616) -- 0:00:22
639000 -- (-1152.412) (-1151.715) (-1152.994) [-1158.354] * (-1151.370) (-1150.909) [-1154.447] (-1152.692) -- 0:00:22
639500 -- (-1153.665) (-1150.708) (-1154.298) [-1152.182] * [-1150.987] (-1150.425) (-1152.944) (-1151.693) -- 0:00:22
640000 -- [-1150.576] (-1150.213) (-1152.647) (-1152.257) * (-1155.268) (-1151.401) (-1150.773) [-1150.694] -- 0:00:22
Average standard deviation of split frequencies: 0.009060
640500 -- (-1151.687) [-1150.472] (-1153.712) (-1152.002) * [-1152.479] (-1151.566) (-1151.506) (-1152.284) -- 0:00:22
641000 -- (-1153.056) (-1152.544) [-1151.304] (-1151.606) * (-1152.831) [-1155.534] (-1155.823) (-1150.084) -- 0:00:22
641500 -- (-1152.343) (-1153.510) (-1155.543) [-1152.091] * (-1154.941) (-1154.656) (-1152.604) [-1153.659] -- 0:00:22
642000 -- (-1152.099) [-1152.732] (-1150.553) (-1150.378) * (-1152.050) [-1152.234] (-1152.057) (-1151.356) -- 0:00:22
642500 -- (-1151.177) [-1154.625] (-1152.692) (-1153.120) * (-1153.478) (-1151.211) (-1151.890) [-1150.535] -- 0:00:22
643000 -- (-1150.473) [-1151.319] (-1152.419) (-1153.406) * (-1151.895) [-1150.330] (-1153.960) (-1150.938) -- 0:00:22
643500 -- (-1149.884) [-1153.428] (-1153.588) (-1152.336) * (-1153.017) [-1151.851] (-1153.824) (-1151.306) -- 0:00:22
644000 -- (-1154.390) (-1151.207) [-1153.520] (-1152.580) * [-1151.809] (-1153.284) (-1153.455) (-1151.472) -- 0:00:22
644500 -- (-1152.558) (-1150.033) (-1152.814) [-1152.074] * (-1152.235) (-1153.098) [-1151.235] (-1151.303) -- 0:00:22
645000 -- (-1155.489) [-1150.332] (-1152.420) (-1151.042) * [-1151.396] (-1156.195) (-1152.029) (-1154.560) -- 0:00:22
Average standard deviation of split frequencies: 0.009350
645500 -- (-1156.005) (-1151.200) (-1151.780) [-1150.980] * (-1158.690) (-1155.505) [-1150.549] (-1151.585) -- 0:00:21
646000 -- [-1154.945] (-1151.188) (-1151.804) (-1150.162) * (-1153.344) [-1151.549] (-1151.980) (-1152.276) -- 0:00:21
646500 -- (-1151.402) [-1151.412] (-1152.143) (-1150.152) * (-1151.980) [-1151.481] (-1151.860) (-1150.703) -- 0:00:21
647000 -- (-1151.140) [-1150.538] (-1152.449) (-1150.905) * (-1153.415) (-1151.345) (-1151.296) [-1150.577] -- 0:00:21
647500 -- (-1155.262) [-1152.139] (-1152.835) (-1150.605) * (-1151.102) [-1151.476] (-1151.210) (-1152.639) -- 0:00:21
648000 -- (-1151.724) (-1152.290) [-1154.666] (-1152.972) * [-1152.695] (-1155.076) (-1153.240) (-1152.410) -- 0:00:21
648500 -- (-1154.333) (-1152.475) (-1151.846) [-1151.215] * (-1153.246) (-1156.412) [-1151.873] (-1154.017) -- 0:00:21
649000 -- (-1153.274) (-1151.893) (-1152.977) [-1153.579] * (-1151.897) [-1152.560] (-1152.675) (-1151.772) -- 0:00:22
649500 -- [-1153.838] (-1153.084) (-1152.618) (-1151.129) * (-1151.210) (-1156.005) (-1151.100) [-1153.087] -- 0:00:22
650000 -- (-1155.649) (-1151.995) (-1153.587) [-1152.685] * (-1152.155) [-1154.505] (-1153.704) (-1154.057) -- 0:00:22
Average standard deviation of split frequencies: 0.008920
650500 -- (-1155.459) (-1151.318) (-1150.317) [-1153.316] * (-1152.208) [-1150.964] (-1153.437) (-1151.437) -- 0:00:22
651000 -- (-1157.708) (-1155.804) [-1151.697] (-1152.975) * [-1150.042] (-1150.528) (-1156.198) (-1154.124) -- 0:00:21
651500 -- [-1152.935] (-1153.120) (-1150.708) (-1153.420) * [-1152.438] (-1153.374) (-1153.941) (-1151.552) -- 0:00:21
652000 -- (-1153.175) [-1150.065] (-1151.311) (-1152.721) * (-1152.792) (-1151.652) [-1153.116] (-1156.903) -- 0:00:21
652500 -- (-1151.200) [-1149.931] (-1150.306) (-1150.554) * (-1154.652) (-1151.874) (-1152.627) [-1152.495] -- 0:00:21
653000 -- (-1152.147) (-1152.237) [-1152.674] (-1152.306) * (-1151.138) (-1153.305) (-1156.115) [-1151.219] -- 0:00:21
653500 -- (-1151.142) (-1154.522) (-1154.044) [-1151.517] * [-1150.155] (-1152.254) (-1151.150) (-1150.894) -- 0:00:21
654000 -- (-1151.798) (-1153.074) (-1152.874) [-1153.625] * (-1150.920) (-1150.898) (-1150.907) [-1150.399] -- 0:00:21
654500 -- (-1152.824) [-1151.648] (-1152.298) (-1155.752) * [-1153.407] (-1151.872) (-1152.364) (-1155.669) -- 0:00:21
655000 -- (-1150.917) [-1156.541] (-1151.986) (-1152.713) * (-1151.392) (-1151.690) (-1153.392) [-1152.531] -- 0:00:21
Average standard deviation of split frequencies: 0.008668
655500 -- [-1151.364] (-1152.299) (-1154.252) (-1150.783) * (-1156.166) (-1153.101) (-1153.210) [-1154.829] -- 0:00:21
656000 -- (-1153.324) [-1150.685] (-1152.360) (-1150.445) * [-1154.800] (-1152.744) (-1153.671) (-1159.137) -- 0:00:21
656500 -- (-1150.295) (-1150.794) [-1150.510] (-1149.885) * (-1154.287) [-1153.287] (-1158.756) (-1151.214) -- 0:00:21
657000 -- (-1153.544) (-1151.721) (-1150.479) [-1150.167] * (-1161.712) (-1153.325) [-1152.155] (-1150.553) -- 0:00:21
657500 -- (-1153.946) [-1151.929] (-1152.389) (-1151.834) * (-1154.205) [-1152.157] (-1151.335) (-1149.809) -- 0:00:21
658000 -- (-1152.751) (-1150.076) (-1154.505) [-1151.374] * [-1151.345] (-1152.281) (-1152.715) (-1149.874) -- 0:00:21
658500 -- (-1151.201) [-1152.009] (-1152.222) (-1152.516) * (-1151.934) [-1151.816] (-1152.733) (-1150.415) -- 0:00:21
659000 -- (-1151.822) (-1152.137) [-1151.508] (-1151.098) * (-1153.028) [-1151.907] (-1150.302) (-1150.443) -- 0:00:21
659500 -- (-1151.597) (-1151.868) [-1152.637] (-1150.717) * (-1153.861) [-1151.168] (-1150.244) (-1152.372) -- 0:00:21
660000 -- (-1150.641) (-1153.937) (-1155.786) [-1151.115] * (-1153.825) (-1151.399) [-1150.548] (-1151.215) -- 0:00:21
Average standard deviation of split frequencies: 0.009008
660500 -- [-1150.434] (-1150.469) (-1152.560) (-1149.973) * (-1156.058) (-1150.511) (-1158.480) [-1153.548] -- 0:00:21
661000 -- [-1149.947] (-1150.833) (-1152.233) (-1151.270) * (-1152.412) [-1150.519] (-1154.068) (-1150.960) -- 0:00:21
661500 -- [-1150.566] (-1156.739) (-1154.794) (-1153.388) * [-1152.050] (-1152.003) (-1152.287) (-1151.612) -- 0:00:20
662000 -- (-1152.102) (-1151.774) [-1150.287] (-1152.114) * (-1156.945) (-1151.556) (-1153.301) [-1151.127] -- 0:00:20
662500 -- (-1152.474) [-1154.385] (-1151.469) (-1152.905) * (-1155.615) (-1150.770) (-1156.907) [-1151.362] -- 0:00:20
663000 -- (-1152.635) (-1149.979) [-1150.591] (-1152.039) * (-1152.667) (-1153.830) (-1153.614) [-1151.759] -- 0:00:20
663500 -- (-1153.397) (-1153.509) (-1150.869) [-1153.285] * (-1151.594) (-1157.161) [-1150.843] (-1153.510) -- 0:00:20
664000 -- (-1154.279) (-1151.162) [-1150.133] (-1152.570) * (-1151.460) (-1155.363) [-1150.951] (-1151.374) -- 0:00:20
664500 -- (-1151.040) (-1152.479) (-1150.581) [-1150.491] * (-1150.577) [-1150.838] (-1152.329) (-1150.778) -- 0:00:20
665000 -- [-1150.946] (-1150.982) (-1152.279) (-1150.167) * [-1153.122] (-1151.570) (-1149.981) (-1153.109) -- 0:00:20
Average standard deviation of split frequencies: 0.009243
665500 -- (-1150.934) [-1152.814] (-1154.101) (-1151.351) * [-1151.946] (-1151.345) (-1151.367) (-1154.216) -- 0:00:21
666000 -- (-1150.905) (-1152.137) (-1151.429) [-1151.699] * (-1151.018) (-1150.744) [-1151.530] (-1152.078) -- 0:00:21
666500 -- (-1160.065) [-1151.456] (-1151.384) (-1151.867) * (-1158.370) (-1152.361) (-1152.860) [-1152.167] -- 0:00:21
667000 -- (-1155.942) (-1151.584) [-1150.922] (-1153.830) * (-1152.389) (-1151.591) (-1151.025) [-1152.093] -- 0:00:20
667500 -- (-1150.763) (-1152.031) [-1152.190] (-1150.245) * (-1151.081) (-1154.192) (-1150.207) [-1151.329] -- 0:00:20
668000 -- (-1152.742) (-1151.759) [-1152.345] (-1151.454) * (-1152.220) [-1151.300] (-1154.445) (-1154.426) -- 0:00:20
668500 -- (-1155.370) (-1151.838) [-1150.573] (-1152.489) * (-1152.624) [-1151.855] (-1154.089) (-1151.642) -- 0:00:20
669000 -- (-1150.219) [-1152.086] (-1150.293) (-1150.578) * (-1154.424) [-1151.300] (-1153.839) (-1152.333) -- 0:00:20
669500 -- [-1151.659] (-1151.416) (-1152.429) (-1152.381) * (-1153.080) (-1151.648) [-1153.553] (-1152.067) -- 0:00:20
670000 -- (-1151.393) (-1156.074) (-1151.353) [-1155.336] * (-1150.319) (-1152.970) (-1154.014) [-1152.230] -- 0:00:20
Average standard deviation of split frequencies: 0.008950
670500 -- (-1152.593) [-1155.545] (-1151.415) (-1152.021) * (-1150.312) (-1151.065) [-1152.292] (-1154.670) -- 0:00:20
671000 -- (-1150.959) (-1155.579) [-1152.667] (-1154.889) * (-1153.247) (-1151.065) (-1152.764) [-1151.685] -- 0:00:20
671500 -- (-1152.040) (-1154.212) [-1151.157] (-1151.420) * (-1151.586) [-1150.220] (-1152.032) (-1150.897) -- 0:00:20
672000 -- [-1152.216] (-1154.160) (-1149.902) (-1153.961) * (-1151.589) (-1150.798) (-1153.105) [-1151.862] -- 0:00:20
672500 -- (-1151.972) (-1152.173) (-1150.317) [-1152.250] * (-1151.218) (-1152.203) (-1158.161) [-1151.493] -- 0:00:20
673000 -- (-1150.118) (-1151.275) [-1151.075] (-1155.701) * (-1154.288) [-1152.067] (-1154.691) (-1151.857) -- 0:00:20
673500 -- (-1152.875) (-1151.755) [-1151.191] (-1153.815) * (-1155.684) [-1151.958] (-1152.415) (-1150.936) -- 0:00:20
674000 -- (-1152.820) (-1151.630) [-1152.619] (-1153.381) * [-1152.706] (-1154.036) (-1150.136) (-1154.446) -- 0:00:20
674500 -- [-1155.110] (-1152.533) (-1151.454) (-1151.991) * (-1151.007) (-1151.821) (-1151.785) [-1151.524] -- 0:00:20
675000 -- (-1156.540) (-1153.423) (-1150.636) [-1150.618] * (-1153.282) (-1149.761) [-1150.500] (-1151.152) -- 0:00:20
Average standard deviation of split frequencies: 0.008880
675500 -- (-1154.790) (-1155.830) (-1150.776) [-1151.427] * (-1156.732) (-1150.001) (-1155.152) [-1151.801] -- 0:00:20
676000 -- (-1150.678) (-1156.423) (-1156.068) [-1150.980] * (-1154.306) (-1150.525) [-1154.129] (-1151.117) -- 0:00:20
676500 -- (-1151.014) [-1155.312] (-1150.774) (-1151.682) * (-1150.268) (-1152.161) (-1152.753) [-1151.312] -- 0:00:20
677000 -- [-1150.376] (-1155.018) (-1154.286) (-1150.213) * (-1153.979) [-1153.261] (-1150.040) (-1153.633) -- 0:00:20
677500 -- (-1154.341) [-1150.263] (-1151.215) (-1151.571) * [-1154.032] (-1153.111) (-1152.332) (-1154.950) -- 0:00:19
678000 -- [-1150.463] (-1151.377) (-1151.898) (-1152.083) * (-1152.315) (-1152.766) (-1155.950) [-1153.059] -- 0:00:19
678500 -- (-1152.393) (-1151.563) (-1151.147) [-1152.149] * (-1151.320) (-1150.208) (-1153.287) [-1151.046] -- 0:00:19
679000 -- (-1152.251) [-1149.966] (-1150.712) (-1153.058) * (-1154.671) [-1152.501] (-1156.057) (-1151.791) -- 0:00:19
679500 -- (-1156.206) (-1155.277) (-1150.467) [-1154.598] * (-1156.158) (-1152.501) (-1155.852) [-1151.382] -- 0:00:19
680000 -- (-1153.661) [-1155.998] (-1153.240) (-1152.009) * (-1152.442) [-1155.105] (-1155.617) (-1151.567) -- 0:00:19
Average standard deviation of split frequencies: 0.008403
680500 -- (-1153.974) (-1153.033) (-1156.647) [-1152.132] * (-1153.906) (-1153.805) (-1153.206) [-1151.389] -- 0:00:19
681000 -- (-1153.052) (-1154.430) (-1154.418) [-1151.863] * (-1154.765) (-1153.220) [-1152.735] (-1152.366) -- 0:00:19
681500 -- (-1152.326) (-1153.803) [-1150.465] (-1151.896) * (-1157.299) (-1155.002) [-1151.412] (-1155.393) -- 0:00:19
682000 -- (-1153.285) (-1154.714) [-1150.612] (-1154.645) * [-1154.311] (-1150.931) (-1151.771) (-1154.370) -- 0:00:20
682500 -- [-1149.964] (-1154.268) (-1151.615) (-1152.331) * [-1157.830] (-1155.340) (-1151.081) (-1157.335) -- 0:00:20
683000 -- (-1151.632) (-1152.397) (-1152.059) [-1152.432] * (-1154.111) (-1153.196) (-1152.634) [-1153.097] -- 0:00:19
683500 -- [-1152.848] (-1152.345) (-1152.026) (-1153.295) * [-1151.874] (-1150.790) (-1153.476) (-1151.090) -- 0:00:19
684000 -- (-1155.700) [-1150.760] (-1152.560) (-1153.481) * (-1151.093) (-1152.046) (-1151.254) [-1151.561] -- 0:00:19
684500 -- (-1151.085) (-1156.555) (-1151.215) [-1153.581] * [-1151.051] (-1155.191) (-1150.491) (-1154.928) -- 0:00:19
685000 -- [-1151.889] (-1153.884) (-1151.369) (-1151.995) * (-1153.615) (-1150.936) [-1151.168] (-1152.239) -- 0:00:19
Average standard deviation of split frequencies: 0.008292
685500 -- (-1151.895) (-1153.793) [-1151.452] (-1150.392) * [-1152.806] (-1153.271) (-1153.740) (-1158.206) -- 0:00:19
686000 -- (-1151.255) (-1154.227) (-1155.475) [-1151.386] * (-1153.344) (-1153.120) (-1151.281) [-1150.533] -- 0:00:19
686500 -- [-1155.739] (-1152.244) (-1151.525) (-1154.231) * (-1155.364) [-1151.532] (-1151.144) (-1150.763) -- 0:00:19
687000 -- (-1155.117) [-1152.108] (-1152.189) (-1154.671) * (-1151.647) (-1151.286) [-1153.100] (-1154.728) -- 0:00:19
687500 -- (-1152.308) (-1150.498) (-1152.387) [-1154.933] * [-1151.941] (-1150.371) (-1151.825) (-1151.936) -- 0:00:19
688000 -- (-1152.953) (-1150.242) (-1153.519) [-1152.095] * (-1154.497) [-1152.355] (-1151.579) (-1154.571) -- 0:00:19
688500 -- (-1151.569) (-1150.522) [-1150.521] (-1152.265) * [-1151.662] (-1154.555) (-1156.813) (-1153.932) -- 0:00:19
689000 -- (-1155.270) (-1150.475) (-1152.133) [-1152.361] * (-1151.895) (-1150.425) (-1152.197) [-1152.586] -- 0:00:19
689500 -- (-1151.050) [-1151.994] (-1153.037) (-1155.480) * (-1154.502) (-1157.030) [-1154.973] (-1150.458) -- 0:00:19
690000 -- (-1150.403) [-1153.097] (-1154.544) (-1154.980) * (-1152.233) [-1150.907] (-1150.921) (-1149.830) -- 0:00:19
Average standard deviation of split frequencies: 0.009009
690500 -- (-1153.192) (-1152.537) (-1153.898) [-1153.839] * [-1152.009] (-1152.423) (-1153.311) (-1151.200) -- 0:00:19
691000 -- [-1152.486] (-1151.363) (-1153.285) (-1153.506) * (-1151.459) [-1152.655] (-1153.308) (-1151.702) -- 0:00:19
691500 -- (-1151.994) [-1154.850] (-1154.068) (-1152.868) * (-1151.171) (-1152.489) (-1154.674) [-1152.647] -- 0:00:19
692000 -- (-1157.121) [-1152.173] (-1151.262) (-1152.822) * (-1152.916) [-1154.677] (-1152.504) (-1152.292) -- 0:00:19
692500 -- (-1153.307) (-1153.230) [-1151.021] (-1150.395) * [-1155.195] (-1159.386) (-1150.794) (-1150.472) -- 0:00:19
693000 -- (-1151.217) (-1151.904) [-1153.384] (-1152.779) * (-1152.117) (-1152.287) [-1152.927] (-1151.180) -- 0:00:19
693500 -- (-1154.391) (-1151.281) (-1151.703) [-1151.594] * (-1158.763) (-1150.899) [-1150.920] (-1151.859) -- 0:00:19
694000 -- (-1153.170) (-1151.670) (-1153.346) [-1152.570] * (-1152.591) (-1152.318) [-1156.864] (-1156.726) -- 0:00:18
694500 -- [-1151.851] (-1152.031) (-1152.310) (-1151.697) * (-1151.393) (-1151.674) [-1150.338] (-1152.078) -- 0:00:18
695000 -- (-1153.152) [-1153.228] (-1152.862) (-1153.997) * (-1157.266) [-1153.419] (-1151.793) (-1154.204) -- 0:00:18
Average standard deviation of split frequencies: 0.009271
695500 -- (-1152.339) (-1153.413) [-1150.078] (-1152.089) * [-1154.788] (-1151.494) (-1152.190) (-1154.382) -- 0:00:18
696000 -- (-1154.869) (-1154.296) (-1150.704) [-1151.160] * (-1151.039) (-1150.751) [-1154.398] (-1152.442) -- 0:00:18
696500 -- (-1156.469) (-1156.036) (-1151.100) [-1151.335] * (-1152.177) (-1153.129) (-1151.778) [-1153.030] -- 0:00:18
697000 -- (-1153.430) (-1157.528) (-1150.022) [-1150.270] * (-1151.587) (-1151.580) [-1152.559] (-1156.376) -- 0:00:18
697500 -- (-1152.646) (-1151.551) (-1152.814) [-1150.446] * (-1152.387) (-1154.139) (-1152.206) [-1151.923] -- 0:00:18
698000 -- [-1151.439] (-1150.753) (-1151.243) (-1153.479) * (-1152.550) [-1151.948] (-1151.811) (-1151.147) -- 0:00:18
698500 -- (-1150.723) (-1153.570) (-1153.390) [-1154.846] * (-1160.313) [-1152.585] (-1151.114) (-1150.948) -- 0:00:18
699000 -- (-1153.885) (-1154.036) (-1152.542) [-1153.448] * [-1152.972] (-1150.437) (-1152.474) (-1151.004) -- 0:00:18
699500 -- (-1152.753) (-1161.433) (-1151.484) [-1152.527] * (-1154.772) (-1153.825) [-1151.096] (-1150.712) -- 0:00:18
700000 -- (-1151.535) [-1158.173] (-1154.079) (-1152.264) * (-1152.787) (-1150.863) [-1151.183] (-1150.385) -- 0:00:18
Average standard deviation of split frequencies: 0.008701
700500 -- (-1150.420) (-1150.293) [-1151.313] (-1152.255) * [-1150.372] (-1150.825) (-1150.357) (-1154.192) -- 0:00:18
701000 -- (-1151.272) [-1151.646] (-1158.796) (-1150.146) * (-1158.171) [-1150.682] (-1153.438) (-1150.848) -- 0:00:18
701500 -- (-1150.805) (-1150.770) (-1157.466) [-1151.521] * (-1150.926) [-1150.740] (-1152.068) (-1150.936) -- 0:00:18
702000 -- [-1150.145] (-1151.361) (-1156.156) (-1153.532) * (-1154.901) [-1151.036] (-1151.141) (-1154.773) -- 0:00:18
702500 -- (-1150.544) [-1151.843] (-1154.017) (-1153.987) * [-1150.948] (-1153.524) (-1154.474) (-1152.474) -- 0:00:18
703000 -- (-1150.479) (-1151.360) [-1152.163] (-1155.282) * (-1154.182) (-1154.260) [-1151.164] (-1151.910) -- 0:00:18
703500 -- [-1150.601] (-1152.612) (-1151.784) (-1151.792) * (-1153.003) [-1153.173] (-1150.801) (-1152.856) -- 0:00:18
704000 -- (-1151.308) [-1153.700] (-1155.531) (-1156.053) * (-1151.667) [-1150.715] (-1150.804) (-1151.795) -- 0:00:18
704500 -- (-1158.965) (-1153.311) (-1151.975) [-1150.077] * (-1155.383) (-1151.771) (-1150.360) [-1152.053] -- 0:00:18
705000 -- (-1152.393) (-1151.937) [-1152.353] (-1149.993) * (-1152.582) [-1151.352] (-1150.387) (-1152.494) -- 0:00:18
Average standard deviation of split frequencies: 0.008369
705500 -- (-1152.266) (-1158.884) (-1154.217) [-1150.056] * [-1152.497] (-1151.947) (-1149.722) (-1160.724) -- 0:00:18
706000 -- (-1155.703) (-1152.175) [-1149.983] (-1153.010) * (-1151.374) [-1151.798] (-1151.521) (-1155.296) -- 0:00:18
706500 -- [-1151.875] (-1154.730) (-1151.719) (-1152.274) * (-1151.492) (-1151.353) (-1151.958) [-1151.394] -- 0:00:18
707000 -- [-1156.454] (-1150.610) (-1151.796) (-1153.353) * (-1151.436) [-1151.801] (-1154.272) (-1152.449) -- 0:00:18
707500 -- (-1154.963) [-1150.907] (-1152.403) (-1149.769) * (-1152.081) [-1151.907] (-1155.045) (-1154.513) -- 0:00:18
708000 -- (-1155.493) (-1152.200) (-1152.349) [-1150.226] * [-1150.185] (-1150.684) (-1153.724) (-1155.226) -- 0:00:18
708500 -- (-1155.924) (-1155.055) [-1150.466] (-1151.923) * (-1151.571) (-1152.509) [-1150.849] (-1155.415) -- 0:00:18
709000 -- (-1153.955) (-1154.743) [-1153.196] (-1151.781) * [-1151.557] (-1152.325) (-1152.089) (-1150.649) -- 0:00:18
709500 -- (-1151.864) (-1154.914) [-1150.768] (-1151.437) * (-1151.489) (-1151.994) [-1151.786] (-1152.862) -- 0:00:18
710000 -- [-1151.147] (-1152.501) (-1151.103) (-1153.129) * (-1152.669) (-1153.876) (-1152.215) [-1150.647] -- 0:00:17
Average standard deviation of split frequencies: 0.007562
710500 -- (-1151.200) [-1150.360] (-1153.996) (-1149.723) * (-1152.155) (-1154.938) (-1152.313) [-1151.467] -- 0:00:17
711000 -- (-1156.747) (-1153.146) (-1152.869) [-1151.716] * (-1152.251) [-1154.704] (-1157.251) (-1151.745) -- 0:00:17
711500 -- [-1155.347] (-1153.144) (-1152.208) (-1155.179) * (-1151.528) (-1152.654) [-1152.492] (-1156.257) -- 0:00:17
712000 -- (-1153.747) (-1154.699) (-1152.013) [-1152.189] * (-1156.932) (-1151.833) [-1152.043] (-1154.305) -- 0:00:17
712500 -- (-1151.489) [-1151.777] (-1154.897) (-1150.937) * (-1154.382) [-1150.304] (-1151.339) (-1151.237) -- 0:00:17
713000 -- (-1152.992) [-1152.777] (-1151.981) (-1153.859) * (-1151.648) (-1153.635) (-1150.666) [-1151.996] -- 0:00:17
713500 -- (-1150.613) (-1153.488) (-1151.934) [-1151.102] * (-1151.585) [-1152.359] (-1151.258) (-1153.417) -- 0:00:17
714000 -- (-1154.640) (-1155.477) (-1152.481) [-1152.244] * (-1154.837) [-1154.255] (-1151.583) (-1159.596) -- 0:00:17
714500 -- [-1158.338] (-1155.502) (-1152.450) (-1152.935) * (-1159.376) (-1150.960) [-1151.723] (-1155.402) -- 0:00:17
715000 -- [-1151.720] (-1155.164) (-1151.546) (-1153.416) * (-1157.224) [-1150.911] (-1151.497) (-1151.238) -- 0:00:17
Average standard deviation of split frequencies: 0.007681
715500 -- (-1152.613) (-1157.335) (-1153.037) [-1152.209] * (-1154.191) (-1151.993) (-1150.814) [-1151.257] -- 0:00:17
716000 -- (-1153.701) (-1150.074) (-1151.549) [-1151.890] * (-1153.048) [-1153.570] (-1151.065) (-1152.421) -- 0:00:17
716500 -- [-1151.229] (-1151.872) (-1150.049) (-1152.184) * (-1153.544) [-1151.041] (-1153.545) (-1151.618) -- 0:00:17
717000 -- (-1150.193) [-1153.340] (-1152.773) (-1153.175) * (-1150.335) (-1150.436) (-1151.311) [-1153.696] -- 0:00:17
717500 -- [-1150.153] (-1151.567) (-1150.121) (-1154.394) * (-1150.333) (-1153.528) (-1151.224) [-1150.730] -- 0:00:17
718000 -- (-1150.111) (-1155.019) [-1154.922] (-1152.122) * (-1151.473) [-1153.360] (-1155.210) (-1152.549) -- 0:00:17
718500 -- (-1152.492) (-1156.532) (-1152.599) [-1150.759] * (-1152.233) [-1151.614] (-1151.304) (-1150.604) -- 0:00:17
719000 -- [-1153.097] (-1153.824) (-1153.350) (-1150.177) * (-1152.074) (-1151.153) (-1152.410) [-1151.821] -- 0:00:17
719500 -- (-1152.652) (-1152.949) (-1151.347) [-1150.020] * [-1150.928] (-1151.089) (-1152.861) (-1157.427) -- 0:00:17
720000 -- (-1151.842) (-1151.627) [-1150.874] (-1150.767) * (-1154.111) (-1153.727) (-1153.786) [-1155.342] -- 0:00:17
Average standard deviation of split frequencies: 0.007457
720500 -- (-1156.938) (-1151.510) (-1151.394) [-1152.757] * (-1158.358) [-1151.857] (-1153.208) (-1153.114) -- 0:00:17
721000 -- (-1151.861) [-1152.433] (-1151.046) (-1154.168) * (-1152.700) (-1152.527) (-1154.324) [-1150.096] -- 0:00:17
721500 -- [-1151.597] (-1150.065) (-1151.926) (-1151.534) * [-1151.461] (-1154.229) (-1153.455) (-1150.229) -- 0:00:17
722000 -- (-1158.866) (-1153.006) [-1151.074] (-1151.743) * (-1152.642) (-1151.284) (-1153.056) [-1153.275] -- 0:00:17
722500 -- (-1154.248) (-1155.170) (-1150.781) [-1152.292] * (-1156.159) [-1151.485] (-1153.451) (-1152.214) -- 0:00:17
723000 -- (-1155.818) (-1150.936) [-1150.916] (-1151.407) * [-1150.852] (-1152.708) (-1153.857) (-1152.801) -- 0:00:17
723500 -- (-1153.119) (-1151.855) [-1151.237] (-1150.455) * [-1150.380] (-1151.936) (-1152.822) (-1153.038) -- 0:00:17
724000 -- [-1151.781] (-1150.689) (-1150.780) (-1155.410) * (-1153.840) [-1150.187] (-1151.939) (-1156.066) -- 0:00:17
724500 -- [-1149.978] (-1150.754) (-1150.478) (-1153.219) * (-1151.593) [-1150.350] (-1151.230) (-1150.778) -- 0:00:17
725000 -- (-1154.010) [-1151.345] (-1152.455) (-1152.989) * (-1150.681) [-1151.555] (-1150.972) (-1150.884) -- 0:00:17
Average standard deviation of split frequencies: 0.007467
725500 -- (-1155.924) (-1152.602) (-1149.862) [-1154.568] * [-1151.381] (-1153.033) (-1152.808) (-1151.737) -- 0:00:17
726000 -- (-1151.173) (-1152.775) (-1152.627) [-1154.486] * (-1152.881) (-1150.904) [-1151.808] (-1151.568) -- 0:00:16
726500 -- [-1151.241] (-1150.864) (-1150.999) (-1152.389) * (-1153.299) [-1153.093] (-1151.396) (-1156.218) -- 0:00:16
727000 -- (-1156.066) (-1152.350) (-1153.787) [-1150.624] * (-1152.146) [-1152.857] (-1151.495) (-1150.802) -- 0:00:16
727500 -- (-1151.319) (-1152.955) [-1151.710] (-1156.003) * [-1150.770] (-1150.738) (-1153.475) (-1152.372) -- 0:00:16
728000 -- [-1151.356] (-1151.568) (-1153.210) (-1150.134) * (-1153.639) (-1154.237) (-1150.779) [-1150.865] -- 0:00:16
728500 -- (-1151.078) [-1154.363] (-1151.309) (-1150.694) * (-1152.954) (-1151.021) [-1152.657] (-1150.903) -- 0:00:16
729000 -- (-1154.145) [-1151.339] (-1150.832) (-1151.800) * (-1152.028) [-1152.440] (-1155.390) (-1153.608) -- 0:00:16
729500 -- (-1152.331) [-1153.281] (-1151.286) (-1152.720) * [-1151.167] (-1152.711) (-1152.126) (-1151.587) -- 0:00:16
730000 -- (-1153.276) [-1152.760] (-1152.204) (-1152.203) * (-1150.679) (-1158.189) (-1151.964) [-1151.513] -- 0:00:16
Average standard deviation of split frequencies: 0.007218
730500 -- [-1154.156] (-1154.186) (-1163.214) (-1154.251) * (-1153.388) (-1154.448) [-1150.312] (-1155.445) -- 0:00:16
731000 -- [-1152.946] (-1157.007) (-1156.915) (-1155.376) * (-1153.339) (-1155.047) (-1152.393) [-1150.136] -- 0:00:16
731500 -- [-1151.587] (-1151.284) (-1154.293) (-1155.116) * [-1152.283] (-1153.708) (-1155.150) (-1159.061) -- 0:00:16
732000 -- [-1151.740] (-1150.742) (-1151.015) (-1155.932) * (-1151.422) (-1153.583) (-1150.832) [-1153.979] -- 0:00:16
732500 -- (-1150.243) (-1152.083) (-1150.470) [-1151.520] * (-1153.032) [-1153.246] (-1156.595) (-1154.049) -- 0:00:16
733000 -- (-1151.110) [-1151.856] (-1150.895) (-1152.799) * (-1153.804) (-1152.670) (-1150.351) [-1150.817] -- 0:00:16
733500 -- (-1152.529) (-1154.454) [-1150.554] (-1154.240) * (-1151.020) (-1155.772) [-1151.050] (-1150.165) -- 0:00:16
734000 -- (-1150.718) (-1151.929) (-1150.008) [-1150.993] * (-1151.677) [-1154.560] (-1153.067) (-1150.315) -- 0:00:16
734500 -- (-1150.144) (-1151.515) [-1151.267] (-1152.758) * (-1152.212) [-1152.228] (-1155.037) (-1154.799) -- 0:00:16
735000 -- [-1150.593] (-1151.188) (-1152.473) (-1152.942) * (-1152.113) [-1150.062] (-1150.107) (-1151.264) -- 0:00:16
Average standard deviation of split frequencies: 0.007005
735500 -- (-1150.798) (-1150.810) (-1150.504) [-1151.946] * (-1153.440) (-1151.076) (-1151.431) [-1151.435] -- 0:00:16
736000 -- (-1151.994) (-1154.029) [-1152.178] (-1151.673) * (-1151.970) [-1153.963] (-1152.256) (-1150.594) -- 0:00:16
736500 -- (-1151.802) (-1150.043) (-1154.443) [-1152.398] * (-1150.751) (-1151.000) (-1150.138) [-1151.660] -- 0:00:16
737000 -- (-1150.740) (-1153.970) [-1151.072] (-1151.217) * [-1152.377] (-1150.940) (-1152.302) (-1152.361) -- 0:00:16
737500 -- [-1151.912] (-1156.413) (-1150.736) (-1152.093) * (-1152.972) (-1154.615) (-1154.454) [-1150.063] -- 0:00:16
738000 -- (-1152.406) (-1153.236) (-1153.566) [-1153.644] * (-1152.767) [-1152.618] (-1150.613) (-1150.913) -- 0:00:16
738500 -- (-1151.410) (-1152.617) [-1151.977] (-1155.533) * [-1151.691] (-1151.876) (-1153.168) (-1150.773) -- 0:00:16
739000 -- (-1153.517) (-1150.729) [-1150.685] (-1153.173) * (-1154.160) [-1151.669] (-1151.625) (-1151.849) -- 0:00:16
739500 -- (-1151.036) (-1155.761) (-1152.259) [-1150.583] * (-1152.534) (-1154.842) (-1151.862) [-1150.479] -- 0:00:16
740000 -- [-1158.616] (-1151.619) (-1152.928) (-1151.289) * (-1152.151) (-1152.789) (-1155.786) [-1150.503] -- 0:00:16
Average standard deviation of split frequencies: 0.006563
740500 -- [-1151.922] (-1150.284) (-1151.351) (-1150.876) * (-1153.166) (-1151.646) [-1154.173] (-1156.032) -- 0:00:16
741000 -- (-1153.065) (-1150.624) (-1152.784) [-1154.103] * [-1151.444] (-1152.278) (-1151.599) (-1152.507) -- 0:00:16
741500 -- (-1151.469) [-1150.940] (-1152.271) (-1156.101) * (-1150.042) (-1150.963) (-1151.566) [-1150.409] -- 0:00:16
742000 -- (-1151.806) [-1152.211] (-1152.966) (-1150.613) * (-1150.173) (-1154.205) [-1150.979] (-1150.796) -- 0:00:15
742500 -- (-1150.679) [-1150.596] (-1153.651) (-1152.075) * (-1150.328) (-1150.630) [-1150.337] (-1156.405) -- 0:00:15
743000 -- [-1153.999] (-1156.120) (-1152.702) (-1152.735) * [-1151.496] (-1150.704) (-1150.837) (-1151.949) -- 0:00:15
743500 -- (-1153.105) (-1150.937) [-1152.002] (-1149.729) * (-1157.785) [-1151.116] (-1150.375) (-1150.866) -- 0:00:15
744000 -- (-1150.660) (-1150.905) (-1151.000) [-1151.936] * [-1153.145] (-1151.632) (-1158.038) (-1155.277) -- 0:00:15
744500 -- (-1153.802) (-1150.327) (-1151.271) [-1153.445] * [-1151.177] (-1152.416) (-1152.583) (-1153.928) -- 0:00:15
745000 -- (-1150.956) (-1151.965) [-1151.916] (-1153.988) * (-1150.444) (-1153.361) (-1151.030) [-1151.602] -- 0:00:15
Average standard deviation of split frequencies: 0.006675
745500 -- (-1152.546) (-1150.993) (-1150.642) [-1153.055] * (-1153.697) [-1151.330] (-1151.021) (-1150.897) -- 0:00:15
746000 -- (-1153.271) [-1153.056] (-1151.961) (-1150.937) * [-1150.251] (-1150.717) (-1152.290) (-1151.829) -- 0:00:15
746500 -- (-1153.693) (-1154.356) [-1151.797] (-1152.542) * (-1155.704) [-1151.071] (-1154.120) (-1150.481) -- 0:00:15
747000 -- (-1150.618) (-1151.637) [-1150.611] (-1152.460) * [-1150.488] (-1150.046) (-1153.390) (-1150.036) -- 0:00:15
747500 -- (-1153.529) (-1153.744) (-1151.160) [-1150.384] * (-1152.365) [-1150.867] (-1153.619) (-1151.859) -- 0:00:15
748000 -- [-1151.693] (-1151.929) (-1151.267) (-1150.221) * [-1151.223] (-1152.814) (-1151.513) (-1151.499) -- 0:00:15
748500 -- (-1153.316) (-1155.881) [-1153.625] (-1152.308) * (-1150.806) (-1153.126) [-1151.885] (-1152.197) -- 0:00:15
749000 -- (-1155.206) (-1157.230) (-1152.172) [-1150.062] * (-1155.038) (-1156.377) (-1153.031) [-1150.214] -- 0:00:15
749500 -- [-1152.791] (-1155.888) (-1153.544) (-1151.299) * (-1150.764) (-1154.169) (-1151.675) [-1152.200] -- 0:00:15
750000 -- [-1153.598] (-1152.868) (-1153.805) (-1152.047) * (-1150.169) (-1152.676) (-1150.953) [-1150.466] -- 0:00:15
Average standard deviation of split frequencies: 0.006633
750500 -- (-1158.060) [-1151.087] (-1150.888) (-1155.155) * (-1150.496) (-1152.060) (-1155.930) [-1156.304] -- 0:00:15
751000 -- [-1151.453] (-1152.406) (-1150.653) (-1153.101) * (-1152.414) (-1151.624) [-1150.437] (-1156.330) -- 0:00:15
751500 -- [-1150.281] (-1151.907) (-1153.101) (-1150.775) * (-1153.764) [-1151.569] (-1152.344) (-1150.797) -- 0:00:15
752000 -- (-1150.171) (-1152.301) [-1152.246] (-1151.667) * [-1153.441] (-1152.682) (-1152.231) (-1150.131) -- 0:00:15
752500 -- [-1151.601] (-1152.151) (-1151.204) (-1151.683) * [-1152.790] (-1154.284) (-1151.493) (-1153.851) -- 0:00:15
753000 -- (-1155.580) [-1150.572] (-1151.573) (-1151.065) * (-1154.935) [-1153.351] (-1153.160) (-1153.471) -- 0:00:15
753500 -- [-1150.600] (-1151.828) (-1152.670) (-1151.057) * (-1151.676) [-1156.184] (-1154.030) (-1152.150) -- 0:00:15
754000 -- (-1150.657) (-1152.109) (-1152.158) [-1153.689] * (-1151.803) (-1150.718) [-1150.722] (-1151.265) -- 0:00:15
754500 -- (-1151.310) [-1152.278] (-1156.390) (-1151.512) * (-1150.647) (-1153.336) [-1150.743] (-1151.991) -- 0:00:15
755000 -- (-1151.143) (-1152.476) [-1154.128] (-1150.263) * [-1153.339] (-1152.791) (-1158.197) (-1150.930) -- 0:00:15
Average standard deviation of split frequencies: 0.006508
755500 -- [-1155.810] (-1151.118) (-1150.844) (-1156.061) * (-1152.226) (-1150.618) (-1155.568) [-1152.431] -- 0:00:15
756000 -- (-1154.284) (-1151.152) [-1150.557] (-1152.064) * (-1154.494) [-1154.000] (-1153.184) (-1152.197) -- 0:00:15
756500 -- (-1151.142) (-1150.983) (-1152.753) [-1151.113] * [-1153.013] (-1151.971) (-1155.457) (-1152.728) -- 0:00:15
757000 -- (-1152.311) (-1153.936) [-1151.531] (-1150.556) * (-1153.863) [-1150.540] (-1152.932) (-1153.320) -- 0:00:15
757500 -- (-1151.322) (-1154.523) [-1150.297] (-1153.602) * (-1152.983) (-1151.182) (-1153.064) [-1152.560] -- 0:00:15
758000 -- (-1152.443) (-1153.630) [-1150.780] (-1153.727) * (-1151.843) [-1150.173] (-1152.464) (-1155.286) -- 0:00:15
758500 -- (-1152.952) [-1151.643] (-1152.964) (-1152.080) * (-1150.911) [-1150.125] (-1152.527) (-1154.101) -- 0:00:14
759000 -- (-1153.802) (-1150.324) (-1154.993) [-1151.047] * (-1150.862) (-1153.311) [-1154.915] (-1151.677) -- 0:00:14
759500 -- (-1157.451) (-1152.878) [-1152.741] (-1151.698) * [-1151.806] (-1152.897) (-1151.679) (-1151.570) -- 0:00:14
760000 -- (-1150.434) (-1150.884) (-1150.875) [-1154.042] * (-1151.951) [-1151.233] (-1154.018) (-1150.589) -- 0:00:14
Average standard deviation of split frequencies: 0.006856
760500 -- (-1150.544) (-1150.624) (-1150.644) [-1152.784] * [-1152.761] (-1157.607) (-1152.161) (-1150.333) -- 0:00:14
761000 -- (-1150.415) [-1153.358] (-1153.387) (-1152.065) * (-1153.069) (-1155.432) (-1151.949) [-1150.409] -- 0:00:14
761500 -- (-1151.525) (-1155.209) [-1152.870] (-1150.844) * (-1151.500) (-1154.483) (-1153.700) [-1152.004] -- 0:00:14
762000 -- (-1150.677) (-1154.100) [-1152.150] (-1152.213) * (-1152.009) (-1154.501) (-1153.726) [-1151.920] -- 0:00:14
762500 -- (-1152.170) (-1152.016) [-1156.001] (-1155.075) * (-1152.786) (-1151.659) [-1154.204] (-1153.440) -- 0:00:14
763000 -- (-1156.088) (-1153.345) (-1154.471) [-1157.307] * (-1154.569) [-1151.471] (-1150.482) (-1151.170) -- 0:00:14
763500 -- [-1153.987] (-1156.659) (-1153.328) (-1152.836) * (-1155.966) (-1152.893) (-1150.894) [-1151.072] -- 0:00:14
764000 -- (-1153.335) (-1150.877) (-1153.148) [-1152.241] * (-1152.681) (-1153.363) [-1150.581] (-1152.113) -- 0:00:14
764500 -- (-1156.112) (-1151.169) [-1152.602] (-1155.453) * (-1152.036) (-1151.402) (-1151.862) [-1152.271] -- 0:00:14
765000 -- [-1153.941] (-1151.237) (-1150.682) (-1157.876) * (-1151.832) (-1150.857) (-1152.289) [-1152.128] -- 0:00:14
Average standard deviation of split frequencies: 0.006231
765500 -- [-1152.647] (-1150.857) (-1150.817) (-1150.913) * (-1152.508) [-1150.573] (-1150.307) (-1152.803) -- 0:00:14
766000 -- (-1153.642) (-1151.284) [-1151.119] (-1150.949) * (-1151.271) (-1152.701) (-1150.332) [-1150.920] -- 0:00:14
766500 -- [-1151.354] (-1151.730) (-1152.245) (-1151.716) * (-1152.255) (-1156.866) (-1154.018) [-1152.545] -- 0:00:14
767000 -- (-1153.379) (-1155.396) (-1152.526) [-1150.526] * (-1150.313) [-1155.183] (-1153.583) (-1153.737) -- 0:00:14
767500 -- [-1154.799] (-1153.535) (-1151.714) (-1150.461) * (-1150.146) [-1150.072] (-1150.981) (-1150.565) -- 0:00:14
768000 -- (-1151.265) (-1153.874) (-1154.446) [-1151.907] * (-1150.507) (-1151.521) (-1150.932) [-1153.167] -- 0:00:14
768500 -- (-1153.760) [-1153.833] (-1153.946) (-1154.531) * (-1152.396) (-1150.670) [-1150.951] (-1153.185) -- 0:00:14
769000 -- [-1151.493] (-1154.198) (-1153.706) (-1152.901) * (-1150.827) [-1153.689] (-1152.472) (-1150.681) -- 0:00:14
769500 -- [-1151.105] (-1152.026) (-1152.868) (-1151.217) * (-1151.536) (-1152.638) (-1151.463) [-1151.639] -- 0:00:14
770000 -- (-1152.873) [-1153.772] (-1151.699) (-1151.169) * (-1152.478) (-1154.159) [-1151.200] (-1150.866) -- 0:00:14
Average standard deviation of split frequencies: 0.006117
770500 -- (-1150.768) (-1152.138) [-1152.948] (-1152.316) * (-1152.839) [-1156.727] (-1152.410) (-1150.221) -- 0:00:14
771000 -- (-1151.755) [-1153.433] (-1153.217) (-1151.781) * [-1151.502] (-1156.331) (-1151.126) (-1152.450) -- 0:00:14
771500 -- (-1152.198) [-1151.228] (-1151.210) (-1151.315) * (-1150.925) (-1151.866) (-1150.974) [-1152.900] -- 0:00:14
772000 -- [-1152.819] (-1151.079) (-1151.150) (-1156.517) * (-1150.817) [-1150.795] (-1157.079) (-1151.163) -- 0:00:14
772500 -- (-1151.235) [-1151.374] (-1155.175) (-1160.720) * (-1153.465) (-1152.505) (-1155.731) [-1150.127] -- 0:00:14
773000 -- [-1150.774] (-1151.044) (-1154.448) (-1153.923) * (-1151.662) (-1150.543) (-1151.044) [-1150.255] -- 0:00:14
773500 -- (-1153.215) (-1153.901) (-1154.989) [-1152.613] * [-1153.141] (-1155.248) (-1151.858) (-1152.081) -- 0:00:14
774000 -- (-1155.004) [-1151.317] (-1152.977) (-1164.483) * (-1153.706) (-1150.326) (-1155.601) [-1151.193] -- 0:00:14
774500 -- [-1153.559] (-1150.342) (-1153.670) (-1151.656) * (-1151.944) [-1152.707] (-1150.618) (-1151.771) -- 0:00:13
775000 -- (-1154.702) (-1152.107) [-1150.078] (-1151.134) * (-1153.966) (-1150.805) (-1151.866) [-1152.423] -- 0:00:13
Average standard deviation of split frequencies: 0.006492
775500 -- (-1151.689) [-1153.249] (-1149.944) (-1152.852) * (-1152.075) (-1152.630) [-1152.753] (-1151.916) -- 0:00:13
776000 -- (-1156.163) (-1150.866) (-1156.544) [-1150.537] * (-1152.307) (-1153.022) (-1154.283) [-1152.118] -- 0:00:13
776500 -- (-1151.429) (-1152.656) [-1153.035] (-1150.807) * (-1154.632) [-1152.288] (-1152.953) (-1152.052) -- 0:00:13
777000 -- (-1151.075) (-1152.232) [-1153.479] (-1151.057) * (-1155.220) [-1150.315] (-1155.243) (-1154.880) -- 0:00:13
777500 -- (-1151.494) [-1152.568] (-1153.488) (-1153.783) * [-1151.569] (-1153.398) (-1156.695) (-1151.645) -- 0:00:13
778000 -- [-1151.931] (-1153.342) (-1151.605) (-1155.675) * (-1151.302) [-1155.457] (-1153.806) (-1150.268) -- 0:00:13
778500 -- (-1150.658) (-1153.809) [-1151.071] (-1154.263) * (-1154.190) (-1156.105) (-1152.697) [-1153.690] -- 0:00:13
779000 -- (-1150.658) [-1152.763] (-1151.207) (-1153.813) * [-1152.668] (-1154.731) (-1152.397) (-1151.447) -- 0:00:13
779500 -- (-1149.766) (-1151.021) (-1154.353) [-1150.592] * (-1153.663) [-1151.558] (-1151.562) (-1151.310) -- 0:00:13
780000 -- (-1150.323) [-1150.506] (-1153.538) (-1152.755) * (-1150.793) (-1159.311) [-1150.949] (-1151.103) -- 0:00:13
Average standard deviation of split frequencies: 0.006718
780500 -- (-1153.568) [-1150.733] (-1153.654) (-1152.983) * (-1150.464) [-1150.995] (-1153.554) (-1150.500) -- 0:00:13
781000 -- (-1150.616) (-1154.822) (-1150.434) [-1152.261] * [-1150.894] (-1151.405) (-1152.007) (-1150.856) -- 0:00:13
781500 -- [-1152.568] (-1151.688) (-1153.695) (-1153.360) * [-1151.085] (-1150.504) (-1152.302) (-1151.896) -- 0:00:13
782000 -- (-1152.694) [-1150.432] (-1156.010) (-1154.206) * (-1150.232) (-1151.582) (-1151.015) [-1153.240] -- 0:00:13
782500 -- (-1151.234) [-1150.262] (-1156.541) (-1152.685) * (-1150.929) (-1151.582) [-1151.186] (-1152.966) -- 0:00:13
783000 -- [-1152.081] (-1149.995) (-1156.941) (-1151.531) * (-1152.190) [-1152.648] (-1150.829) (-1150.161) -- 0:00:13
783500 -- (-1152.131) (-1150.794) (-1150.922) [-1156.633] * (-1156.340) (-1152.166) [-1151.679] (-1152.423) -- 0:00:13
784000 -- (-1156.230) (-1151.379) [-1153.843] (-1158.335) * (-1156.980) (-1153.572) [-1152.893] (-1153.365) -- 0:00:13
784500 -- (-1156.383) (-1154.633) (-1154.333) [-1151.741] * (-1152.063) [-1155.028] (-1152.794) (-1151.619) -- 0:00:13
785000 -- (-1150.941) [-1152.691] (-1153.798) (-1153.128) * [-1151.793] (-1152.604) (-1150.562) (-1156.744) -- 0:00:13
Average standard deviation of split frequencies: 0.006297
785500 -- (-1151.799) [-1153.427] (-1152.841) (-1151.501) * [-1150.967] (-1154.133) (-1155.856) (-1156.352) -- 0:00:13
786000 -- (-1151.049) [-1151.552] (-1157.687) (-1151.483) * (-1152.957) (-1153.788) (-1156.551) [-1152.115] -- 0:00:13
786500 -- (-1152.857) (-1152.862) [-1154.315] (-1154.866) * (-1151.204) (-1150.783) [-1150.673] (-1153.329) -- 0:00:13
787000 -- (-1151.901) (-1152.272) [-1151.959] (-1152.557) * (-1152.721) (-1152.668) [-1150.696] (-1149.914) -- 0:00:13
787500 -- [-1150.952] (-1151.860) (-1151.592) (-1155.084) * [-1152.664] (-1153.142) (-1152.716) (-1150.047) -- 0:00:13
788000 -- (-1155.123) (-1153.008) [-1151.035] (-1155.506) * (-1154.276) (-1152.757) [-1151.487] (-1151.761) -- 0:00:13
788500 -- (-1155.039) (-1154.594) [-1150.194] (-1153.465) * (-1151.808) (-1150.405) [-1151.622] (-1151.176) -- 0:00:13
789000 -- [-1151.188] (-1152.526) (-1151.783) (-1151.247) * (-1152.744) [-1151.778] (-1152.141) (-1153.901) -- 0:00:13
789500 -- (-1150.609) (-1151.405) (-1154.777) [-1152.381] * (-1158.525) (-1153.989) [-1151.696] (-1151.799) -- 0:00:13
790000 -- [-1151.350] (-1151.320) (-1154.698) (-1151.421) * [-1151.972] (-1151.883) (-1152.637) (-1155.941) -- 0:00:13
Average standard deviation of split frequencies: 0.006717
790500 -- [-1152.988] (-1153.805) (-1153.066) (-1154.032) * (-1151.908) [-1150.418] (-1153.331) (-1154.076) -- 0:00:12
791000 -- (-1152.637) [-1153.964] (-1153.431) (-1153.707) * (-1152.398) [-1153.685] (-1150.720) (-1156.479) -- 0:00:12
791500 -- (-1150.147) (-1151.890) (-1152.514) [-1151.211] * (-1151.004) (-1152.533) (-1150.668) [-1155.478] -- 0:00:12
792000 -- [-1151.224] (-1151.249) (-1154.606) (-1153.138) * (-1152.368) (-1151.418) (-1151.841) [-1151.167] -- 0:00:12
792500 -- (-1151.008) (-1153.052) [-1150.001] (-1152.042) * (-1151.538) (-1158.325) (-1150.090) [-1149.861] -- 0:00:12
793000 -- [-1152.305] (-1150.422) (-1152.464) (-1151.211) * (-1152.007) (-1156.105) [-1150.110] (-1151.214) -- 0:00:12
793500 -- (-1153.737) [-1151.167] (-1152.019) (-1152.736) * (-1150.744) (-1154.821) (-1151.551) [-1151.207] -- 0:00:12
794000 -- (-1155.188) (-1153.426) (-1153.277) [-1153.888] * (-1151.199) (-1153.170) [-1153.861] (-1151.922) -- 0:00:12
794500 -- (-1152.645) [-1155.069] (-1152.302) (-1157.264) * (-1154.148) (-1156.358) (-1153.180) [-1150.684] -- 0:00:12
795000 -- (-1152.162) (-1151.797) [-1152.763] (-1157.678) * [-1159.393] (-1160.320) (-1153.918) (-1152.077) -- 0:00:12
Average standard deviation of split frequencies: 0.006870
795500 -- (-1156.626) [-1152.531] (-1154.534) (-1150.733) * (-1150.961) (-1154.304) (-1151.851) [-1150.285] -- 0:00:12
796000 -- [-1150.972] (-1153.133) (-1153.966) (-1150.733) * (-1150.991) [-1150.524] (-1153.198) (-1152.036) -- 0:00:12
796500 -- [-1151.482] (-1151.051) (-1155.042) (-1151.715) * (-1152.514) [-1151.795] (-1150.934) (-1151.627) -- 0:00:12
797000 -- (-1154.749) (-1159.229) [-1151.887] (-1151.165) * (-1153.044) (-1150.086) [-1150.668] (-1151.560) -- 0:00:12
797500 -- (-1153.375) (-1151.982) (-1153.257) [-1151.824] * (-1151.900) [-1150.517] (-1150.913) (-1153.031) -- 0:00:12
798000 -- (-1150.779) [-1151.614] (-1151.067) (-1154.793) * (-1153.390) (-1150.381) (-1152.889) [-1150.421] -- 0:00:12
798500 -- (-1150.416) (-1151.191) (-1152.327) [-1151.451] * (-1153.924) (-1151.451) [-1151.071] (-1153.743) -- 0:00:12
799000 -- (-1150.590) (-1151.124) [-1152.926] (-1150.327) * (-1152.100) (-1150.841) (-1151.109) [-1154.049] -- 0:00:12
799500 -- (-1150.616) [-1150.169] (-1150.648) (-1150.375) * (-1151.015) (-1153.463) (-1152.478) [-1152.210] -- 0:00:12
800000 -- (-1152.742) [-1152.146] (-1153.321) (-1150.641) * (-1150.366) [-1151.875] (-1153.298) (-1152.159) -- 0:00:12
Average standard deviation of split frequencies: 0.007261
800500 -- (-1151.061) [-1151.054] (-1153.488) (-1151.339) * (-1150.282) (-1153.061) (-1150.791) [-1149.960] -- 0:00:12
801000 -- (-1151.729) [-1155.775] (-1152.148) (-1152.273) * [-1153.011] (-1157.979) (-1150.792) (-1159.032) -- 0:00:12
801500 -- [-1150.657] (-1153.694) (-1153.775) (-1152.278) * (-1154.314) (-1153.646) (-1152.080) [-1153.367] -- 0:00:12
802000 -- [-1150.290] (-1152.197) (-1150.967) (-1152.476) * (-1153.423) [-1154.890] (-1152.307) (-1151.789) -- 0:00:12
802500 -- (-1150.277) [-1151.939] (-1151.579) (-1151.616) * [-1154.857] (-1154.504) (-1151.476) (-1150.262) -- 0:00:12
803000 -- [-1151.436] (-1158.544) (-1150.174) (-1151.651) * (-1151.588) (-1152.498) (-1150.797) [-1152.737] -- 0:00:12
803500 -- (-1153.246) [-1150.394] (-1152.802) (-1151.189) * (-1152.188) (-1154.671) (-1150.850) [-1152.938] -- 0:00:12
804000 -- (-1152.846) (-1152.307) [-1151.545] (-1150.274) * (-1152.090) [-1151.774] (-1151.940) (-1154.116) -- 0:00:12
804500 -- (-1153.361) (-1152.573) (-1153.649) [-1151.762] * [-1153.223] (-1151.961) (-1150.512) (-1153.428) -- 0:00:12
805000 -- [-1151.756] (-1151.838) (-1153.065) (-1154.275) * (-1154.743) (-1151.368) [-1150.971] (-1151.436) -- 0:00:12
Average standard deviation of split frequencies: 0.007055
805500 -- (-1151.430) (-1152.067) (-1150.502) [-1152.291] * (-1153.940) (-1154.111) [-1150.575] (-1151.633) -- 0:00:12
806000 -- (-1151.921) [-1150.941] (-1152.967) (-1152.375) * (-1156.966) (-1150.559) [-1152.113] (-1152.554) -- 0:00:12
806500 -- [-1154.644] (-1151.968) (-1152.820) (-1150.586) * [-1152.957] (-1151.866) (-1155.268) (-1154.306) -- 0:00:11
807000 -- (-1151.742) [-1153.427] (-1151.456) (-1151.238) * (-1155.548) (-1151.242) [-1150.487] (-1154.666) -- 0:00:11
807500 -- [-1151.155] (-1152.258) (-1152.100) (-1153.555) * (-1154.711) (-1151.452) [-1150.366] (-1154.054) -- 0:00:11
808000 -- [-1151.834] (-1152.955) (-1153.236) (-1156.781) * (-1150.749) [-1153.373] (-1154.061) (-1152.238) -- 0:00:11
808500 -- (-1150.587) [-1152.288] (-1153.386) (-1150.948) * (-1150.839) [-1154.086] (-1151.927) (-1154.919) -- 0:00:11
809000 -- [-1151.018] (-1153.094) (-1151.694) (-1153.167) * [-1152.485] (-1154.248) (-1156.657) (-1152.514) -- 0:00:11
809500 -- (-1152.856) (-1154.352) [-1153.905] (-1156.616) * [-1151.847] (-1152.006) (-1153.075) (-1154.275) -- 0:00:11
810000 -- (-1150.217) (-1157.182) [-1152.286] (-1152.183) * (-1153.952) [-1153.071] (-1154.247) (-1154.706) -- 0:00:11
Average standard deviation of split frequencies: 0.007269
810500 -- [-1150.716] (-1152.182) (-1150.679) (-1153.806) * (-1153.651) (-1154.407) (-1154.903) [-1152.704] -- 0:00:11
811000 -- (-1150.484) (-1152.938) [-1149.949] (-1150.852) * (-1153.844) [-1153.164] (-1151.121) (-1150.671) -- 0:00:11
811500 -- (-1152.365) [-1151.263] (-1151.616) (-1152.860) * (-1153.061) (-1152.446) [-1150.006] (-1154.204) -- 0:00:11
812000 -- (-1152.399) (-1151.239) [-1150.411] (-1153.921) * (-1153.382) (-1152.519) [-1152.416] (-1152.447) -- 0:00:11
812500 -- (-1152.291) [-1151.235] (-1150.423) (-1155.023) * (-1151.201) (-1155.311) (-1152.609) [-1152.027] -- 0:00:11
813000 -- (-1150.904) (-1152.562) [-1150.210] (-1151.282) * [-1151.978] (-1153.134) (-1151.040) (-1153.856) -- 0:00:11
813500 -- (-1152.031) [-1150.079] (-1152.041) (-1155.652) * (-1152.765) (-1152.767) [-1151.309] (-1151.545) -- 0:00:11
814000 -- [-1152.986] (-1150.612) (-1153.272) (-1151.762) * (-1156.600) [-1153.472] (-1151.927) (-1150.739) -- 0:00:11
814500 -- (-1152.570) (-1152.109) [-1154.411] (-1150.954) * (-1156.485) (-1152.915) [-1150.326] (-1152.239) -- 0:00:11
815000 -- (-1151.538) (-1150.296) [-1154.464] (-1152.647) * (-1155.776) (-1157.144) [-1151.095] (-1152.520) -- 0:00:11
Average standard deviation of split frequencies: 0.007952
815500 -- (-1151.888) (-1150.000) (-1152.111) [-1151.513] * (-1158.508) (-1155.682) [-1152.208] (-1154.662) -- 0:00:11
816000 -- (-1157.435) [-1150.230] (-1154.206) (-1150.094) * [-1154.372] (-1151.418) (-1151.266) (-1151.015) -- 0:00:11
816500 -- (-1153.742) (-1153.698) [-1152.377] (-1150.566) * (-1155.292) (-1149.751) [-1151.455] (-1151.877) -- 0:00:11
817000 -- (-1152.311) [-1154.265] (-1150.188) (-1152.139) * (-1151.138) (-1150.409) [-1154.800] (-1152.891) -- 0:00:11
817500 -- (-1151.552) [-1149.908] (-1151.063) (-1153.315) * (-1151.921) [-1151.308] (-1156.782) (-1150.988) -- 0:00:11
818000 -- (-1150.414) [-1150.457] (-1153.075) (-1153.282) * (-1150.812) (-1152.744) (-1152.058) [-1155.218] -- 0:00:11
818500 -- [-1151.612] (-1156.658) (-1152.988) (-1152.369) * (-1151.068) (-1150.793) (-1151.067) [-1150.811] -- 0:00:11
819000 -- [-1150.729] (-1155.978) (-1152.327) (-1150.327) * (-1153.067) (-1151.653) [-1151.868] (-1152.384) -- 0:00:11
819500 -- [-1150.333] (-1154.553) (-1152.040) (-1150.377) * (-1151.204) [-1151.327] (-1150.302) (-1156.155) -- 0:00:11
820000 -- (-1153.329) [-1151.745] (-1152.438) (-1154.076) * (-1151.270) (-1153.064) [-1154.555] (-1153.164) -- 0:00:11
Average standard deviation of split frequencies: 0.007738
820500 -- (-1150.649) (-1152.771) (-1152.842) [-1153.283] * (-1151.331) [-1152.440] (-1151.240) (-1151.887) -- 0:00:11
821000 -- [-1154.062] (-1154.455) (-1152.403) (-1156.003) * (-1151.569) (-1151.645) [-1151.131] (-1151.587) -- 0:00:11
821500 -- (-1154.823) (-1154.728) (-1151.492) [-1151.437] * (-1151.744) (-1153.599) (-1152.137) [-1151.842] -- 0:00:11
822000 -- (-1151.573) (-1152.419) [-1150.144] (-1152.627) * [-1150.425] (-1152.020) (-1157.100) (-1152.502) -- 0:00:11
822500 -- (-1153.126) (-1152.385) [-1152.228] (-1149.961) * (-1155.237) (-1152.209) [-1152.849] (-1150.926) -- 0:00:11
823000 -- (-1152.089) (-1151.142) [-1150.555] (-1151.533) * [-1151.494] (-1151.561) (-1154.420) (-1152.219) -- 0:00:10
823500 -- (-1150.138) (-1151.587) (-1151.167) [-1150.261] * (-1152.272) (-1150.525) [-1152.738] (-1152.857) -- 0:00:10
824000 -- (-1155.758) [-1150.866] (-1153.151) (-1149.832) * (-1152.405) (-1155.845) [-1152.736] (-1151.605) -- 0:00:10
824500 -- (-1151.920) (-1151.847) (-1150.947) [-1150.859] * (-1153.624) [-1155.423] (-1151.471) (-1152.187) -- 0:00:10
825000 -- (-1151.638) (-1155.298) (-1151.321) [-1150.477] * (-1154.577) (-1153.302) (-1151.994) [-1150.179] -- 0:00:10
Average standard deviation of split frequencies: 0.008023
825500 -- (-1153.389) [-1151.800] (-1152.706) (-1152.027) * (-1152.198) [-1152.452] (-1151.603) (-1150.287) -- 0:00:10
826000 -- (-1151.021) (-1154.031) [-1152.536] (-1152.050) * (-1152.082) (-1154.299) [-1150.679] (-1153.027) -- 0:00:10
826500 -- (-1152.659) [-1150.342] (-1151.623) (-1153.882) * (-1159.172) [-1150.957] (-1150.692) (-1154.392) -- 0:00:10
827000 -- (-1152.081) (-1151.192) [-1151.891] (-1154.602) * (-1153.131) (-1152.672) [-1151.259] (-1151.591) -- 0:00:10
827500 -- (-1150.652) (-1151.440) (-1152.267) [-1152.095] * (-1150.044) (-1152.077) [-1153.409] (-1151.984) -- 0:00:10
828000 -- [-1151.553] (-1151.273) (-1151.004) (-1156.394) * (-1150.216) (-1155.701) (-1151.270) [-1151.243] -- 0:00:10
828500 -- (-1150.927) (-1152.940) [-1151.177] (-1153.922) * (-1154.581) [-1155.094] (-1153.397) (-1152.246) -- 0:00:10
829000 -- (-1152.363) (-1150.150) (-1150.859) [-1152.559] * (-1153.085) (-1151.219) (-1151.797) [-1150.092] -- 0:00:10
829500 -- (-1152.283) (-1150.413) [-1151.077] (-1153.088) * (-1152.561) (-1152.928) [-1152.239] (-1151.166) -- 0:00:10
830000 -- [-1153.626] (-1151.825) (-1155.223) (-1155.478) * (-1152.053) (-1151.015) [-1150.060] (-1152.816) -- 0:00:10
Average standard deviation of split frequencies: 0.008179
830500 -- (-1154.096) (-1154.159) (-1151.806) [-1150.424] * (-1151.575) [-1153.034] (-1151.091) (-1152.741) -- 0:00:10
831000 -- (-1153.546) (-1153.820) (-1152.951) [-1150.825] * (-1158.969) [-1151.022] (-1150.218) (-1153.622) -- 0:00:10
831500 -- [-1151.789] (-1158.814) (-1152.050) (-1151.452) * (-1153.000) (-1152.108) (-1151.279) [-1154.932] -- 0:00:10
832000 -- (-1152.859) (-1152.855) [-1150.913] (-1152.466) * (-1152.150) [-1154.724] (-1154.929) (-1156.012) -- 0:00:10
832500 -- (-1153.929) [-1151.831] (-1152.444) (-1152.082) * (-1151.375) [-1151.113] (-1150.407) (-1154.791) -- 0:00:10
833000 -- (-1152.261) (-1150.979) [-1153.493] (-1153.115) * (-1151.734) (-1151.292) [-1152.835] (-1154.845) -- 0:00:10
833500 -- (-1155.791) [-1150.180] (-1154.312) (-1154.589) * (-1152.104) (-1154.739) (-1153.784) [-1155.092] -- 0:00:10
834000 -- (-1154.148) (-1152.303) [-1152.715] (-1154.359) * (-1151.615) (-1154.483) [-1152.569] (-1153.231) -- 0:00:10
834500 -- (-1155.309) (-1150.784) [-1153.633] (-1154.246) * (-1150.835) [-1151.358] (-1152.419) (-1152.347) -- 0:00:10
835000 -- (-1155.144) [-1151.201] (-1157.403) (-1151.302) * (-1153.009) (-1150.593) [-1157.972] (-1152.593) -- 0:00:10
Average standard deviation of split frequencies: 0.007529
835500 -- [-1152.773] (-1150.700) (-1150.729) (-1152.916) * [-1152.397] (-1150.421) (-1151.240) (-1151.753) -- 0:00:10
836000 -- [-1153.128] (-1150.520) (-1152.351) (-1153.250) * [-1150.091] (-1150.830) (-1150.441) (-1151.587) -- 0:00:10
836500 -- (-1152.669) (-1151.637) (-1151.489) [-1151.411] * (-1152.493) (-1152.188) (-1153.401) [-1156.955] -- 0:00:10
837000 -- (-1153.255) (-1152.077) [-1153.593] (-1151.547) * [-1152.834] (-1153.109) (-1150.981) (-1155.776) -- 0:00:10
837500 -- (-1152.773) (-1151.772) (-1152.544) [-1150.383] * (-1150.592) (-1154.462) (-1152.869) [-1157.545] -- 0:00:10
838000 -- (-1150.590) (-1151.469) (-1151.772) [-1150.904] * (-1151.767) (-1152.224) (-1152.030) [-1153.023] -- 0:00:10
838500 -- (-1151.893) (-1149.994) (-1152.221) [-1153.756] * (-1153.219) (-1153.330) [-1149.918] (-1151.617) -- 0:00:10
839000 -- [-1150.904] (-1151.142) (-1154.289) (-1151.305) * [-1153.568] (-1156.133) (-1151.854) (-1150.168) -- 0:00:09
839500 -- (-1153.734) (-1153.812) [-1151.283] (-1151.238) * [-1153.448] (-1151.283) (-1156.999) (-1151.443) -- 0:00:09
840000 -- (-1153.856) [-1152.629] (-1151.764) (-1153.074) * (-1150.615) (-1153.114) [-1150.447] (-1154.021) -- 0:00:09
Average standard deviation of split frequencies: 0.007150
840500 -- (-1152.507) (-1150.766) (-1151.374) [-1151.287] * [-1152.448] (-1151.192) (-1152.899) (-1154.338) -- 0:00:09
841000 -- (-1152.265) (-1151.864) (-1153.362) [-1154.209] * (-1153.511) (-1151.505) [-1152.459] (-1153.615) -- 0:00:09
841500 -- [-1152.441] (-1150.839) (-1152.592) (-1153.030) * (-1150.501) [-1155.006] (-1153.097) (-1150.536) -- 0:00:09
842000 -- [-1152.625] (-1151.869) (-1153.651) (-1153.288) * [-1150.339] (-1152.114) (-1155.041) (-1152.027) -- 0:00:09
842500 -- (-1151.253) [-1152.513] (-1153.399) (-1152.282) * (-1152.689) (-1152.342) [-1152.745] (-1154.524) -- 0:00:09
843000 -- [-1154.672] (-1152.674) (-1158.823) (-1151.900) * (-1152.708) (-1152.156) (-1153.426) [-1153.109] -- 0:00:09
843500 -- [-1151.908] (-1151.660) (-1155.469) (-1151.697) * (-1150.663) (-1155.814) (-1153.731) [-1154.926] -- 0:00:09
844000 -- (-1151.011) [-1154.305] (-1150.599) (-1156.444) * (-1152.373) (-1156.549) (-1152.739) [-1154.659] -- 0:00:09
844500 -- (-1151.109) (-1151.865) [-1151.291] (-1154.372) * (-1156.636) [-1152.271] (-1153.075) (-1150.309) -- 0:00:09
845000 -- [-1152.056] (-1151.801) (-1152.385) (-1151.413) * [-1151.454] (-1151.463) (-1152.285) (-1153.709) -- 0:00:09
Average standard deviation of split frequencies: 0.007430
845500 -- (-1151.613) (-1152.571) [-1151.378] (-1151.712) * (-1152.504) [-1151.195] (-1159.254) (-1152.130) -- 0:00:09
846000 -- (-1151.667) (-1151.662) [-1152.975] (-1154.343) * (-1151.995) (-1152.719) [-1151.392] (-1151.256) -- 0:00:09
846500 -- [-1152.617] (-1153.617) (-1152.118) (-1156.843) * [-1153.377] (-1152.824) (-1151.607) (-1151.401) -- 0:00:09
847000 -- (-1152.845) (-1153.912) (-1150.792) [-1150.535] * (-1152.663) (-1152.387) (-1151.848) [-1151.665] -- 0:00:09
847500 -- (-1151.158) [-1156.417] (-1151.766) (-1151.984) * (-1155.969) (-1150.918) (-1151.719) [-1153.295] -- 0:00:09
848000 -- (-1153.696) (-1157.062) (-1151.696) [-1152.314] * [-1151.294] (-1152.558) (-1152.855) (-1152.922) -- 0:00:09
848500 -- (-1150.287) [-1151.467] (-1153.307) (-1153.590) * (-1151.144) [-1151.800] (-1152.658) (-1153.156) -- 0:00:09
849000 -- (-1151.708) (-1153.612) (-1154.691) [-1151.207] * (-1150.514) (-1152.160) [-1152.561] (-1149.977) -- 0:00:09
849500 -- (-1150.975) [-1151.174] (-1156.502) (-1153.991) * (-1153.699) (-1152.938) (-1149.908) [-1152.432] -- 0:00:09
850000 -- (-1149.958) (-1150.729) [-1151.946] (-1151.427) * (-1157.433) (-1150.851) (-1151.822) [-1151.719] -- 0:00:09
Average standard deviation of split frequencies: 0.007789
850500 -- (-1153.871) (-1151.215) [-1153.821] (-1158.849) * (-1151.749) [-1150.441] (-1153.345) (-1150.749) -- 0:00:09
851000 -- [-1152.524] (-1152.519) (-1153.374) (-1155.366) * (-1151.048) (-1150.980) [-1152.172] (-1152.460) -- 0:00:09
851500 -- (-1152.531) (-1151.348) [-1153.594] (-1154.291) * [-1152.514] (-1153.306) (-1150.747) (-1151.098) -- 0:00:09
852000 -- (-1152.006) (-1151.135) [-1150.914] (-1153.431) * (-1151.889) (-1153.838) [-1152.124] (-1155.247) -- 0:00:09
852500 -- (-1153.432) (-1153.139) [-1152.387] (-1158.274) * (-1150.720) [-1151.665] (-1151.151) (-1156.630) -- 0:00:09
853000 -- (-1151.081) (-1153.600) [-1153.300] (-1156.963) * (-1151.835) [-1153.523] (-1152.748) (-1152.637) -- 0:00:09
853500 -- (-1152.712) [-1153.282] (-1152.994) (-1153.552) * (-1154.086) (-1152.774) (-1152.948) [-1152.147] -- 0:00:09
854000 -- (-1151.239) (-1151.779) (-1152.249) [-1152.545] * [-1152.327] (-1153.092) (-1152.506) (-1151.104) -- 0:00:09
854500 -- (-1152.042) (-1152.263) [-1152.733] (-1154.957) * (-1150.847) (-1150.911) [-1152.674] (-1152.785) -- 0:00:09
855000 -- (-1153.658) (-1151.936) [-1153.316] (-1150.959) * [-1153.261] (-1151.681) (-1158.795) (-1150.457) -- 0:00:08
Average standard deviation of split frequencies: 0.007744
855500 -- [-1150.212] (-1151.426) (-1151.690) (-1152.243) * (-1153.442) (-1150.631) (-1158.792) [-1150.186] -- 0:00:08
856000 -- (-1152.247) [-1151.226] (-1151.739) (-1152.879) * (-1150.708) [-1151.814] (-1151.134) (-1158.363) -- 0:00:08
856500 -- [-1152.738] (-1152.923) (-1154.114) (-1152.184) * (-1151.803) (-1150.114) [-1150.419] (-1153.096) -- 0:00:08
857000 -- (-1157.227) (-1153.993) (-1152.179) [-1150.878] * (-1152.136) [-1152.337] (-1150.458) (-1152.950) -- 0:00:08
857500 -- [-1150.273] (-1152.032) (-1154.334) (-1152.205) * (-1150.915) [-1151.290] (-1152.854) (-1155.132) -- 0:00:08
858000 -- (-1153.978) [-1150.116] (-1155.900) (-1153.615) * [-1150.432] (-1153.110) (-1151.381) (-1152.736) -- 0:00:08
858500 -- [-1151.134] (-1151.488) (-1152.389) (-1152.125) * [-1151.283] (-1155.130) (-1151.730) (-1149.986) -- 0:00:08
859000 -- (-1155.096) (-1155.782) (-1151.930) [-1151.542] * (-1152.071) (-1152.454) [-1152.142] (-1149.992) -- 0:00:08
859500 -- (-1153.324) (-1152.127) (-1156.444) [-1153.274] * (-1153.899) (-1152.167) (-1151.765) [-1151.521] -- 0:00:08
860000 -- [-1151.112] (-1150.183) (-1150.024) (-1153.088) * (-1150.729) (-1151.575) [-1150.265] (-1153.249) -- 0:00:08
Average standard deviation of split frequencies: 0.007376
860500 -- (-1152.186) (-1154.076) (-1150.618) [-1150.778] * (-1155.973) [-1151.937] (-1151.156) (-1153.451) -- 0:00:08
861000 -- (-1152.171) (-1150.749) [-1150.854] (-1151.707) * (-1154.429) [-1151.712] (-1150.043) (-1154.178) -- 0:00:08
861500 -- (-1153.038) (-1151.640) [-1152.151] (-1150.735) * (-1152.864) [-1150.993] (-1150.666) (-1150.791) -- 0:00:08
862000 -- (-1153.380) (-1150.032) (-1152.507) [-1151.929] * (-1152.608) [-1150.479] (-1150.246) (-1151.122) -- 0:00:08
862500 -- (-1150.783) [-1150.449] (-1153.425) (-1151.334) * (-1151.149) [-1151.093] (-1150.385) (-1152.208) -- 0:00:08
863000 -- (-1152.134) (-1157.120) [-1150.838] (-1150.387) * (-1151.742) [-1151.930] (-1150.810) (-1155.089) -- 0:00:08
863500 -- (-1151.752) [-1151.747] (-1155.955) (-1149.966) * (-1151.741) [-1154.864] (-1150.756) (-1151.962) -- 0:00:08
864000 -- (-1154.289) (-1154.709) (-1151.007) [-1150.954] * [-1151.597] (-1151.884) (-1151.917) (-1153.632) -- 0:00:08
864500 -- [-1151.117] (-1154.553) (-1152.265) (-1151.617) * [-1154.056] (-1153.739) (-1152.045) (-1150.491) -- 0:00:08
865000 -- [-1151.633] (-1156.900) (-1150.967) (-1152.200) * [-1153.329] (-1150.733) (-1154.173) (-1151.178) -- 0:00:08
Average standard deviation of split frequencies: 0.007111
865500 -- (-1152.917) (-1149.938) [-1151.577] (-1151.136) * (-1161.273) (-1154.478) (-1151.310) [-1150.113] -- 0:00:08
866000 -- (-1150.977) (-1157.902) [-1152.760] (-1151.706) * (-1154.378) (-1151.059) [-1151.024] (-1150.070) -- 0:00:08
866500 -- [-1151.299] (-1152.966) (-1153.145) (-1154.793) * (-1152.677) (-1150.791) (-1151.736) [-1150.726] -- 0:00:08
867000 -- (-1151.699) [-1154.158] (-1151.182) (-1150.368) * (-1155.393) [-1152.950] (-1153.393) (-1150.756) -- 0:00:08
867500 -- (-1150.531) [-1150.010] (-1151.128) (-1152.426) * (-1152.494) (-1154.607) (-1152.241) [-1150.163] -- 0:00:08
868000 -- (-1150.517) [-1151.463] (-1154.269) (-1150.386) * (-1150.792) (-1155.844) [-1151.018] (-1150.748) -- 0:00:08
868500 -- (-1152.206) (-1150.440) (-1153.543) [-1151.634] * (-1151.646) (-1150.473) [-1152.108] (-1155.338) -- 0:00:08
869000 -- [-1152.647] (-1150.384) (-1152.074) (-1153.877) * [-1150.844] (-1151.351) (-1151.255) (-1151.549) -- 0:00:08
869500 -- [-1150.416] (-1151.494) (-1151.279) (-1151.771) * (-1151.167) (-1151.596) (-1154.094) [-1151.233] -- 0:00:08
870000 -- (-1151.396) (-1151.612) (-1156.595) [-1152.661] * (-1154.132) [-1152.195] (-1153.811) (-1152.776) -- 0:00:08
Average standard deviation of split frequencies: 0.007994
870500 -- [-1151.374] (-1150.271) (-1153.692) (-1151.575) * (-1152.508) (-1150.886) [-1151.988] (-1152.482) -- 0:00:08
871000 -- [-1152.921] (-1153.257) (-1159.826) (-1150.886) * (-1158.439) (-1151.224) (-1152.240) [-1151.974] -- 0:00:07
871500 -- (-1150.348) [-1151.344] (-1154.497) (-1152.077) * [-1150.397] (-1152.771) (-1151.485) (-1154.720) -- 0:00:07
872000 -- (-1152.251) (-1152.025) [-1150.218] (-1151.304) * (-1152.173) (-1151.983) (-1152.832) [-1153.523] -- 0:00:07
872500 -- (-1151.720) (-1151.419) [-1149.953] (-1152.851) * (-1153.718) [-1150.830] (-1150.640) (-1151.474) -- 0:00:07
873000 -- (-1152.658) (-1153.917) (-1151.029) [-1152.517] * [-1152.902] (-1150.833) (-1153.633) (-1151.017) -- 0:00:07
873500 -- (-1152.853) (-1151.830) (-1154.912) [-1151.850] * [-1150.503] (-1150.311) (-1151.555) (-1154.436) -- 0:00:07
874000 -- [-1150.305] (-1155.394) (-1150.309) (-1153.399) * (-1151.452) [-1151.328] (-1153.753) (-1149.723) -- 0:00:07
874500 -- (-1152.141) (-1150.844) (-1150.568) [-1150.780] * (-1154.651) [-1151.653] (-1151.856) (-1151.654) -- 0:00:07
875000 -- (-1151.476) (-1152.282) (-1153.571) [-1150.244] * [-1151.073] (-1151.588) (-1152.243) (-1150.263) -- 0:00:07
Average standard deviation of split frequencies: 0.008294
875500 -- [-1151.048] (-1155.221) (-1153.193) (-1154.784) * (-1152.509) (-1154.701) (-1152.664) [-1152.010] -- 0:00:07
876000 -- [-1150.108] (-1155.414) (-1152.062) (-1155.610) * [-1152.405] (-1150.980) (-1152.063) (-1153.201) -- 0:00:07
876500 -- (-1152.321) (-1152.485) [-1151.248] (-1151.168) * (-1151.554) [-1150.855] (-1149.893) (-1154.411) -- 0:00:07
877000 -- (-1152.984) [-1152.329] (-1153.542) (-1149.941) * [-1151.513] (-1150.981) (-1151.964) (-1160.626) -- 0:00:07
877500 -- (-1150.815) (-1153.125) [-1151.980] (-1149.941) * (-1152.784) (-1151.549) [-1151.037] (-1152.869) -- 0:00:07
878000 -- (-1150.811) [-1152.230] (-1152.367) (-1151.237) * (-1151.445) (-1151.439) (-1152.397) [-1150.444] -- 0:00:07
878500 -- (-1153.797) (-1154.128) (-1153.035) [-1152.472] * [-1150.573] (-1150.532) (-1154.141) (-1154.509) -- 0:00:07
879000 -- (-1153.149) (-1150.709) (-1150.815) [-1153.566] * [-1150.575] (-1152.581) (-1158.194) (-1156.873) -- 0:00:07
879500 -- (-1152.023) (-1152.395) (-1154.102) [-1153.954] * (-1152.128) (-1153.141) (-1156.011) [-1150.696] -- 0:00:07
880000 -- (-1151.329) (-1151.377) [-1150.242] (-1152.367) * (-1150.427) [-1151.280] (-1153.558) (-1151.569) -- 0:00:07
Average standard deviation of split frequencies: 0.008439
880500 -- [-1152.679] (-1152.039) (-1152.106) (-1156.719) * [-1150.210] (-1152.196) (-1151.982) (-1154.080) -- 0:00:07
881000 -- (-1153.265) (-1152.646) (-1156.722) [-1155.126] * [-1152.006] (-1150.751) (-1153.414) (-1151.457) -- 0:00:07
881500 -- (-1152.773) (-1152.453) [-1150.362] (-1152.009) * (-1152.878) [-1150.494] (-1150.815) (-1150.852) -- 0:00:07
882000 -- (-1151.432) [-1151.654] (-1150.406) (-1153.280) * (-1155.496) (-1151.979) [-1150.143] (-1154.126) -- 0:00:07
882500 -- (-1151.700) (-1154.801) [-1150.253] (-1152.415) * (-1152.726) [-1152.344] (-1150.625) (-1152.512) -- 0:00:07
883000 -- (-1152.070) [-1150.357] (-1151.788) (-1151.015) * (-1151.092) (-1155.147) [-1151.274] (-1150.308) -- 0:00:07
883500 -- [-1152.735] (-1151.126) (-1150.967) (-1150.048) * (-1151.022) (-1154.351) [-1150.696] (-1156.852) -- 0:00:07
884000 -- [-1151.337] (-1151.825) (-1151.128) (-1153.769) * (-1155.396) (-1155.761) [-1151.531] (-1152.734) -- 0:00:07
884500 -- (-1150.413) (-1154.036) [-1152.991] (-1152.847) * [-1151.574] (-1150.794) (-1153.374) (-1153.815) -- 0:00:07
885000 -- (-1150.627) (-1150.957) (-1152.389) [-1152.432] * (-1155.816) [-1155.299] (-1153.552) (-1153.131) -- 0:00:07
Average standard deviation of split frequencies: 0.008732
885500 -- (-1150.632) [-1151.067] (-1152.499) (-1150.963) * (-1155.233) (-1158.714) (-1150.504) [-1151.651] -- 0:00:07
886000 -- (-1155.637) (-1153.929) (-1150.764) [-1150.362] * (-1152.389) (-1154.719) (-1155.242) [-1151.406] -- 0:00:07
886500 -- (-1151.961) (-1153.300) [-1151.380] (-1152.297) * (-1150.830) [-1151.927] (-1152.317) (-1154.148) -- 0:00:07
887000 -- [-1150.630] (-1155.894) (-1153.628) (-1151.137) * [-1152.491] (-1151.277) (-1151.994) (-1153.432) -- 0:00:07
887500 -- [-1152.205] (-1152.256) (-1156.243) (-1152.212) * (-1152.441) [-1151.152] (-1150.384) (-1152.422) -- 0:00:06
888000 -- [-1154.064] (-1151.336) (-1155.845) (-1152.155) * (-1153.112) (-1152.104) [-1152.147] (-1153.003) -- 0:00:06
888500 -- (-1153.299) (-1152.102) (-1152.729) [-1151.203] * (-1155.524) (-1151.937) [-1151.664] (-1154.408) -- 0:00:06
889000 -- (-1150.211) [-1152.232] (-1151.856) (-1152.432) * (-1154.014) [-1151.645] (-1151.973) (-1154.623) -- 0:00:06
889500 -- (-1153.972) [-1150.673] (-1153.035) (-1150.728) * (-1152.889) (-1152.661) [-1151.379] (-1152.782) -- 0:00:06
890000 -- (-1154.076) (-1155.487) (-1153.045) [-1150.615] * (-1151.832) [-1152.324] (-1150.896) (-1157.889) -- 0:00:06
Average standard deviation of split frequencies: 0.008898
890500 -- (-1153.677) (-1154.775) (-1152.027) [-1151.561] * (-1154.859) [-1150.336] (-1151.325) (-1151.542) -- 0:00:06
891000 -- [-1151.797] (-1152.572) (-1151.553) (-1152.089) * (-1154.972) (-1151.397) [-1153.617] (-1156.415) -- 0:00:06
891500 -- (-1150.691) (-1155.675) [-1150.278] (-1152.183) * (-1153.295) [-1151.209] (-1150.338) (-1152.809) -- 0:00:06
892000 -- (-1150.840) (-1151.182) (-1151.027) [-1151.293] * [-1150.560] (-1152.075) (-1151.433) (-1151.267) -- 0:00:06
892500 -- [-1152.100] (-1152.021) (-1152.300) (-1151.664) * (-1150.692) [-1150.120] (-1152.831) (-1153.192) -- 0:00:06
893000 -- (-1152.004) [-1151.777] (-1150.351) (-1151.298) * (-1154.603) (-1154.239) (-1155.086) [-1152.927] -- 0:00:06
893500 -- (-1152.236) [-1152.331] (-1150.605) (-1151.743) * (-1150.313) [-1153.533] (-1150.418) (-1156.700) -- 0:00:06
894000 -- [-1154.312] (-1156.306) (-1151.472) (-1153.067) * [-1150.897] (-1152.145) (-1151.868) (-1156.076) -- 0:00:06
894500 -- (-1157.262) [-1151.353] (-1151.093) (-1155.934) * (-1153.525) (-1152.117) [-1153.060] (-1154.172) -- 0:00:06
895000 -- (-1151.263) [-1150.534] (-1154.717) (-1153.434) * (-1152.927) (-1150.418) [-1150.162] (-1152.280) -- 0:00:06
Average standard deviation of split frequencies: 0.009141
895500 -- [-1154.831] (-1152.611) (-1154.312) (-1150.469) * (-1155.215) (-1152.166) (-1150.568) [-1151.961] -- 0:00:06
896000 -- (-1156.627) (-1151.978) [-1151.055] (-1151.623) * (-1152.906) (-1151.790) (-1153.074) [-1152.464] -- 0:00:06
896500 -- (-1153.031) [-1155.413] (-1152.632) (-1151.602) * (-1151.653) [-1151.282] (-1151.781) (-1154.831) -- 0:00:06
897000 -- (-1153.498) (-1152.526) (-1152.245) [-1152.554] * (-1153.142) (-1150.443) [-1155.296] (-1153.130) -- 0:00:06
897500 -- (-1153.499) [-1152.246] (-1158.131) (-1155.530) * (-1151.373) (-1154.267) (-1150.533) [-1151.394] -- 0:00:06
898000 -- [-1152.210] (-1152.789) (-1150.309) (-1153.029) * (-1150.347) (-1152.747) [-1150.438] (-1153.677) -- 0:00:06
898500 -- (-1153.964) (-1154.221) [-1154.638] (-1152.776) * (-1152.316) (-1154.407) [-1150.890] (-1150.430) -- 0:00:06
899000 -- (-1153.902) (-1150.226) (-1154.504) [-1153.655] * (-1152.085) [-1154.011] (-1151.856) (-1153.757) -- 0:00:06
899500 -- (-1155.171) (-1153.110) (-1150.933) [-1158.149] * [-1155.167] (-1153.868) (-1158.224) (-1151.183) -- 0:00:06
900000 -- (-1151.842) [-1150.570] (-1150.703) (-1152.446) * (-1154.484) (-1152.604) (-1155.319) [-1151.773] -- 0:00:06
Average standard deviation of split frequencies: 0.008688
900500 -- (-1150.589) [-1151.522] (-1150.738) (-1150.784) * (-1155.068) [-1157.595] (-1151.842) (-1152.212) -- 0:00:06
901000 -- [-1152.318] (-1152.485) (-1150.766) (-1153.603) * (-1156.584) (-1155.384) (-1151.198) [-1152.535] -- 0:00:06
901500 -- (-1151.754) [-1150.713] (-1150.124) (-1150.269) * (-1156.096) [-1150.548] (-1150.698) (-1153.244) -- 0:00:06
902000 -- (-1152.526) (-1150.537) [-1151.170] (-1152.314) * (-1152.762) [-1153.275] (-1150.674) (-1150.296) -- 0:00:06
902500 -- (-1150.951) [-1151.645] (-1150.367) (-1154.864) * (-1153.338) (-1151.114) (-1150.040) [-1150.972] -- 0:00:06
903000 -- (-1153.363) (-1153.016) [-1149.737] (-1151.366) * (-1156.705) (-1154.463) (-1151.031) [-1150.647] -- 0:00:06
903500 -- (-1150.701) (-1150.896) [-1150.634] (-1150.866) * (-1152.325) (-1151.925) (-1151.038) [-1150.216] -- 0:00:05
904000 -- (-1150.241) (-1160.994) (-1151.527) [-1151.884] * [-1150.709] (-1151.837) (-1151.937) (-1152.084) -- 0:00:05
904500 -- (-1152.098) [-1153.791] (-1153.166) (-1150.759) * (-1154.353) (-1152.872) (-1151.969) [-1154.135] -- 0:00:05
905000 -- (-1150.165) (-1151.749) [-1151.800] (-1150.522) * (-1151.222) (-1152.575) [-1151.307] (-1150.839) -- 0:00:05
Average standard deviation of split frequencies: 0.008637
905500 -- (-1150.840) (-1154.595) [-1151.935] (-1152.343) * (-1154.042) (-1150.945) (-1152.950) [-1150.948] -- 0:00:05
906000 -- (-1152.352) (-1157.565) (-1152.112) [-1150.662] * (-1155.170) (-1152.369) [-1150.249] (-1151.246) -- 0:00:05
906500 -- (-1151.677) (-1150.667) (-1156.212) [-1151.191] * (-1152.594) (-1151.925) (-1150.152) [-1153.355] -- 0:00:05
907000 -- (-1151.521) [-1150.190] (-1156.609) (-1152.047) * [-1150.458] (-1151.352) (-1150.074) (-1153.569) -- 0:00:05
907500 -- (-1154.460) (-1150.547) (-1157.714) [-1152.329] * [-1152.032] (-1155.701) (-1151.129) (-1151.797) -- 0:00:05
908000 -- (-1154.676) (-1154.199) [-1153.816] (-1153.169) * (-1154.487) (-1151.774) (-1152.788) [-1150.549] -- 0:00:05
908500 -- (-1151.698) [-1150.661] (-1152.831) (-1151.551) * [-1156.754] (-1151.935) (-1150.132) (-1150.632) -- 0:00:05
909000 -- (-1150.407) (-1150.139) [-1150.911] (-1150.820) * (-1152.243) [-1150.772] (-1153.919) (-1155.407) -- 0:00:05
909500 -- (-1151.162) (-1153.991) [-1153.049] (-1162.744) * [-1151.080] (-1151.325) (-1152.055) (-1153.144) -- 0:00:05
910000 -- [-1152.519] (-1150.947) (-1150.420) (-1154.067) * [-1152.207] (-1151.488) (-1150.157) (-1154.996) -- 0:00:05
Average standard deviation of split frequencies: 0.008593
910500 -- (-1151.360) [-1151.623] (-1150.664) (-1151.163) * (-1152.286) (-1154.786) [-1150.291] (-1153.454) -- 0:00:05
911000 -- (-1153.381) [-1152.352] (-1151.199) (-1153.583) * (-1152.577) (-1153.644) (-1150.827) [-1151.243] -- 0:00:05
911500 -- (-1153.798) [-1152.134] (-1154.700) (-1152.997) * (-1150.935) [-1152.573] (-1153.323) (-1151.592) -- 0:00:05
912000 -- (-1154.578) (-1152.341) [-1152.888] (-1150.686) * (-1151.273) (-1150.883) (-1150.915) [-1153.861] -- 0:00:05
912500 -- (-1154.700) (-1154.359) [-1152.273] (-1150.924) * [-1152.060] (-1155.590) (-1151.616) (-1151.724) -- 0:00:05
913000 -- (-1153.767) (-1152.808) (-1151.226) [-1152.006] * (-1151.452) (-1151.129) [-1150.796] (-1151.345) -- 0:00:05
913500 -- (-1154.015) (-1150.715) [-1154.844] (-1151.324) * (-1150.868) (-1153.373) (-1154.140) [-1152.114] -- 0:00:05
914000 -- (-1151.525) (-1152.738) (-1150.865) [-1151.545] * [-1150.166] (-1150.642) (-1150.691) (-1152.217) -- 0:00:05
914500 -- (-1150.507) [-1152.835] (-1151.947) (-1152.359) * (-1152.654) [-1150.598] (-1151.743) (-1152.432) -- 0:00:05
915000 -- [-1154.567] (-1150.259) (-1155.169) (-1152.607) * (-1152.462) (-1155.285) (-1150.781) [-1150.699] -- 0:00:05
Average standard deviation of split frequencies: 0.008680
915500 -- [-1152.645] (-1151.597) (-1152.996) (-1150.498) * (-1157.603) [-1149.793] (-1150.966) (-1150.306) -- 0:00:05
916000 -- (-1155.714) (-1151.337) [-1151.810] (-1153.702) * [-1151.030] (-1153.790) (-1152.189) (-1151.232) -- 0:00:05
916500 -- (-1151.203) (-1151.166) [-1154.295] (-1151.675) * (-1150.816) (-1151.645) (-1154.689) [-1150.881] -- 0:00:05
917000 -- [-1155.726] (-1154.346) (-1153.331) (-1154.136) * [-1151.444] (-1150.633) (-1153.422) (-1150.528) -- 0:00:05
917500 -- (-1152.084) (-1152.965) (-1152.763) [-1152.059] * [-1152.097] (-1151.181) (-1149.753) (-1150.539) -- 0:00:05
918000 -- (-1153.599) [-1151.836] (-1151.297) (-1152.599) * [-1153.347] (-1153.122) (-1150.233) (-1150.652) -- 0:00:05
918500 -- [-1150.824] (-1151.901) (-1151.279) (-1153.819) * (-1150.740) [-1149.979] (-1152.630) (-1154.047) -- 0:00:05
919000 -- [-1152.803] (-1150.577) (-1152.100) (-1152.647) * (-1150.372) [-1152.584] (-1149.933) (-1150.817) -- 0:00:05
919500 -- (-1152.876) [-1151.471] (-1150.288) (-1152.050) * (-1158.310) (-1150.418) [-1150.183] (-1153.609) -- 0:00:04
920000 -- (-1153.098) [-1153.543] (-1150.386) (-1153.632) * (-1150.427) [-1151.103] (-1154.639) (-1151.727) -- 0:00:04
Average standard deviation of split frequencies: 0.008739
920500 -- (-1153.827) (-1152.300) [-1150.151] (-1154.392) * (-1151.164) (-1155.731) [-1155.163] (-1150.698) -- 0:00:04
921000 -- (-1156.139) [-1152.333] (-1152.318) (-1149.932) * (-1151.844) [-1153.200] (-1152.369) (-1156.961) -- 0:00:04
921500 -- (-1154.940) (-1153.899) [-1154.125] (-1149.893) * (-1153.166) (-1151.162) (-1150.517) [-1151.669] -- 0:00:04
922000 -- (-1155.610) (-1153.466) [-1151.856] (-1150.812) * (-1154.868) (-1151.927) (-1152.562) [-1152.462] -- 0:00:04
922500 -- (-1150.952) (-1154.030) (-1151.938) [-1150.992] * (-1153.921) [-1151.915] (-1150.003) (-1152.360) -- 0:00:04
923000 -- (-1152.824) (-1152.747) [-1151.366] (-1152.781) * (-1159.272) [-1151.403] (-1154.072) (-1150.931) -- 0:00:04
923500 -- (-1149.976) (-1153.799) [-1152.364] (-1151.438) * (-1155.784) (-1151.548) [-1151.839] (-1151.689) -- 0:00:04
924000 -- (-1154.471) (-1150.768) [-1150.759] (-1151.802) * (-1150.526) [-1150.559] (-1149.938) (-1153.128) -- 0:00:04
924500 -- [-1151.443] (-1150.604) (-1153.084) (-1154.164) * (-1150.017) [-1154.953] (-1153.591) (-1154.053) -- 0:00:04
925000 -- (-1155.018) (-1150.285) (-1152.295) [-1151.386] * (-1152.717) (-1153.504) [-1150.453] (-1154.064) -- 0:00:04
Average standard deviation of split frequencies: 0.008756
925500 -- (-1153.392) [-1150.383] (-1155.385) (-1150.848) * (-1154.803) (-1153.101) [-1150.517] (-1149.955) -- 0:00:04
926000 -- (-1158.950) [-1153.525] (-1154.147) (-1153.462) * [-1151.824] (-1151.060) (-1155.173) (-1151.666) -- 0:00:04
926500 -- (-1156.021) (-1151.244) (-1151.802) [-1154.713] * [-1154.065] (-1150.750) (-1151.849) (-1151.974) -- 0:00:04
927000 -- [-1154.064] (-1150.871) (-1152.464) (-1153.448) * (-1157.401) (-1151.894) (-1151.447) [-1152.337] -- 0:00:04
927500 -- [-1155.015] (-1152.279) (-1150.913) (-1152.576) * (-1153.691) (-1157.883) [-1151.911] (-1153.032) -- 0:00:04
928000 -- (-1150.647) (-1155.992) (-1152.862) [-1150.983] * (-1153.518) (-1152.038) (-1151.257) [-1152.546] -- 0:00:04
928500 -- [-1151.848] (-1153.673) (-1150.451) (-1150.896) * (-1154.454) [-1153.214] (-1152.187) (-1154.235) -- 0:00:04
929000 -- [-1156.084] (-1152.780) (-1150.443) (-1150.224) * [-1153.890] (-1152.125) (-1151.580) (-1151.409) -- 0:00:04
929500 -- (-1161.219) (-1153.383) [-1151.214] (-1150.292) * [-1154.196] (-1151.940) (-1151.352) (-1152.121) -- 0:00:04
930000 -- (-1153.651) (-1153.373) [-1153.110] (-1150.524) * (-1159.208) (-1153.499) (-1151.540) [-1153.609] -- 0:00:04
Average standard deviation of split frequencies: 0.008949
930500 -- (-1159.241) (-1154.727) [-1158.344] (-1153.255) * (-1153.154) (-1152.247) [-1153.803] (-1152.383) -- 0:00:04
931000 -- (-1152.962) (-1153.660) [-1151.288] (-1157.640) * (-1154.003) (-1151.992) (-1151.431) [-1149.911] -- 0:00:04
931500 -- (-1153.840) [-1157.583] (-1152.428) (-1154.213) * (-1154.995) [-1151.517] (-1153.878) (-1152.385) -- 0:00:04
932000 -- (-1154.907) [-1152.582] (-1154.922) (-1152.011) * [-1150.307] (-1150.381) (-1150.369) (-1154.074) -- 0:00:04
932500 -- (-1153.699) [-1152.992] (-1152.424) (-1152.512) * (-1152.213) [-1150.513] (-1151.404) (-1151.219) -- 0:00:04
933000 -- [-1151.573] (-1154.265) (-1150.987) (-1150.940) * (-1153.076) (-1150.336) [-1150.943] (-1151.901) -- 0:00:04
933500 -- (-1151.945) (-1156.651) (-1150.910) [-1150.405] * (-1152.848) [-1150.486] (-1151.141) (-1151.546) -- 0:00:04
934000 -- (-1154.310) (-1150.663) (-1153.314) [-1151.031] * (-1151.894) [-1150.879] (-1151.465) (-1150.368) -- 0:00:04
934500 -- (-1153.862) (-1152.795) (-1153.582) [-1152.633] * (-1152.112) [-1150.960] (-1150.998) (-1155.678) -- 0:00:04
935000 -- (-1150.941) (-1151.570) (-1153.218) [-1154.716] * (-1152.562) (-1151.242) [-1149.947] (-1150.620) -- 0:00:04
Average standard deviation of split frequencies: 0.008998
935500 -- (-1150.265) [-1150.473] (-1150.374) (-1152.042) * [-1152.771] (-1150.514) (-1150.018) (-1151.088) -- 0:00:03
936000 -- (-1152.492) (-1153.047) (-1149.913) [-1155.918] * (-1152.615) (-1150.224) (-1150.787) [-1154.493] -- 0:00:03
936500 -- (-1153.637) (-1150.509) (-1150.796) [-1153.641] * (-1156.199) (-1150.061) (-1153.817) [-1150.772] -- 0:00:03
937000 -- (-1154.777) (-1152.592) (-1151.959) [-1152.720] * (-1152.149) [-1152.959] (-1151.401) (-1151.776) -- 0:00:03
937500 -- (-1153.712) (-1151.790) (-1151.708) [-1151.795] * (-1151.108) (-1152.985) [-1152.416] (-1155.905) -- 0:00:03
938000 -- [-1152.012] (-1156.956) (-1151.063) (-1152.524) * (-1154.092) (-1150.737) (-1150.712) [-1151.154] -- 0:00:03
938500 -- (-1149.970) (-1151.139) [-1151.168] (-1157.317) * (-1153.393) (-1151.129) (-1152.778) [-1153.654] -- 0:00:03
939000 -- (-1150.387) (-1151.971) (-1153.534) [-1152.588] * (-1151.266) (-1150.742) (-1153.568) [-1153.114] -- 0:00:03
939500 -- [-1153.411] (-1150.322) (-1153.227) (-1152.776) * (-1151.638) (-1151.485) (-1151.837) [-1152.091] -- 0:00:03
940000 -- (-1155.619) [-1151.530] (-1157.622) (-1150.350) * (-1154.067) (-1154.830) [-1150.916] (-1152.917) -- 0:00:03
Average standard deviation of split frequencies: 0.009121
940500 -- (-1153.956) (-1150.630) [-1154.104] (-1153.825) * (-1153.693) (-1153.625) [-1150.100] (-1153.263) -- 0:00:03
941000 -- (-1150.367) (-1150.286) [-1153.560] (-1151.124) * (-1155.694) [-1153.880] (-1155.206) (-1156.720) -- 0:00:03
941500 -- (-1150.217) (-1150.646) (-1151.977) [-1153.320] * (-1153.809) (-1150.418) (-1153.178) [-1153.414] -- 0:00:03
942000 -- [-1150.416] (-1154.749) (-1150.204) (-1151.325) * (-1152.448) [-1150.962] (-1151.679) (-1153.047) -- 0:00:03
942500 -- (-1149.938) (-1155.011) (-1150.852) [-1150.539] * (-1151.241) (-1156.328) (-1152.744) [-1151.827] -- 0:00:03
943000 -- (-1150.169) (-1155.828) [-1152.660] (-1152.987) * (-1151.910) (-1152.567) (-1155.371) [-1150.507] -- 0:00:03
943500 -- (-1151.556) (-1153.867) [-1155.844] (-1151.575) * [-1151.700] (-1150.754) (-1153.429) (-1151.134) -- 0:00:03
944000 -- [-1151.496] (-1154.607) (-1157.664) (-1152.306) * (-1150.890) (-1153.397) [-1156.786] (-1151.795) -- 0:00:03
944500 -- (-1150.628) (-1151.314) [-1151.444] (-1153.132) * (-1157.915) [-1150.175] (-1150.974) (-1153.380) -- 0:00:03
945000 -- (-1154.028) (-1154.212) (-1151.134) [-1152.269] * (-1158.434) (-1159.568) [-1153.190] (-1151.702) -- 0:00:03
Average standard deviation of split frequencies: 0.008671
945500 -- (-1150.655) [-1150.380] (-1150.961) (-1151.656) * (-1157.200) (-1159.107) [-1150.826] (-1156.995) -- 0:00:03
946000 -- (-1152.268) (-1152.410) [-1152.771] (-1155.521) * (-1158.480) [-1152.794] (-1151.649) (-1153.573) -- 0:00:03
946500 -- (-1153.851) [-1151.391] (-1158.472) (-1151.747) * (-1153.869) [-1152.075] (-1151.345) (-1153.197) -- 0:00:03
947000 -- [-1151.716] (-1150.166) (-1156.987) (-1153.606) * (-1149.866) (-1150.783) [-1152.192] (-1152.308) -- 0:00:03
947500 -- (-1155.606) (-1152.553) [-1150.502] (-1152.383) * (-1155.385) (-1153.853) [-1151.359] (-1150.276) -- 0:00:03
948000 -- (-1153.733) (-1152.352) [-1152.434] (-1154.533) * [-1152.554] (-1151.606) (-1153.968) (-1150.671) -- 0:00:03
948500 -- [-1150.631] (-1150.522) (-1151.267) (-1156.996) * (-1151.563) (-1153.431) (-1151.729) [-1149.997] -- 0:00:03
949000 -- (-1150.767) [-1150.800] (-1151.159) (-1151.879) * (-1151.606) [-1152.335] (-1154.580) (-1151.479) -- 0:00:03
949500 -- (-1151.943) [-1153.440] (-1153.262) (-1151.283) * (-1154.210) (-1152.887) [-1153.410] (-1152.309) -- 0:00:03
950000 -- (-1153.265) (-1156.770) (-1152.889) [-1150.335] * (-1153.825) [-1152.099] (-1152.552) (-1151.292) -- 0:00:03
Average standard deviation of split frequencies: 0.008529
950500 -- (-1151.349) (-1161.862) (-1151.553) [-1151.217] * (-1154.432) (-1151.058) (-1158.564) [-1151.012] -- 0:00:03
951000 -- (-1153.981) (-1156.738) (-1152.092) [-1151.219] * [-1151.818] (-1150.104) (-1154.481) (-1150.556) -- 0:00:03
951500 -- (-1150.992) (-1154.604) (-1150.062) [-1151.883] * (-1151.986) [-1151.399] (-1150.470) (-1149.694) -- 0:00:03
952000 -- (-1156.595) [-1151.351] (-1150.877) (-1151.737) * (-1153.257) [-1151.556] (-1151.358) (-1153.021) -- 0:00:02
952500 -- (-1151.150) [-1153.486] (-1150.661) (-1150.862) * (-1153.216) (-1150.857) (-1158.055) [-1158.526] -- 0:00:02
953000 -- [-1150.813] (-1152.972) (-1153.208) (-1153.650) * (-1151.840) [-1151.157] (-1152.581) (-1150.268) -- 0:00:02
953500 -- (-1150.566) [-1150.719] (-1151.803) (-1153.005) * (-1153.255) (-1152.362) [-1152.164] (-1156.183) -- 0:00:02
954000 -- (-1157.844) [-1154.436] (-1151.189) (-1151.996) * (-1153.671) (-1152.995) [-1152.458] (-1150.983) -- 0:00:02
954500 -- (-1150.476) (-1155.453) (-1158.164) [-1150.490] * (-1151.019) (-1154.123) [-1150.496] (-1153.941) -- 0:00:02
955000 -- (-1153.477) [-1154.859] (-1154.178) (-1150.823) * [-1152.397] (-1155.684) (-1150.397) (-1151.990) -- 0:00:02
Average standard deviation of split frequencies: 0.008711
955500 -- [-1154.701] (-1150.953) (-1154.517) (-1150.705) * (-1150.364) [-1156.811] (-1150.500) (-1150.761) -- 0:00:02
956000 -- (-1150.754) [-1151.327] (-1154.487) (-1152.574) * [-1153.217] (-1150.827) (-1151.614) (-1153.147) -- 0:00:02
956500 -- (-1152.964) (-1151.435) [-1154.170] (-1157.106) * [-1153.902] (-1150.087) (-1152.735) (-1150.474) -- 0:00:02
957000 -- (-1150.058) [-1152.346] (-1153.262) (-1154.615) * (-1152.109) (-1151.159) [-1153.033] (-1150.315) -- 0:00:02
957500 -- (-1153.249) [-1153.075] (-1154.646) (-1152.119) * (-1152.680) [-1152.374] (-1151.782) (-1150.929) -- 0:00:02
958000 -- (-1150.729) (-1149.857) (-1152.584) [-1154.026] * (-1150.935) (-1151.589) (-1149.769) [-1151.108] -- 0:00:02
958500 -- (-1151.914) (-1151.874) (-1151.749) [-1151.048] * [-1152.099] (-1150.753) (-1149.855) (-1150.028) -- 0:00:02
959000 -- (-1150.854) (-1155.863) [-1151.483] (-1150.257) * (-1157.182) (-1152.816) (-1150.782) [-1150.732] -- 0:00:02
959500 -- (-1150.627) (-1152.395) [-1152.130] (-1150.401) * (-1150.558) [-1150.269] (-1152.586) (-1151.683) -- 0:00:02
960000 -- (-1152.207) (-1150.536) [-1151.853] (-1150.681) * (-1151.758) (-1150.206) [-1154.083] (-1154.083) -- 0:00:02
Average standard deviation of split frequencies: 0.008277
960500 -- (-1150.178) [-1150.474] (-1158.745) (-1150.392) * (-1151.432) (-1150.617) [-1151.068] (-1156.461) -- 0:00:02
961000 -- [-1151.926] (-1150.282) (-1155.216) (-1150.687) * (-1150.967) (-1151.465) [-1150.911] (-1153.322) -- 0:00:02
961500 -- (-1150.716) (-1149.836) (-1152.724) [-1150.175] * (-1153.154) (-1151.181) [-1152.678] (-1150.575) -- 0:00:02
962000 -- [-1151.631] (-1153.813) (-1150.741) (-1150.156) * (-1155.623) (-1156.425) [-1151.242] (-1151.654) -- 0:00:02
962500 -- (-1152.809) (-1155.019) [-1150.401] (-1150.260) * (-1153.744) (-1152.609) (-1152.812) [-1150.394] -- 0:00:02
963000 -- (-1153.090) [-1152.370] (-1150.763) (-1150.401) * [-1151.271] (-1150.360) (-1152.901) (-1152.178) -- 0:00:02
963500 -- (-1152.664) [-1151.973] (-1150.109) (-1153.186) * [-1152.468] (-1155.323) (-1149.905) (-1150.683) -- 0:00:02
964000 -- (-1154.847) [-1154.292] (-1150.991) (-1155.842) * [-1151.685] (-1151.628) (-1151.909) (-1155.843) -- 0:00:02
964500 -- (-1150.588) (-1152.333) [-1151.545] (-1156.572) * (-1151.019) (-1154.216) [-1152.148] (-1152.646) -- 0:00:02
965000 -- (-1152.285) (-1153.398) [-1153.003] (-1155.943) * [-1156.001] (-1157.413) (-1150.255) (-1159.641) -- 0:00:02
Average standard deviation of split frequencies: 0.008357
965500 -- (-1153.103) (-1151.285) [-1152.909] (-1153.488) * (-1159.184) (-1152.221) [-1152.956] (-1156.852) -- 0:00:02
966000 -- [-1152.089] (-1150.831) (-1153.335) (-1152.839) * [-1154.921] (-1151.338) (-1152.184) (-1155.800) -- 0:00:02
966500 -- (-1153.023) (-1150.932) (-1155.089) [-1153.959] * (-1152.106) [-1151.289] (-1150.861) (-1154.642) -- 0:00:02
967000 -- (-1152.748) (-1158.002) (-1150.115) [-1152.334] * (-1154.945) (-1151.810) [-1151.025] (-1157.628) -- 0:00:02
967500 -- (-1153.837) (-1155.188) [-1150.981] (-1151.336) * (-1158.932) [-1154.630] (-1150.141) (-1156.789) -- 0:00:02
968000 -- [-1150.389] (-1156.685) (-1154.821) (-1150.957) * (-1158.669) [-1152.363] (-1151.575) (-1157.404) -- 0:00:01
968500 -- (-1151.823) (-1156.094) [-1156.076] (-1151.384) * (-1150.762) (-1154.878) (-1151.878) [-1151.011] -- 0:00:01
969000 -- (-1152.252) (-1154.380) [-1154.380] (-1151.336) * (-1155.654) (-1155.914) (-1153.474) [-1152.990] -- 0:00:01
969500 -- [-1151.405] (-1152.064) (-1153.184) (-1150.024) * [-1152.653] (-1151.668) (-1153.078) (-1151.975) -- 0:00:01
970000 -- (-1150.095) (-1151.747) (-1154.212) [-1150.478] * [-1153.242] (-1150.701) (-1154.444) (-1151.464) -- 0:00:01
Average standard deviation of split frequencies: 0.008347
970500 -- [-1155.048] (-1150.027) (-1152.436) (-1150.816) * [-1152.952] (-1154.304) (-1151.401) (-1152.069) -- 0:00:01
971000 -- [-1152.562] (-1152.753) (-1149.945) (-1154.450) * [-1151.578] (-1155.080) (-1153.027) (-1151.958) -- 0:00:01
971500 -- (-1159.368) [-1151.091] (-1149.841) (-1151.496) * (-1151.441) (-1150.993) [-1157.144] (-1150.495) -- 0:00:01
972000 -- (-1152.644) (-1150.904) [-1150.612] (-1153.113) * (-1152.779) (-1150.833) (-1158.922) [-1152.310] -- 0:00:01
972500 -- (-1157.672) (-1150.785) [-1150.430] (-1154.886) * (-1150.538) (-1151.048) [-1150.088] (-1156.483) -- 0:00:01
973000 -- (-1154.797) [-1151.018] (-1150.295) (-1153.560) * [-1150.362] (-1156.784) (-1152.405) (-1155.375) -- 0:00:01
973500 -- (-1153.413) (-1152.606) (-1150.208) [-1152.100] * (-1150.611) (-1152.540) [-1151.965] (-1154.711) -- 0:00:01
974000 -- (-1153.709) [-1152.680] (-1151.563) (-1152.314) * (-1150.555) (-1150.011) [-1155.472] (-1150.706) -- 0:00:01
974500 -- [-1153.508] (-1154.183) (-1151.816) (-1152.773) * [-1151.087] (-1150.540) (-1155.266) (-1151.996) -- 0:00:01
975000 -- (-1154.498) (-1151.881) (-1151.761) [-1153.376] * [-1154.364] (-1152.247) (-1152.574) (-1154.193) -- 0:00:01
Average standard deviation of split frequencies: 0.008211
975500 -- (-1151.960) [-1150.799] (-1151.881) (-1154.910) * (-1154.364) (-1154.461) (-1154.392) [-1151.792] -- 0:00:01
976000 -- (-1151.827) [-1152.409] (-1152.486) (-1153.637) * (-1153.273) (-1152.517) [-1153.458] (-1152.742) -- 0:00:01
976500 -- [-1150.195] (-1150.460) (-1153.936) (-1152.169) * (-1152.576) [-1151.065] (-1150.455) (-1151.612) -- 0:00:01
977000 -- (-1154.607) (-1153.720) (-1151.877) [-1151.565] * (-1150.948) [-1150.102] (-1150.190) (-1150.968) -- 0:00:01
977500 -- (-1159.100) (-1152.277) [-1150.859] (-1151.677) * [-1151.920] (-1152.445) (-1153.295) (-1153.090) -- 0:00:01
978000 -- (-1155.006) (-1157.370) (-1157.263) [-1151.505] * (-1150.439) [-1151.047] (-1151.416) (-1153.279) -- 0:00:01
978500 -- (-1150.756) (-1155.658) (-1155.662) [-1152.358] * (-1150.831) (-1152.708) (-1155.868) [-1152.541] -- 0:00:01
979000 -- (-1151.784) (-1152.619) [-1152.238] (-1152.979) * (-1151.037) [-1155.305] (-1154.203) (-1150.728) -- 0:00:01
979500 -- (-1152.920) (-1153.768) (-1152.405) [-1153.010] * [-1153.471] (-1153.840) (-1153.926) (-1150.947) -- 0:00:01
980000 -- [-1151.561] (-1153.969) (-1156.263) (-1153.588) * (-1152.655) (-1151.311) [-1153.066] (-1151.415) -- 0:00:01
Average standard deviation of split frequencies: 0.008236
980500 -- (-1154.385) (-1153.189) (-1151.458) [-1151.889] * (-1153.884) (-1151.968) (-1151.434) [-1153.326] -- 0:00:01
981000 -- (-1155.384) [-1151.351] (-1152.503) (-1154.377) * (-1151.458) (-1157.240) (-1151.364) [-1151.579] -- 0:00:01
981500 -- (-1151.795) [-1153.026] (-1152.719) (-1153.747) * (-1151.575) (-1155.976) (-1153.454) [-1150.871] -- 0:00:01
982000 -- [-1152.421] (-1151.608) (-1151.120) (-1154.515) * [-1151.498] (-1151.362) (-1154.268) (-1151.827) -- 0:00:01
982500 -- (-1151.698) (-1150.157) [-1153.332] (-1157.234) * [-1150.821] (-1150.589) (-1152.678) (-1154.395) -- 0:00:01
983000 -- [-1151.016] (-1150.531) (-1153.334) (-1154.166) * (-1152.073) (-1157.108) [-1152.845] (-1156.360) -- 0:00:01
983500 -- [-1150.173] (-1151.270) (-1152.861) (-1154.689) * (-1153.243) (-1158.741) [-1154.790] (-1151.971) -- 0:00:01
984000 -- (-1150.777) (-1154.897) (-1153.072) [-1150.573] * (-1153.325) [-1154.504] (-1152.300) (-1150.511) -- 0:00:00
984500 -- (-1152.397) (-1154.321) [-1150.933] (-1150.759) * (-1151.357) [-1150.296] (-1152.064) (-1151.284) -- 0:00:00
985000 -- (-1156.091) (-1150.584) (-1151.500) [-1153.077] * [-1152.106] (-1152.113) (-1154.750) (-1150.887) -- 0:00:00
Average standard deviation of split frequencies: 0.008158
985500 -- (-1150.515) (-1152.542) (-1153.510) [-1151.448] * [-1150.681] (-1152.268) (-1151.503) (-1154.465) -- 0:00:00
986000 -- (-1156.862) [-1155.982] (-1156.129) (-1151.664) * (-1152.724) [-1153.616] (-1153.551) (-1154.296) -- 0:00:00
986500 -- (-1151.217) (-1152.685) [-1151.256] (-1151.238) * (-1151.214) [-1153.762] (-1153.617) (-1151.647) -- 0:00:00
987000 -- [-1150.471] (-1150.914) (-1151.679) (-1150.353) * (-1153.030) (-1152.470) [-1151.298] (-1151.689) -- 0:00:00
987500 -- (-1151.040) [-1150.240] (-1155.638) (-1150.505) * (-1155.440) [-1152.474] (-1151.537) (-1156.927) -- 0:00:00
988000 -- (-1150.123) [-1151.820] (-1150.276) (-1150.607) * (-1153.483) (-1151.402) (-1149.968) [-1150.893] -- 0:00:00
988500 -- (-1154.464) (-1152.517) [-1150.806] (-1150.413) * (-1153.039) (-1152.578) [-1151.816] (-1151.463) -- 0:00:00
989000 -- (-1153.831) [-1150.456] (-1150.764) (-1154.121) * [-1150.397] (-1156.307) (-1158.456) (-1150.504) -- 0:00:00
989500 -- (-1156.781) (-1154.320) (-1152.284) [-1152.860] * (-1153.285) (-1150.840) (-1160.317) [-1150.014] -- 0:00:00
990000 -- (-1152.377) (-1152.527) [-1150.735] (-1155.024) * (-1154.905) (-1152.729) (-1152.350) [-1151.434] -- 0:00:00
Average standard deviation of split frequencies: 0.008565
990500 -- (-1151.611) (-1152.903) (-1150.216) [-1151.673] * (-1151.743) (-1154.041) (-1155.197) [-1150.843] -- 0:00:00
991000 -- [-1152.896] (-1152.837) (-1150.097) (-1151.235) * (-1152.985) (-1154.303) (-1153.243) [-1153.376] -- 0:00:00
991500 -- (-1153.584) (-1151.261) (-1151.258) [-1154.549] * (-1152.256) (-1149.999) (-1152.949) [-1150.796] -- 0:00:00
992000 -- (-1160.674) (-1152.042) [-1151.814] (-1154.104) * (-1156.257) (-1152.095) (-1151.387) [-1151.494] -- 0:00:00
992500 -- [-1154.693] (-1157.434) (-1151.257) (-1151.493) * [-1151.358] (-1152.358) (-1153.089) (-1152.042) -- 0:00:00
993000 -- [-1152.250] (-1157.172) (-1151.252) (-1150.886) * (-1150.515) (-1150.997) [-1150.993] (-1153.250) -- 0:00:00
993500 -- (-1151.731) (-1155.307) [-1151.129] (-1152.619) * (-1152.101) [-1151.742] (-1153.925) (-1156.026) -- 0:00:00
994000 -- (-1153.781) (-1152.253) (-1150.555) [-1150.206] * (-1150.967) (-1150.957) (-1153.173) [-1151.708] -- 0:00:00
994500 -- (-1151.979) [-1155.197] (-1151.519) (-1150.402) * (-1152.485) [-1151.966] (-1152.107) (-1150.738) -- 0:00:00
995000 -- (-1151.516) [-1150.735] (-1150.795) (-1150.954) * (-1152.105) (-1150.989) [-1155.025] (-1153.554) -- 0:00:00
Average standard deviation of split frequencies: 0.008488
995500 -- (-1156.768) (-1153.435) (-1152.172) [-1150.812] * (-1149.818) (-1151.856) (-1152.067) [-1150.031] -- 0:00:00
996000 -- (-1150.793) (-1151.424) (-1155.453) [-1153.421] * (-1156.694) [-1154.683] (-1151.640) (-1150.034) -- 0:00:00
996500 -- (-1152.769) (-1151.218) (-1153.199) [-1154.322] * (-1151.651) (-1150.884) [-1153.735] (-1150.140) -- 0:00:00
997000 -- [-1150.590] (-1162.397) (-1153.929) (-1152.596) * (-1153.079) (-1152.227) [-1153.411] (-1152.553) -- 0:00:00
997500 -- (-1155.223) [-1154.723] (-1155.663) (-1155.580) * [-1151.236] (-1152.077) (-1154.237) (-1152.128) -- 0:00:00
998000 -- (-1151.965) [-1156.700] (-1152.504) (-1157.277) * (-1153.879) (-1155.330) (-1155.947) [-1151.146] -- 0:00:00
998500 -- [-1150.170] (-1154.079) (-1154.305) (-1151.412) * [-1150.748] (-1151.453) (-1157.229) (-1151.273) -- 0:00:00
999000 -- (-1151.279) (-1154.374) [-1152.129] (-1151.177) * (-1153.713) (-1150.676) (-1151.402) [-1152.833] -- 0:00:00
999500 -- (-1151.527) (-1150.859) [-1150.802] (-1151.770) * (-1154.319) (-1153.297) (-1153.068) [-1150.769] -- 0:00:00
1000000 -- [-1152.304] (-1150.997) (-1150.459) (-1150.539) * (-1151.585) [-1152.840] (-1159.235) (-1153.845) -- 0:00:00
Average standard deviation of split frequencies: 0.008857
Analysis completed in 1 mins 2 seconds
Analysis used 60.65 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1149.65
Likelihood of best state for "cold" chain of run 2 was -1149.65
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 74 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.4 % ( 22 %) Dirichlet(Pi{all})
28.5 % ( 20 %) Slider(Pi{all})
77.8 % ( 52 %) Multiplier(Alpha{1,2})
77.3 % ( 47 %) Multiplier(Alpha{3})
20.0 % ( 29 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.7 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.3 % ( 78 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
26.6 % ( 30 %) Dirichlet(Pi{all})
27.5 % ( 19 %) Slider(Pi{all})
79.0 % ( 49 %) Multiplier(Alpha{1,2})
77.6 % ( 53 %) Multiplier(Alpha{3})
19.6 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
69.9 % ( 62 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.5 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167363 0.82 0.67
3 | 166884 166121 0.84
4 | 167019 166364 166249
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.51
2 | 167131 0.82 0.67
3 | 166364 166220 0.84
4 | 166609 166763 166913
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1151.30
| 2 |
| 2 12 |
| 21 1 1 2 1 2 |
|2 1 21 111 2 2 21 12 |
| 1 * 2 1 2 11 1 12|
| 1 2 * 1 2 2 1 112 2 1 22 2 |
| 2 1 22 2 11 2 1 122 *1 |
| 2 2 12 221 1 2 1 1 1|
|1 2 1 1 2 22 * 2 1 12 22 1 21 |
| 2 1 1 1 2 1 2 |
| * 2 1 1 2 1 2 |
| 2 2 1 1 2 |
| 2 |
| 1 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1153.13
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1151.35 -1156.48
2 -1151.37 -1154.02
--------------------------------------
TOTAL -1151.36 -1155.87
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891909 0.091362 0.350203 1.472398 0.849913 1113.40 1287.31 1.001
r(A<->C){all} 0.174041 0.019952 0.000037 0.459419 0.136181 202.76 323.91 1.008
r(A<->G){all} 0.159532 0.018559 0.000025 0.432034 0.125642 158.48 181.80 1.000
r(A<->T){all} 0.169749 0.020805 0.000001 0.459660 0.131878 147.18 167.59 1.000
r(C<->G){all} 0.162498 0.020040 0.000012 0.462251 0.122182 191.06 209.95 1.000
r(C<->T){all} 0.170914 0.020288 0.000015 0.453486 0.136958 218.72 240.87 1.002
r(G<->T){all} 0.163266 0.020049 0.000005 0.456799 0.123094 149.25 184.25 1.002
pi(A){all} 0.176942 0.000164 0.151939 0.202716 0.176845 1175.79 1325.09 1.000
pi(C){all} 0.278903 0.000238 0.247958 0.308309 0.278658 1133.75 1240.53 1.000
pi(G){all} 0.328029 0.000259 0.295372 0.358488 0.328107 1278.13 1332.73 1.000
pi(T){all} 0.216127 0.000199 0.190868 0.245908 0.216147 1102.83 1247.06 1.000
alpha{1,2} 0.427996 0.234790 0.000110 1.393506 0.254605 1018.54 1039.72 1.001
alpha{3} 0.462256 0.236975 0.000125 1.440488 0.304302 1129.32 1158.83 1.000
pinvar{all} 0.998245 0.000004 0.994328 1.000000 0.998883 897.96 1140.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- ..*..*
9 -- ..*.*.
10 -- ..****
11 -- ...**.
12 -- .*.***
13 -- .*...*
14 -- ....**
15 -- .***.*
16 -- .**.**
17 -- .**...
18 -- ...*.*
19 -- .****.
20 -- .*..*.
21 -- ..**..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 462 0.153897 0.000942 0.153231 0.154564 2
8 448 0.149234 0.003769 0.146569 0.151899 2
9 444 0.147901 0.009422 0.141239 0.154564 2
10 438 0.145903 0.008480 0.139907 0.151899 2
11 436 0.145237 0.013191 0.135909 0.154564 2
12 436 0.145237 0.012248 0.136576 0.153897 2
13 435 0.144903 0.012719 0.135909 0.153897 2
14 434 0.144570 0.006595 0.139907 0.149234 2
15 432 0.143904 0.016017 0.132578 0.155230 2
16 429 0.142905 0.005182 0.139241 0.146569 2
17 419 0.139574 0.004240 0.136576 0.142572 2
18 415 0.138241 0.003298 0.135909 0.140573 2
19 413 0.137575 0.004240 0.134577 0.140573 2
20 412 0.137242 0.020728 0.122585 0.151899 2
21 393 0.130913 0.011777 0.122585 0.139241 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/2res/fpg/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099958 0.009632 0.000025 0.289726 0.071113 1.000 2
length{all}[2] 0.099736 0.009833 0.000001 0.293713 0.070310 1.000 2
length{all}[3] 0.097041 0.010044 0.000012 0.287886 0.065787 1.000 2
length{all}[4] 0.098720 0.009406 0.000093 0.295221 0.068481 1.000 2
length{all}[5] 0.101638 0.010971 0.000018 0.301691 0.070555 1.000 2
length{all}[6] 0.103019 0.011591 0.000037 0.310614 0.071319 1.000 2
length{all}[7] 0.095619 0.008661 0.000139 0.281619 0.068446 0.998 2
length{all}[8] 0.100845 0.011544 0.000043 0.338133 0.064670 1.000 2
length{all}[9] 0.096251 0.009671 0.000748 0.287147 0.065457 0.999 2
length{all}[10] 0.094921 0.008555 0.000311 0.282622 0.065381 0.999 2
length{all}[11] 0.100606 0.009572 0.000124 0.298414 0.070062 1.001 2
length{all}[12] 0.096459 0.008928 0.001104 0.268115 0.068416 0.998 2
length{all}[13] 0.103866 0.012622 0.000112 0.314631 0.067299 1.004 2
length{all}[14] 0.099262 0.009753 0.000071 0.287531 0.071093 0.999 2
length{all}[15] 0.094623 0.008858 0.000169 0.284668 0.064969 0.998 2
length{all}[16] 0.096990 0.010414 0.000109 0.292089 0.067658 0.998 2
length{all}[17] 0.098147 0.009251 0.000636 0.276091 0.068872 0.998 2
length{all}[18] 0.098274 0.010427 0.000324 0.309693 0.066944 1.003 2
length{all}[19] 0.102224 0.010746 0.000233 0.340006 0.065566 1.003 2
length{all}[20] 0.098879 0.009215 0.000176 0.306099 0.069611 0.998 2
length{all}[21] 0.089099 0.007119 0.000198 0.256707 0.065752 1.004 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008857
Maximum standard deviation of split frequencies = 0.020728
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------ C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 846
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 282 / 282 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 282 / 282 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.099603 0.087558 0.094764 0.040735 0.031072 0.047119 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1228.151802
Iterating by ming2
Initial: fx= 1228.151802
x= 0.09960 0.08756 0.09476 0.04073 0.03107 0.04712 0.30000 1.30000
1 h-m-p 0.0000 0.0001 678.1069 ++ 1176.730477 m 0.0001 13 | 1/8
2 h-m-p 0.0015 0.0073 43.8528 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 621.6134 ++ 1163.293913 m 0.0000 44 | 2/8
4 h-m-p 0.0007 0.0122 28.8231 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 556.1142 ++ 1156.182664 m 0.0000 75 | 3/8
6 h-m-p 0.0005 0.0151 23.4750 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 481.1509 ++ 1122.119128 m 0.0001 106 | 4/8
8 h-m-p 0.0040 0.0308 14.3611 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 395.4365 ++ 1118.026353 m 0.0000 138 | 5/8
10 h-m-p 0.0009 0.2412 7.8247 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 279.8511 ++ 1116.648661 m 0.0000 169 | 6/8
12 h-m-p 0.0207 8.0000 0.0000 +C 1116.648661 0 0.0829 181 | 6/8
13 h-m-p 0.3247 8.0000 0.0000 -Y 1116.648661 0 0.0203 195
Out..
lnL = -1116.648661
196 lfun, 196 eigenQcodon, 1176 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.074615 0.089338 0.076166 0.109669 0.045660 0.106607 0.299944 0.665359 0.590785
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.532377
np = 9
lnL0 = -1254.583600
Iterating by ming2
Initial: fx= 1254.583600
x= 0.07461 0.08934 0.07617 0.10967 0.04566 0.10661 0.29994 0.66536 0.59078
1 h-m-p 0.0000 0.0002 662.1108 +++ 1180.387523 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0003 455.7976 ++ 1140.089968 m 0.0003 27 | 2/9
3 h-m-p 0.0000 0.0000 1569.9848 ++ 1138.184004 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 3021.2612 ++ 1126.766688 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 79715.9126 ++ 1117.450724 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 2527.8054 ++ 1116.648641 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0002 ++ 1116.648641 m 8.0000 87 | 6/9
8 h-m-p 0.0204 2.6084 0.0879 ++++ 1116.648631 m 2.6084 104 | 7/9
9 h-m-p 0.2530 8.0000 0.1735 -----------C 1116.648631 0 0.0000 130 | 7/9
10 h-m-p 0.0160 8.0000 0.0001 +++++ 1116.648630 m 8.0000 147 | 7/9
11 h-m-p 0.0039 1.9685 0.3173 ---------Y 1116.648630 0 0.0000 170 | 7/9
12 h-m-p 0.0003 0.1441 2.6406 +++++ 1116.648553 m 0.1441 187 | 8/9
13 h-m-p 0.7307 8.0000 0.0527 --------------C 1116.648553 0 0.0000 213 | 8/9
14 h-m-p 0.0160 8.0000 0.0000 -----------Y 1116.648553 0 0.0000 237
Out..
lnL = -1116.648553
238 lfun, 714 eigenQcodon, 2856 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.012608 0.107546 0.098095 0.030520 0.032160 0.076755 0.167531 0.926906 0.224083 0.337910 1.415444
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.992980
np = 11
lnL0 = -1212.139372
Iterating by ming2
Initial: fx= 1212.139372
x= 0.01261 0.10755 0.09809 0.03052 0.03216 0.07676 0.16753 0.92691 0.22408 0.33791 1.41544
1 h-m-p 0.0000 0.0000 628.0844 ++ 1192.782119 m 0.0000 16 | 1/11
2 h-m-p 0.0001 0.0003 297.7353 ++ 1168.298675 m 0.0003 30 | 2/11
3 h-m-p 0.0000 0.0000 627.2173 ++ 1166.759819 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0002 854.2203 +++ 1132.404792 m 0.0002 59 | 4/11
5 h-m-p 0.0000 0.0000 755388.3237 ++ 1123.760963 m 0.0000 73 | 5/11
6 h-m-p 0.0013 0.0065 11.4785 -----------.. | 5/11
7 h-m-p 0.0000 0.0000 386.8298 ++ 1119.657430 m 0.0000 110 | 6/11
8 h-m-p 0.0013 0.0374 5.7292 -----------.. | 6/11
9 h-m-p 0.0000 0.0000 276.2708 ++ 1116.648639 m 0.0000 147 | 7/11
10 h-m-p 0.0764 8.0000 0.0000 ++++ 1116.648639 m 8.0000 163 | 7/11
11 h-m-p 0.0254 8.0000 0.0047 +++++ 1116.648638 m 8.0000 184 | 7/11
12 h-m-p 0.0213 8.0000 1.7704 ----------C 1116.648638 0 0.0000 212 | 7/11
13 h-m-p 0.0160 8.0000 0.0045 +++++ 1116.648638 m 8.0000 229 | 7/11
14 h-m-p 0.0220 8.0000 1.6389 ---------C 1116.648638 0 0.0000 256 | 7/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 1116.648638 m 8.0000 273 | 7/11
16 h-m-p 0.0137 6.8726 0.0830 +++++ 1116.648632 m 6.8726 294 | 8/11
17 h-m-p 1.6000 8.0000 0.1271 Y 1116.648632 0 2.6359 312 | 8/11
18 h-m-p 1.6000 8.0000 0.0027 Y 1116.648632 0 0.6993 329 | 8/11
19 h-m-p 1.6000 8.0000 0.0003 Y 1116.648632 0 3.6757 346 | 8/11
20 h-m-p 1.6000 8.0000 0.0005 +C 1116.648632 0 6.0000 364 | 8/11
21 h-m-p 1.6000 8.0000 0.0001 ++ 1116.648632 m 8.0000 381 | 8/11
22 h-m-p 0.0224 8.0000 0.0396 ++++C 1116.648632 0 5.3756 402 | 8/11
23 h-m-p 1.6000 8.0000 0.0060 ++ 1116.648631 m 8.0000 419 | 8/11
24 h-m-p 0.0181 0.0907 1.8617 ++ 1116.648630 m 0.0907 436 | 9/11
25 h-m-p 0.0835 8.0000 1.8037 ++++ 1116.648513 m 8.0000 452 | 9/11
26 h-m-p 1.6000 8.0000 0.0186 ++ 1116.648513 m 8.0000 466 | 9/11
27 h-m-p 1.6000 8.0000 0.0075 ++ 1116.648513 m 8.0000 482 | 9/11
28 h-m-p 1.5065 8.0000 0.0396 ++ 1116.648513 m 8.0000 498 | 9/11
29 h-m-p 0.3242 8.0000 0.9766 --------C 1116.648513 0 0.0000 522 | 9/11
30 h-m-p 0.0080 3.9927 23.5729 +++Y 1116.648513 0 0.5111 541 | 9/11
31 h-m-p 1.6000 8.0000 0.0000 N 1116.648513 0 1.6000 555 | 9/11
32 h-m-p 0.0160 8.0000 0.0000 N 1116.648513 0 0.0160 571
Out..
lnL = -1116.648513
572 lfun, 2288 eigenQcodon, 10296 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1116.708374 S = -1116.649727 -0.022706
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:04
did 20 / 55 patterns 0:04
did 30 / 55 patterns 0:04
did 40 / 55 patterns 0:04
did 50 / 55 patterns 0:04
did 55 / 55 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.064280 0.065037 0.069778 0.100288 0.033647 0.016043 0.000100 0.847615 1.117003
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.427976
np = 9
lnL0 = -1209.835355
Iterating by ming2
Initial: fx= 1209.835355
x= 0.06428 0.06504 0.06978 0.10029 0.03365 0.01604 0.00011 0.84761 1.11700
1 h-m-p 0.0000 0.0000 629.0487 ++ 1209.062933 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0048 84.0457 +++++ 1181.212914 m 0.0048 29 | 2/9
3 h-m-p 0.0000 0.0002 131.5396 ++ 1172.497814 m 0.0002 41 | 3/9
4 h-m-p 0.0001 0.0024 203.8323 +++ 1145.362761 m 0.0024 54 | 4/9
5 h-m-p 0.0001 0.0005 136.4911 ++ 1140.181402 m 0.0005 66 | 5/9
6 h-m-p 0.0000 0.0002 198.8565 ++ 1135.161914 m 0.0002 78 | 6/9
7 h-m-p 0.0000 0.0002 263.5326 ++ 1128.856711 m 0.0002 90 | 7/9
8 h-m-p 0.0097 0.1807 4.9829 -------------.. | 7/9
9 h-m-p 0.0000 0.0002 260.6720 +++ 1116.648513 m 0.0002 126 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 C 1116.648513 0 1.8571 138 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 -----N 1116.648513 0 0.0004 156
Out..
lnL = -1116.648513
157 lfun, 1727 eigenQcodon, 9420 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.039742 0.071057 0.088548 0.026407 0.096189 0.010159 0.000100 0.900000 0.828100 1.263109 1.299969
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.323147
np = 11
lnL0 = -1204.265709
Iterating by ming2
Initial: fx= 1204.265709
x= 0.03974 0.07106 0.08855 0.02641 0.09619 0.01016 0.00011 0.90000 0.82810 1.26311 1.29997
1 h-m-p 0.0000 0.0000 615.8282 ++ 1203.507799 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0007 166.2550 ++++ 1187.354101 m 0.0007 32 | 2/11
3 h-m-p 0.0000 0.0002 244.1773 ++ 1165.781814 m 0.0002 46 | 3/11
4 h-m-p 0.0002 0.0009 213.5921 ++ 1149.941600 m 0.0009 60 | 4/11
5 h-m-p 0.0000 0.0000 5019.2468 ++ 1126.598304 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0002 1197.6950 ++ 1118.227547 m 0.0002 88 | 6/11
7 h-m-p 0.0000 0.0000 4137.4182 ++ 1116.648629 m 0.0000 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0001 ++ 1116.648629 m 8.0000 116 | 7/11
9 h-m-p 0.0160 8.0000 0.0564 ---------C 1116.648629 0 0.0000 143 | 7/11
10 h-m-p 0.0160 8.0000 0.0004 +++++ 1116.648629 m 8.0000 164 | 7/11
11 h-m-p 0.0017 0.1472 1.9541 ---------C 1116.648629 0 0.0000 191 | 7/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 1116.648629 m 8.0000 208 | 7/11
13 h-m-p 0.0013 0.2265 0.8199 -----------.. | 7/11
14 h-m-p 0.0160 8.0000 0.0002 +++++ 1116.648628 m 8.0000 256 | 7/11
15 h-m-p 0.0080 3.9785 0.1984 ---------C 1116.648628 0 0.0000 283 | 7/11
16 h-m-p 0.0160 8.0000 0.0025 +++++ 1116.648625 m 8.0000 304 | 7/11
17 h-m-p 0.0956 4.3658 0.2073 -----------Y 1116.648625 0 0.0000 333 | 7/11
18 h-m-p 0.0160 8.0000 0.0000 -----Y 1116.648625 0 0.0000 356 | 7/11
19 h-m-p 0.0160 8.0000 0.0006 +++++ 1116.648624 m 8.0000 377 | 7/11
20 h-m-p 0.0232 5.7029 0.1972 ------------Y 1116.648624 0 0.0000 407 | 7/11
21 h-m-p 0.0160 8.0000 0.0052 +++++ 1116.648618 m 8.0000 428 | 7/11
22 h-m-p 0.1979 5.8206 0.2086 -------------N 1116.648618 0 0.0000 459 | 7/11
23 h-m-p 0.0160 8.0000 0.0000 ---Y 1116.648618 0 0.0001 480 | 7/11
24 h-m-p 0.0160 8.0000 0.0002 +++++ 1116.648617 m 8.0000 501 | 7/11
25 h-m-p 0.0008 0.2383 2.2264 +++++ 1116.648594 m 0.2383 522 | 8/11
26 h-m-p 0.1219 0.6094 0.9063 ++ 1116.648513 m 0.6094 536 | 9/11
27 h-m-p 1.6000 8.0000 0.0000 N 1116.648513 0 1.6000 553 | 9/11
28 h-m-p 0.0160 8.0000 3.7778 +
QuantileBeta(0.15, 0.00500, 2.57957) = 9.806934e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.48089) = 4.128595e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 17.08617) = 1.242148e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
+ 1116.648513 m 8.0000 572
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 6.805759e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83456) = 5.298087e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
| 9/11
29 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
N 1116.648513 0 1.6000 586
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 6.805759e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83512) = 5.297991e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83396) = 5.298187e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
| 9/11
30 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
N 1116.648513 0 0.0640 603
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
Out..
lnL = -1116.648513
604 lfun, 7248 eigenQcodon, 39864 P(t)
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1116.725901 S = -1116.649726 -0.033996
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:18
did 20 / 55 patterns 0:18
did 30 / 55 patterns 0:18
did 40 / 55 patterns 0:18
did 50 / 55 patterns 0:18
did 55 / 55 patterns 0:18
QuantileBeta(0.15, 0.00500, 31.83454) = 5.298089e-162 2000 rounds
Time used: 0:18
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/2res/fpg/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 282
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 5 5 5 5 5 5 | Cys TGT 0 0 0 0 0 0
TTC 8 8 8 8 8 8 | TCC 2 2 2 2 2 2 | TAC 2 2 2 2 2 2 | TGC 5 5 5 5 5 5
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 8 8 8 8 8 8 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 5 5 5 5 5 5 | His CAT 2 2 2 2 2 2 | Arg CGT 5 5 5 5 5 5
CTC 7 7 7 7 7 7 | CCC 2 2 2 2 2 2 | CAC 7 7 7 7 7 7 | CGC 9 9 9 9 9 9
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 2 2 2 2 2 2
CTG 13 13 13 13 13 13 | CCG 4 4 4 4 4 4 | CAG 6 6 6 6 6 6 | CGG 14 14 14 14 14 14
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 6 6 6 6 6 6 | Thr ACT 4 4 4 4 4 4 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 3 3 3 3 3 3 | ACC 5 5 5 5 5 5 | AAC 7 7 7 7 7 7 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 7 7 7 7 7 7 | ACG 4 4 4 4 4 4 | AAG 5 5 5 5 5 5 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 5 5 5 5 5 5 | Asp GAT 12 12 12 12 12 12 | Gly GGT 2 2 2 2 2 2
GTC 5 5 5 5 5 5 | GCC 10 10 10 10 10 10 | GAC 10 10 10 10 10 10 | GGC 12 12 12 12 12 12
GTA 4 4 4 4 4 4 | GCA 0 0 0 0 0 0 | Glu GAA 8 8 8 8 8 8 | GGA 4 4 4 4 4 4
GTG 16 16 16 16 16 16 | GCG 8 8 8 8 8 8 | GAG 3 3 3 3 3 3 | GGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908460_1_1761_MLBR_RS08345
position 1: T:0.15248 C:0.28723 A:0.17376 G:0.38652
position 2: T:0.30142 C:0.21277 A:0.25177 G:0.23404
position 3: T:0.19504 C:0.33688 A:0.10284 G:0.36525
Average T:0.21631 C:0.27896 A:0.17612 G:0.32861
#2: NC_002677_1_NP_302139_1_1011_fpg
position 1: T:0.15248 C:0.28723 A:0.17376 G:0.38652
position 2: T:0.30142 C:0.21277 A:0.25177 G:0.23404
position 3: T:0.19504 C:0.33688 A:0.10284 G:0.36525
Average T:0.21631 C:0.27896 A:0.17612 G:0.32861
#3: NZ_LVXE01000091_1_WP_010908460_1_2899_A3216_RS13950
position 1: T:0.15248 C:0.28723 A:0.17376 G:0.38652
position 2: T:0.30142 C:0.21277 A:0.25177 G:0.23404
position 3: T:0.19504 C:0.33688 A:0.10284 G:0.36525
Average T:0.21631 C:0.27896 A:0.17612 G:0.32861
#4: NZ_LYPH01000094_1_WP_010908460_1_2835_A8144_RS13665
position 1: T:0.15248 C:0.28723 A:0.17376 G:0.38652
position 2: T:0.30142 C:0.21277 A:0.25177 G:0.23404
position 3: T:0.19504 C:0.33688 A:0.10284 G:0.36525
Average T:0.21631 C:0.27896 A:0.17612 G:0.32861
#5: NZ_CP029543_1_WP_010908460_1_1790_DIJ64_RS09110
position 1: T:0.15248 C:0.28723 A:0.17376 G:0.38652
position 2: T:0.30142 C:0.21277 A:0.25177 G:0.23404
position 3: T:0.19504 C:0.33688 A:0.10284 G:0.36525
Average T:0.21631 C:0.27896 A:0.17612 G:0.32861
#6: NZ_AP014567_1_WP_010908460_1_1835_mutM
position 1: T:0.15248 C:0.28723 A:0.17376 G:0.38652
position 2: T:0.30142 C:0.21277 A:0.25177 G:0.23404
position 3: T:0.19504 C:0.33688 A:0.10284 G:0.36525
Average T:0.21631 C:0.27896 A:0.17612 G:0.32861
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 18 | Tyr Y TAT 30 | Cys C TGT 0
TTC 48 | TCC 12 | TAC 12 | TGC 30
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 48 | TCG 30 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 30 | His H CAT 12 | Arg R CGT 30
CTC 42 | CCC 12 | CAC 42 | CGC 54
CTA 12 | CCA 6 | Gln Q CAA 12 | CGA 12
CTG 78 | CCG 24 | CAG 36 | CGG 84
------------------------------------------------------------------------------
Ile I ATT 36 | Thr T ACT 24 | Asn N AAT 0 | Ser S AGT 6
ATC 18 | ACC 30 | AAC 42 | AGC 6
ATA 0 | ACA 12 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 42 | ACG 24 | AAG 30 | AGG 6
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 30 | Asp D GAT 72 | Gly G GGT 12
GTC 30 | GCC 60 | GAC 60 | GGC 72
GTA 24 | GCA 0 | Glu E GAA 48 | GGA 24
GTG 96 | GCG 48 | GAG 18 | GGG 36
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15248 C:0.28723 A:0.17376 G:0.38652
position 2: T:0.30142 C:0.21277 A:0.25177 G:0.23404
position 3: T:0.19504 C:0.33688 A:0.10284 G:0.36525
Average T:0.21631 C:0.27896 A:0.17612 G:0.32861
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1116.648661 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299944 1.299969
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908460_1_1761_MLBR_RS08345: 0.000004, NC_002677_1_NP_302139_1_1011_fpg: 0.000004, NZ_LVXE01000091_1_WP_010908460_1_2899_A3216_RS13950: 0.000004, NZ_LYPH01000094_1_WP_010908460_1_2835_A8144_RS13665: 0.000004, NZ_CP029543_1_WP_010908460_1_1790_DIJ64_RS09110: 0.000004, NZ_AP014567_1_WP_010908460_1_1835_mutM: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29994
omega (dN/dS) = 1.29997
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 652.6 193.4 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 652.6 193.4 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 652.6 193.4 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 652.6 193.4 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 652.6 193.4 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 652.6 193.4 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1116.648553 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.167531 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908460_1_1761_MLBR_RS08345: 0.000004, NC_002677_1_NP_302139_1_1011_fpg: 0.000004, NZ_LVXE01000091_1_WP_010908460_1_2899_A3216_RS13950: 0.000004, NZ_LYPH01000094_1_WP_010908460_1_2835_A8144_RS13665: 0.000004, NZ_CP029543_1_WP_010908460_1_1790_DIJ64_RS09110: 0.000004, NZ_AP014567_1_WP_010908460_1_1835_mutM: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.16753
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 656.4 189.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 656.4 189.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 656.4 189.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 656.4 189.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 656.4 189.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 656.4 189.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1116.648513 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908460_1_1761_MLBR_RS08345: 0.000004, NC_002677_1_NP_302139_1_1011_fpg: 0.000004, NZ_LVXE01000091_1_WP_010908460_1_2899_A3216_RS13950: 0.000004, NZ_LYPH01000094_1_WP_010908460_1_2835_A8144_RS13665: 0.000004, NZ_CP029543_1_WP_010908460_1_1790_DIJ64_RS09110: 0.000004, NZ_AP014567_1_WP_010908460_1_1835_mutM: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908460_1_1761_MLBR_RS08345)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.104 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.096
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1116.648513 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.890556
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908460_1_1761_MLBR_RS08345: 0.000004, NC_002677_1_NP_302139_1_1011_fpg: 0.000004, NZ_LVXE01000091_1_WP_010908460_1_2899_A3216_RS13950: 0.000004, NZ_LYPH01000094_1_WP_010908460_1_2835_A8144_RS13665: 0.000004, NZ_CP029543_1_WP_010908460_1_1790_DIJ64_RS09110: 0.000004, NZ_AP014567_1_WP_010908460_1_1835_mutM: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 0.89056
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00004
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1116.648513 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 31.834541 1.788098
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908460_1_1761_MLBR_RS08345: 0.000004, NC_002677_1_NP_302139_1_1011_fpg: 0.000004, NZ_LVXE01000091_1_WP_010908460_1_2899_A3216_RS13950: 0.000004, NZ_LYPH01000094_1_WP_010908460_1_2835_A8144_RS13665: 0.000004, NZ_CP029543_1_WP_010908460_1_1790_DIJ64_RS09110: 0.000004, NZ_AP014567_1_WP_010908460_1_1835_mutM: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 31.83454
(p1 = 0.00001) w = 1.78810
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.78810
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 661.9 184.1 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908460_1_1761_MLBR_RS08345)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.105 0.104 0.103 0.102 0.101 0.099 0.098 0.097 0.096 0.095
Time used: 0:18