--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:21:04 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/frr/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -766.14 -770.19
2 -766.07 -769.03
--------------------------------------
TOTAL -766.10 -769.77
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895088 0.090873 0.393545 1.528508 0.867552 1501.00 1501.00 1.000
r(A<->C){all} 0.163978 0.020358 0.000012 0.445899 0.122322 211.60 248.70 1.001
r(A<->G){all} 0.152923 0.018722 0.000155 0.426808 0.112322 186.20 208.34 1.002
r(A<->T){all} 0.158461 0.017666 0.000188 0.428545 0.123467 155.77 185.31 1.000
r(C<->G){all} 0.174747 0.022551 0.000068 0.494163 0.135617 125.91 204.93 1.000
r(C<->T){all} 0.172200 0.021029 0.000008 0.466561 0.134987 200.47 227.17 1.000
r(G<->T){all} 0.177692 0.021342 0.000187 0.462759 0.137248 252.74 268.54 1.000
pi(A){all} 0.257665 0.000331 0.222846 0.294631 0.257461 1274.86 1306.96 1.000
pi(C){all} 0.244663 0.000342 0.210239 0.281290 0.244170 1055.11 1067.70 1.000
pi(G){all} 0.295800 0.000356 0.257871 0.332199 0.295703 1335.01 1418.01 1.000
pi(T){all} 0.201872 0.000284 0.168941 0.233894 0.201525 1069.68 1236.68 1.000
alpha{1,2} 0.402477 0.199402 0.000367 1.328210 0.243336 1098.08 1140.96 1.000
alpha{3} 0.470469 0.262049 0.000176 1.473438 0.302843 1112.87 1146.11 1.000
pinvar{all} 0.997142 0.000012 0.990734 0.999999 0.998309 1091.16 1296.08 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -727.163242
Model 2: PositiveSelection -727.163275
Model 0: one-ratio -727.16338
Model 7: beta -727.162982
Model 8: beta&w>1 -727.162982
Model 0 vs 1 2.75999999985288E-4
Model 2 vs 1 6.60000000607397E-5
Model 8 vs 7 0.0
>C1
MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
>C2
MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
>C3
MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
>C4
MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
>C5
MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
>C6
MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=185
C1 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
C2 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
C3 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
C4 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
C5 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
C6 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
**************************************************
C1 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
C2 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
C3 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
C4 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
C5 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
C6 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
**************************************************
C1 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
C2 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
C3 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
C4 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
C5 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
C6 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
**************************************************
C1 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
C2 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
C3 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
C4 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
C5 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
C6 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
***********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 185 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5550]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5550]--->[5550]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.456 Mb, Max= 30.705 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
C2 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
C3 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
C4 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
C5 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
C6 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
**************************************************
C1 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
C2 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
C3 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
C4 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
C5 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
C6 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
**************************************************
C1 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
C2 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
C3 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
C4 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
C5 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
C6 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
**************************************************
C1 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
C2 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
C3 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
C4 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
C5 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
C6 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
***********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT
C2 ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT
C3 ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT
C4 ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT
C5 ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT
C6 ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT
**************************************************
C1 TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC
C2 TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC
C3 TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC
C4 TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC
C5 TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC
C6 TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC
**************************************************
C1 CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG
C2 CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG
C3 CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG
C4 CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG
C5 CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG
C6 CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG
**************************************************
C1 ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT
C2 ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT
C3 ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT
C4 ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT
C5 ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT
C6 ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT
**************************************************
C1 CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA
C2 CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA
C3 CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA
C4 CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA
C5 CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA
C6 CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA
**************************************************
C1 ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA
C2 ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA
C3 ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA
C4 ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA
C5 ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA
C6 ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA
**************************************************
C1 GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC
C2 GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC
C3 GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC
C4 GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC
C5 GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC
C6 GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC
**************************************************
C1 CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA
C2 CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA
C3 CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA
C4 CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA
C5 CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA
C6 CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA
**************************************************
C1 AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA
C2 AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA
C3 AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA
C4 AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA
C5 AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA
C6 AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA
**************************************************
C1 GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA
C2 GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA
C3 GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA
C4 GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA
C5 GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA
C6 GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA
**************************************************
C1 CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG
C2 CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG
C3 CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG
C4 CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG
C5 CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG
C6 CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG
**************************************************
C1 AGGTC
C2 AGGTC
C3 AGGTC
C4 AGGTC
C5 AGGTC
C6 AGGTC
*****
>C1
ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT
TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC
CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG
ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT
CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA
ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA
GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC
CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA
AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA
GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA
CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG
AGGTC
>C2
ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT
TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC
CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG
ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT
CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA
ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA
GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC
CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA
AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA
GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA
CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG
AGGTC
>C3
ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT
TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC
CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG
ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT
CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA
ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA
GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC
CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA
AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA
GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA
CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG
AGGTC
>C4
ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT
TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC
CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG
ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT
CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA
ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA
GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC
CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA
AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA
GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA
CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG
AGGTC
>C5
ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT
TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC
CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG
ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT
CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA
ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA
GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC
CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA
AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA
GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA
CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG
AGGTC
>C6
ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT
TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC
CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG
ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT
CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA
ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA
GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC
CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA
AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA
GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA
CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG
AGGTC
>C1
MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
>C2
MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
>C3
MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
>C4
MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
>C5
MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
>C6
MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 555 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789170
Setting output file names to "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1597246131
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0172722612
Seed = 1463830838
Swapseed = 1579789170
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1242.116537 -- -24.965149
Chain 2 -- -1242.116537 -- -24.965149
Chain 3 -- -1242.116608 -- -24.965149
Chain 4 -- -1242.116608 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1242.116608 -- -24.965149
Chain 2 -- -1242.116608 -- -24.965149
Chain 3 -- -1242.116419 -- -24.965149
Chain 4 -- -1242.116608 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1242.117] (-1242.117) (-1242.117) (-1242.117) * [-1242.117] (-1242.117) (-1242.116) (-1242.117)
500 -- (-773.874) (-778.277) (-775.508) [-774.470] * (-779.967) (-783.984) [-782.003] (-776.206) -- 0:00:00
1000 -- (-775.045) (-776.493) [-775.302] (-779.311) * [-776.305] (-774.077) (-774.591) (-768.530) -- 0:00:00
1500 -- (-776.421) (-778.944) [-775.726] (-776.693) * (-776.901) (-772.352) [-771.896] (-783.071) -- 0:00:00
2000 -- (-779.298) (-777.155) (-771.702) [-772.722] * (-780.221) (-779.762) [-774.771] (-771.651) -- 0:00:00
2500 -- (-774.131) [-783.767] (-776.039) (-769.933) * (-772.005) (-772.384) [-780.376] (-778.638) -- 0:00:00
3000 -- (-782.724) [-777.938] (-784.565) (-779.799) * (-775.471) (-773.046) (-784.828) [-774.878] -- 0:05:32
3500 -- (-778.994) [-773.118] (-778.098) (-774.829) * [-782.458] (-771.473) (-781.065) (-777.201) -- 0:04:44
4000 -- (-780.124) (-783.432) [-782.533] (-771.558) * (-777.736) (-773.982) (-782.597) [-776.567] -- 0:04:09
4500 -- (-777.150) (-778.152) (-778.708) [-774.274] * (-776.658) (-778.042) [-772.128] (-773.053) -- 0:03:41
5000 -- (-771.773) [-773.002] (-779.632) (-777.805) * (-782.641) (-782.535) (-776.320) [-773.263] -- 0:03:19
Average standard deviation of split frequencies: 0.104757
5500 -- [-773.789] (-777.974) (-780.946) (-782.095) * [-773.804] (-779.303) (-776.628) (-777.377) -- 0:03:00
6000 -- [-772.858] (-772.328) (-787.652) (-777.740) * (-783.831) (-773.393) (-777.607) [-773.694] -- 0:02:45
6500 -- [-776.831] (-775.017) (-774.541) (-777.418) * [-779.307] (-787.895) (-775.508) (-773.596) -- 0:02:32
7000 -- (-776.684) [-774.360] (-775.532) (-786.731) * (-774.791) (-770.858) [-773.387] (-772.393) -- 0:02:21
7500 -- (-780.616) [-772.167] (-780.147) (-777.651) * (-779.083) [-773.172] (-771.617) (-779.612) -- 0:02:12
8000 -- (-782.694) [-771.425] (-773.400) (-777.963) * (-770.958) (-780.493) (-778.711) [-777.502] -- 0:02:04
8500 -- (-773.647) [-770.062] (-782.502) (-781.870) * [-770.040] (-774.288) (-772.705) (-786.244) -- 0:01:56
9000 -- (-776.366) (-777.680) (-774.222) [-777.639] * (-775.854) (-775.677) [-772.440] (-779.225) -- 0:01:50
9500 -- [-772.566] (-775.862) (-776.974) (-773.430) * [-769.016] (-772.185) (-782.105) (-785.298) -- 0:01:44
10000 -- (-778.748) (-772.977) [-776.089] (-772.694) * (-772.138) (-772.491) (-788.400) [-777.260] -- 0:01:39
Average standard deviation of split frequencies: 0.049393
10500 -- (-776.651) (-774.555) (-779.373) [-769.398] * [-771.501] (-779.607) (-779.610) (-770.257) -- 0:01:34
11000 -- (-779.818) (-775.062) (-782.938) [-773.170] * (-779.273) (-775.942) (-770.984) [-774.350] -- 0:01:29
11500 -- (-771.178) (-780.677) [-777.005] (-775.057) * (-776.807) [-772.588] (-765.039) (-775.649) -- 0:01:25
12000 -- (-784.356) [-772.021] (-781.110) (-772.256) * (-775.519) (-769.787) (-766.598) [-779.986] -- 0:01:22
12500 -- (-778.315) [-773.206] (-781.672) (-777.654) * (-774.854) [-764.943] (-767.576) (-773.563) -- 0:01:19
13000 -- (-774.728) (-775.391) (-773.630) [-776.872] * [-770.058] (-766.804) (-767.403) (-779.112) -- 0:01:15
13500 -- (-772.158) (-775.155) (-775.135) [-775.691] * (-780.583) (-765.902) (-774.087) [-769.953] -- 0:01:13
14000 -- (-771.614) (-774.382) (-772.151) [-774.750] * (-769.967) (-766.789) (-773.883) [-772.554] -- 0:01:10
14500 -- (-774.061) [-777.335] (-777.032) (-781.400) * (-776.952) (-770.670) (-766.558) [-768.919] -- 0:01:07
15000 -- (-770.367) (-771.250) (-774.356) [-772.315] * (-779.383) [-765.633] (-768.995) (-773.680) -- 0:01:05
Average standard deviation of split frequencies: 0.043328
15500 -- (-781.514) (-776.529) (-776.580) [-768.810] * [-773.880] (-768.566) (-767.685) (-776.790) -- 0:01:03
16000 -- (-776.590) [-772.716] (-782.486) (-774.019) * (-781.933) (-769.119) (-767.737) [-776.483] -- 0:01:01
16500 -- (-779.183) [-774.590] (-779.771) (-777.214) * [-778.385] (-768.944) (-764.803) (-770.107) -- 0:00:59
17000 -- (-771.451) [-774.688] (-778.528) (-773.913) * (-784.172) (-766.105) [-766.376] (-772.760) -- 0:01:55
17500 -- [-776.506] (-776.364) (-777.777) (-774.843) * (-775.808) (-766.915) [-767.349] (-775.092) -- 0:01:52
18000 -- (-782.542) (-784.934) [-774.506] (-777.565) * [-778.718] (-765.325) (-768.637) (-781.974) -- 0:01:49
18500 -- (-780.102) (-788.565) (-771.845) [-771.105] * [-771.894] (-768.556) (-766.282) (-774.154) -- 0:01:46
19000 -- (-775.078) [-779.011] (-778.688) (-777.066) * (-776.006) (-768.866) [-765.933] (-781.022) -- 0:01:43
19500 -- [-773.139] (-776.889) (-780.691) (-773.881) * [-773.277] (-766.854) (-766.529) (-769.274) -- 0:01:40
20000 -- (-778.307) (-782.553) (-775.853) [-774.096] * [-774.863] (-766.081) (-765.317) (-777.206) -- 0:01:38
Average standard deviation of split frequencies: 0.059306
20500 -- (-779.325) (-780.939) [-774.571] (-774.156) * (-777.721) (-768.115) (-767.233) [-770.267] -- 0:01:35
21000 -- (-792.438) (-779.162) (-774.168) [-778.517] * (-776.887) [-768.594] (-765.203) (-778.123) -- 0:01:33
21500 -- [-775.070] (-775.678) (-773.150) (-774.665) * (-778.436) [-768.497] (-768.211) (-771.150) -- 0:01:31
22000 -- [-772.667] (-774.556) (-775.162) (-777.325) * (-775.045) [-765.566] (-765.371) (-770.831) -- 0:01:28
22500 -- (-787.618) (-775.414) (-778.878) [-776.255] * (-775.478) (-766.237) [-765.974] (-772.368) -- 0:01:26
23000 -- (-778.315) (-781.844) [-774.444] (-778.329) * [-775.270] (-768.300) (-772.326) (-777.306) -- 0:01:24
23500 -- (-767.364) [-789.791] (-779.855) (-775.710) * (-773.197) (-765.647) (-768.479) [-777.010] -- 0:01:23
24000 -- (-767.661) (-781.535) [-773.603] (-771.928) * (-769.680) (-766.089) [-766.438] (-778.723) -- 0:01:21
24500 -- (-770.257) (-786.611) (-777.566) [-773.157] * (-775.549) [-766.358] (-771.144) (-774.226) -- 0:01:19
25000 -- (-769.949) [-787.709] (-779.441) (-776.839) * [-776.579] (-765.939) (-766.864) (-775.729) -- 0:01:18
Average standard deviation of split frequencies: 0.045327
25500 -- (-768.362) (-779.858) (-779.491) [-777.829] * (-785.896) (-765.617) [-765.770] (-770.737) -- 0:01:16
26000 -- (-766.913) (-778.614) (-776.216) [-777.033] * (-777.924) [-767.725] (-765.062) (-775.699) -- 0:01:14
26500 -- (-770.290) [-774.383] (-776.399) (-776.792) * (-780.026) (-773.486) (-764.820) [-773.434] -- 0:01:13
27000 -- (-765.208) (-784.451) (-772.873) [-774.464] * (-773.605) (-767.997) [-767.777] (-774.849) -- 0:01:12
27500 -- [-765.310] (-765.879) (-770.384) (-776.156) * (-778.810) (-767.917) [-767.255] (-779.943) -- 0:01:10
28000 -- (-765.821) (-765.713) (-777.921) [-773.289] * (-779.922) [-776.869] (-766.285) (-771.944) -- 0:01:09
28500 -- (-767.153) (-765.849) (-769.890) [-771.041] * (-779.814) [-768.848] (-765.116) (-776.059) -- 0:01:08
29000 -- (-765.831) [-766.339] (-770.997) (-780.832) * (-777.547) (-769.830) [-765.981] (-782.902) -- 0:01:06
29500 -- (-765.707) (-765.393) (-770.115) [-782.137] * [-767.449] (-767.778) (-767.327) (-775.743) -- 0:01:05
30000 -- (-765.475) (-766.345) [-771.400] (-777.674) * (-769.366) [-764.671] (-765.927) (-783.974) -- 0:01:37
Average standard deviation of split frequencies: 0.046116
30500 -- (-767.428) (-767.077) (-778.753) [-771.193] * (-770.448) [-764.988] (-767.415) (-772.001) -- 0:01:35
31000 -- [-771.324] (-771.441) (-773.141) (-775.433) * (-768.918) (-767.877) [-767.287] (-767.375) -- 0:01:33
31500 -- (-769.467) (-767.564) (-782.285) [-770.765] * [-773.113] (-765.837) (-768.945) (-771.618) -- 0:01:32
32000 -- [-768.562] (-768.067) (-775.270) (-774.690) * (-767.947) (-766.534) (-767.418) [-766.913] -- 0:01:30
32500 -- (-774.245) (-766.360) [-775.413] (-775.909) * (-768.009) (-765.887) (-765.794) [-765.807] -- 0:01:29
33000 -- [-765.320] (-767.817) (-775.102) (-779.422) * (-772.291) (-765.525) [-766.480] (-766.116) -- 0:01:27
33500 -- (-766.749) (-767.206) [-778.756] (-779.395) * [-766.032] (-765.325) (-766.901) (-766.017) -- 0:01:26
34000 -- (-766.842) (-764.835) [-779.218] (-782.071) * [-766.517] (-766.864) (-766.555) (-766.149) -- 0:01:25
34500 -- [-765.628] (-766.497) (-770.344) (-784.071) * (-765.586) (-768.413) (-766.229) [-765.288] -- 0:01:23
35000 -- (-767.025) [-765.792] (-773.186) (-778.345) * [-765.758] (-767.342) (-769.698) (-769.365) -- 0:01:22
Average standard deviation of split frequencies: 0.042557
35500 -- (-770.064) [-767.603] (-774.622) (-778.939) * (-767.744) (-769.675) [-766.469] (-768.366) -- 0:01:21
36000 -- (-768.811) (-766.373) (-772.938) [-771.918] * (-765.884) [-770.217] (-766.171) (-766.692) -- 0:01:20
36500 -- [-766.316] (-765.010) (-781.301) (-775.833) * (-765.583) [-765.489] (-765.248) (-766.636) -- 0:01:19
37000 -- (-771.834) (-766.557) [-773.910] (-777.299) * (-766.700) [-768.097] (-766.522) (-770.014) -- 0:01:18
37500 -- (-768.001) (-765.459) [-769.197] (-776.948) * [-766.311] (-766.758) (-765.632) (-768.250) -- 0:01:17
38000 -- (-770.037) [-764.884] (-773.255) (-772.817) * (-768.287) (-767.861) [-770.230] (-766.972) -- 0:01:15
38500 -- (-770.438) (-765.542) [-772.290] (-786.279) * (-767.988) [-765.061] (-767.463) (-766.878) -- 0:01:14
39000 -- (-769.963) [-765.198] (-772.894) (-777.346) * (-770.913) [-766.290] (-768.136) (-766.629) -- 0:01:13
39500 -- [-765.736] (-765.560) (-780.258) (-787.028) * (-769.130) [-768.252] (-770.704) (-765.898) -- 0:01:12
40000 -- (-766.506) [-770.316] (-774.759) (-780.239) * (-770.480) [-767.019] (-766.492) (-773.196) -- 0:01:12
Average standard deviation of split frequencies: 0.041487
40500 -- (-768.376) (-778.771) [-779.110] (-768.450) * (-766.702) (-767.399) [-765.981] (-767.501) -- 0:01:11
41000 -- (-766.715) [-765.719] (-781.292) (-766.441) * (-765.699) [-765.597] (-766.081) (-765.005) -- 0:01:10
41500 -- [-766.789] (-767.458) (-789.417) (-767.281) * (-771.783) [-765.240] (-767.853) (-766.147) -- 0:01:09
42000 -- [-767.587] (-767.039) (-768.699) (-770.998) * (-768.664) (-765.403) [-766.064] (-765.751) -- 0:01:08
42500 -- (-767.385) (-766.809) [-770.564] (-765.682) * (-767.361) [-767.952] (-766.299) (-765.326) -- 0:01:07
43000 -- (-770.461) (-771.544) (-771.644) [-766.801] * (-768.457) [-766.863] (-767.400) (-768.593) -- 0:01:06
43500 -- (-767.883) (-766.664) (-767.923) [-767.438] * (-770.983) [-766.977] (-766.032) (-766.263) -- 0:01:05
44000 -- [-766.747] (-767.899) (-765.808) (-769.215) * (-767.553) [-766.603] (-768.568) (-764.894) -- 0:01:05
44500 -- (-765.171) (-767.617) [-765.808] (-767.118) * (-767.813) (-767.785) (-766.011) [-765.421] -- 0:01:25
45000 -- (-770.539) (-765.273) (-768.593) [-771.556] * (-771.449) [-770.560] (-765.700) (-766.854) -- 0:01:24
Average standard deviation of split frequencies: 0.040992
45500 -- (-765.625) [-765.158] (-769.107) (-768.283) * (-766.886) (-767.557) [-767.303] (-767.490) -- 0:01:23
46000 -- (-769.911) [-773.128] (-768.745) (-774.068) * (-765.715) (-766.789) [-765.954] (-766.369) -- 0:01:22
46500 -- (-767.105) [-768.042] (-769.542) (-765.594) * (-765.791) (-770.099) [-770.862] (-765.335) -- 0:01:22
47000 -- (-768.603) (-766.556) [-766.101] (-765.899) * (-766.333) (-767.149) (-767.370) [-768.556] -- 0:01:21
47500 -- (-766.946) [-765.732] (-770.543) (-765.466) * (-767.707) (-770.347) [-765.959] (-766.565) -- 0:01:20
48000 -- (-769.761) (-765.869) (-767.543) [-765.867] * (-766.539) [-765.781] (-768.112) (-766.938) -- 0:01:19
48500 -- (-766.332) [-766.228] (-765.903) (-765.872) * (-765.623) [-765.448] (-768.125) (-767.588) -- 0:01:18
49000 -- (-768.490) [-766.077] (-764.698) (-767.619) * (-764.735) (-767.790) [-769.310] (-765.017) -- 0:01:17
49500 -- [-765.075] (-766.737) (-767.868) (-766.142) * (-768.238) [-765.708] (-774.350) (-766.213) -- 0:01:16
50000 -- (-766.566) (-765.610) [-767.491] (-766.863) * (-768.888) (-766.443) (-768.234) [-770.120] -- 0:01:16
Average standard deviation of split frequencies: 0.033833
50500 -- (-767.258) (-771.706) (-768.041) [-764.800] * [-765.986] (-769.026) (-769.781) (-767.953) -- 0:01:15
51000 -- [-767.676] (-769.789) (-765.879) (-764.887) * (-770.265) (-766.419) [-767.439] (-769.183) -- 0:01:14
51500 -- (-773.938) [-764.797] (-766.197) (-767.074) * [-767.142] (-767.767) (-770.747) (-765.818) -- 0:01:13
52000 -- (-770.331) (-767.602) (-764.875) [-766.258] * (-766.686) [-765.039] (-768.644) (-768.363) -- 0:01:12
52500 -- (-768.214) (-766.572) [-765.675] (-766.742) * (-766.578) (-765.778) (-767.129) [-769.805] -- 0:01:12
53000 -- (-768.277) (-770.587) (-765.293) [-766.806] * (-765.973) [-764.910] (-770.629) (-767.271) -- 0:01:11
53500 -- (-767.740) (-768.460) (-765.329) [-767.148] * (-767.329) (-770.493) [-766.613] (-765.136) -- 0:01:10
54000 -- [-766.015] (-766.456) (-768.247) (-764.936) * (-767.913) (-769.214) (-765.187) [-767.207] -- 0:01:10
54500 -- (-768.106) [-770.080] (-769.103) (-766.960) * (-766.076) [-765.851] (-765.614) (-769.232) -- 0:01:09
55000 -- (-766.871) (-765.227) (-766.077) [-765.061] * [-764.955] (-766.344) (-767.169) (-767.754) -- 0:01:08
Average standard deviation of split frequencies: 0.031842
55500 -- (-765.406) (-766.485) (-769.864) [-768.972] * (-765.613) (-768.187) (-767.842) [-770.827] -- 0:01:08
56000 -- (-765.567) (-765.967) (-767.456) [-767.742] * (-767.373) [-766.345] (-768.339) (-767.529) -- 0:01:07
56500 -- [-766.281] (-765.711) (-765.364) (-764.807) * (-765.744) [-764.892] (-768.282) (-767.723) -- 0:01:06
57000 -- (-767.573) (-768.873) (-765.711) [-765.611] * (-767.399) [-764.888] (-771.159) (-774.780) -- 0:01:06
57500 -- [-766.443] (-765.168) (-766.576) (-767.049) * (-766.988) (-766.272) (-768.263) [-768.323] -- 0:01:05
58000 -- (-766.127) [-766.474] (-767.959) (-769.213) * [-765.796] (-766.111) (-771.159) (-772.323) -- 0:01:04
58500 -- (-767.275) (-766.082) (-768.414) [-765.664] * [-769.679] (-765.885) (-765.032) (-775.238) -- 0:01:04
59000 -- (-766.402) (-768.321) [-766.683] (-765.097) * (-769.154) (-766.747) [-767.635] (-765.799) -- 0:01:19
59500 -- (-765.351) (-767.922) [-767.746] (-764.604) * (-766.151) [-767.110] (-768.430) (-764.941) -- 0:01:19
60000 -- [-767.709] (-769.758) (-768.765) (-766.548) * (-765.305) (-767.393) [-764.622] (-771.704) -- 0:01:18
Average standard deviation of split frequencies: 0.031082
60500 -- (-766.580) (-768.008) (-766.845) [-764.793] * (-765.732) [-765.464] (-766.457) (-771.372) -- 0:01:17
61000 -- (-765.523) (-768.556) [-766.118] (-764.783) * (-766.944) [-765.782] (-765.529) (-768.660) -- 0:01:16
61500 -- (-766.426) (-765.461) (-766.105) [-764.924] * (-766.366) (-768.928) (-765.137) [-767.540] -- 0:01:16
62000 -- (-766.906) (-770.730) [-768.846] (-767.379) * (-766.617) (-769.705) [-765.947] (-768.300) -- 0:01:15
62500 -- (-765.622) (-772.728) (-766.690) [-765.179] * (-768.970) (-765.920) (-765.022) [-770.593] -- 0:01:15
63000 -- (-765.128) (-770.678) (-768.526) [-765.190] * (-767.444) (-767.435) (-764.781) [-769.285] -- 0:01:14
63500 -- [-765.914] (-767.568) (-765.543) (-766.986) * (-768.781) (-767.090) [-765.458] (-768.811) -- 0:01:13
64000 -- [-765.569] (-769.041) (-765.010) (-766.157) * (-766.846) [-766.763] (-766.406) (-767.649) -- 0:01:13
64500 -- [-766.095] (-765.044) (-768.093) (-767.284) * (-766.011) (-766.287) [-766.280] (-765.750) -- 0:01:12
65000 -- (-766.052) [-765.566] (-769.195) (-766.851) * [-765.872] (-767.373) (-772.621) (-768.827) -- 0:01:11
Average standard deviation of split frequencies: 0.031971
65500 -- [-769.894] (-769.245) (-765.796) (-771.502) * (-770.144) [-765.887] (-765.943) (-765.341) -- 0:01:11
66000 -- [-766.105] (-770.674) (-769.141) (-768.812) * (-766.429) [-766.443] (-766.575) (-766.694) -- 0:01:10
66500 -- (-768.917) [-768.772] (-768.142) (-768.916) * (-768.334) (-766.966) (-765.556) [-766.522] -- 0:01:10
67000 -- (-765.268) (-768.918) (-767.013) [-765.076] * (-769.449) (-766.258) [-766.060] (-767.478) -- 0:01:09
67500 -- [-767.445] (-773.090) (-765.354) (-765.262) * [-767.435] (-766.014) (-765.539) (-766.094) -- 0:01:09
68000 -- (-770.385) (-768.134) (-765.700) [-766.324] * (-767.692) (-769.329) (-765.960) [-765.441] -- 0:01:08
68500 -- (-766.432) (-768.218) (-765.522) [-767.036] * (-769.334) (-769.169) [-766.792] (-764.598) -- 0:01:07
69000 -- (-765.691) (-766.320) [-766.574] (-767.124) * (-766.097) (-768.081) (-765.539) [-765.994] -- 0:01:07
69500 -- (-766.036) (-768.137) [-764.531] (-768.231) * (-764.866) (-769.812) (-770.700) [-767.330] -- 0:01:06
70000 -- [-767.094] (-765.862) (-766.537) (-768.340) * (-766.158) [-767.935] (-768.152) (-765.088) -- 0:01:06
Average standard deviation of split frequencies: 0.026350
70500 -- (-765.981) (-767.342) [-764.680] (-765.998) * (-764.612) (-769.061) (-769.325) [-766.781] -- 0:01:05
71000 -- [-767.329] (-768.524) (-765.197) (-769.463) * [-764.868] (-766.849) (-766.411) (-768.356) -- 0:01:05
71500 -- [-768.975] (-769.400) (-766.192) (-776.170) * (-766.049) (-767.601) (-767.366) [-766.191] -- 0:01:04
72000 -- (-766.490) (-766.034) [-765.969] (-768.592) * [-766.152] (-770.773) (-766.732) (-767.763) -- 0:01:04
72500 -- (-767.107) (-767.079) (-767.885) [-767.843] * (-767.117) (-766.308) (-765.143) [-768.279] -- 0:01:03
73000 -- (-768.066) (-767.054) (-767.546) [-768.748] * (-766.776) (-768.336) [-764.961] (-765.683) -- 0:01:03
73500 -- (-766.615) (-768.070) (-766.431) [-766.545] * (-767.418) [-769.506] (-768.366) (-765.557) -- 0:01:03
74000 -- (-765.363) [-767.819] (-765.588) (-766.834) * (-766.713) (-765.977) [-767.126] (-767.634) -- 0:01:02
74500 -- (-767.549) [-765.030] (-767.320) (-766.143) * (-765.827) [-766.363] (-765.864) (-765.853) -- 0:01:02
75000 -- (-767.059) [-765.015] (-766.247) (-767.534) * [-767.106] (-770.060) (-768.034) (-765.773) -- 0:01:01
Average standard deviation of split frequencies: 0.023039
75500 -- (-768.262) [-765.913] (-765.622) (-765.513) * (-765.438) (-769.792) (-766.799) [-766.807] -- 0:01:13
76000 -- [-766.284] (-769.185) (-766.962) (-767.345) * [-765.357] (-767.441) (-766.573) (-765.177) -- 0:01:12
76500 -- [-765.911] (-766.207) (-765.064) (-770.198) * (-765.796) (-767.795) (-769.065) [-765.421] -- 0:01:12
77000 -- (-769.415) [-769.182] (-766.695) (-767.236) * (-771.226) (-766.980) (-768.655) [-765.683] -- 0:01:11
77500 -- (-766.778) (-766.145) (-766.080) [-765.326] * (-766.837) (-767.331) (-766.192) [-765.449] -- 0:01:11
78000 -- [-764.954] (-766.613) (-766.180) (-766.247) * (-766.582) (-766.799) (-768.128) [-765.440] -- 0:01:10
78500 -- [-764.666] (-769.568) (-766.352) (-766.326) * (-764.769) (-770.465) (-767.395) [-765.793] -- 0:01:10
79000 -- (-765.672) [-768.597] (-766.248) (-769.063) * (-766.818) [-768.748] (-765.644) (-766.438) -- 0:01:09
79500 -- (-764.848) (-765.554) [-765.892] (-767.373) * [-767.062] (-772.922) (-765.131) (-765.865) -- 0:01:09
80000 -- (-767.748) (-766.335) [-765.696] (-768.223) * [-767.019] (-768.394) (-765.307) (-766.738) -- 0:01:09
Average standard deviation of split frequencies: 0.028635
80500 -- (-766.582) (-765.868) [-766.517] (-766.368) * [-766.512] (-769.063) (-772.497) (-772.742) -- 0:01:08
81000 -- [-765.974] (-765.298) (-765.737) (-768.339) * (-769.258) (-767.276) [-765.036] (-776.068) -- 0:01:08
81500 -- (-766.825) (-764.706) [-766.970] (-770.680) * (-766.237) (-767.829) [-765.559] (-768.983) -- 0:01:07
82000 -- (-765.906) [-766.970] (-767.400) (-766.452) * (-770.202) (-766.958) [-765.023] (-769.025) -- 0:01:07
82500 -- (-767.852) (-767.896) [-768.475] (-767.983) * (-767.979) (-766.611) (-765.831) [-767.144] -- 0:01:06
83000 -- (-765.942) (-768.428) (-766.959) [-766.615] * (-768.534) (-766.667) [-765.588] (-769.371) -- 0:01:06
83500 -- (-765.503) (-764.790) (-769.258) [-769.350] * (-769.463) (-766.651) (-766.194) [-765.741] -- 0:01:05
84000 -- (-765.960) (-764.806) [-770.967] (-769.894) * (-771.995) (-766.106) (-766.865) [-765.195] -- 0:01:05
84500 -- (-767.766) (-765.807) (-765.869) [-767.635] * (-773.684) (-765.934) [-768.062] (-765.789) -- 0:01:05
85000 -- [-766.408] (-767.236) (-766.692) (-765.870) * (-766.202) [-766.384] (-769.401) (-767.406) -- 0:01:04
Average standard deviation of split frequencies: 0.029899
85500 -- (-766.435) (-765.468) (-765.732) [-766.039] * [-765.845] (-765.990) (-770.814) (-767.206) -- 0:01:04
86000 -- (-765.987) [-765.410] (-768.553) (-770.058) * (-770.158) (-765.762) (-766.744) [-765.213] -- 0:01:03
86500 -- (-768.609) (-766.742) [-768.730] (-771.545) * [-767.953] (-767.753) (-769.426) (-766.584) -- 0:01:03
87000 -- (-768.524) (-767.559) [-766.615] (-766.970) * (-765.278) (-766.781) [-768.201] (-768.576) -- 0:01:02
87500 -- (-766.853) (-766.758) [-768.881] (-772.720) * (-765.441) (-766.180) [-769.520] (-766.141) -- 0:01:02
88000 -- (-768.177) (-766.557) [-769.117] (-772.636) * (-768.972) [-766.746] (-770.133) (-766.827) -- 0:01:02
88500 -- (-768.917) (-767.722) [-768.574] (-767.976) * (-766.064) [-766.521] (-770.991) (-766.131) -- 0:01:01
89000 -- (-768.595) [-764.920] (-766.695) (-766.719) * (-766.205) (-766.330) (-766.823) [-765.237] -- 0:01:01
89500 -- (-767.258) (-766.568) [-766.687] (-766.982) * (-767.489) [-769.841] (-766.076) (-765.745) -- 0:01:01
90000 -- [-765.558] (-765.876) (-769.142) (-774.085) * (-766.759) [-767.971] (-767.632) (-765.224) -- 0:01:00
Average standard deviation of split frequencies: 0.030453
90500 -- (-769.748) [-765.623] (-768.052) (-767.531) * [-766.490] (-769.479) (-772.517) (-766.842) -- 0:01:00
91000 -- (-766.719) [-765.953] (-767.668) (-768.120) * (-765.852) [-773.540] (-767.583) (-767.657) -- 0:00:59
91500 -- [-765.900] (-766.910) (-767.854) (-765.367) * [-768.134] (-773.428) (-767.543) (-765.864) -- 0:00:59
92000 -- (-767.657) (-768.490) (-766.205) [-768.098] * [-765.080] (-766.659) (-767.395) (-767.745) -- 0:01:09
92500 -- [-764.842] (-772.330) (-766.216) (-769.760) * [-765.687] (-767.184) (-770.913) (-766.346) -- 0:01:08
93000 -- (-765.829) [-764.726] (-769.247) (-766.060) * (-765.091) [-768.147] (-770.851) (-768.693) -- 0:01:08
93500 -- [-768.982] (-765.572) (-768.239) (-766.729) * (-766.071) [-765.655] (-768.019) (-768.826) -- 0:01:07
94000 -- (-772.304) [-767.214] (-765.700) (-768.580) * [-767.237] (-765.403) (-768.805) (-768.135) -- 0:01:07
94500 -- [-766.976] (-766.862) (-769.013) (-764.753) * (-769.130) [-765.157] (-767.224) (-767.520) -- 0:01:07
95000 -- [-767.349] (-771.607) (-767.084) (-764.566) * (-770.037) (-767.867) (-766.642) [-769.583] -- 0:01:06
Average standard deviation of split frequencies: 0.024786
95500 -- [-766.046] (-769.806) (-767.390) (-764.566) * (-768.216) (-769.052) [-768.493] (-768.935) -- 0:01:06
96000 -- (-766.098) (-771.305) (-768.051) [-764.729] * (-767.521) (-768.224) [-764.734] (-768.450) -- 0:01:05
96500 -- (-771.778) (-769.016) (-765.231) [-766.281] * (-771.373) (-766.828) (-764.800) [-766.378] -- 0:01:05
97000 -- (-768.467) (-767.843) (-765.034) [-766.545] * (-767.454) (-767.683) (-767.416) [-765.653] -- 0:01:05
97500 -- (-765.675) (-767.433) (-768.246) [-765.318] * (-769.333) (-768.836) [-765.545] (-766.503) -- 0:01:04
98000 -- [-766.790] (-768.438) (-766.601) (-766.713) * (-767.165) [-766.548] (-769.283) (-766.503) -- 0:01:04
98500 -- (-765.773) [-767.410] (-765.144) (-767.010) * (-766.881) (-766.501) (-765.300) [-766.353] -- 0:01:04
99000 -- (-767.395) (-767.490) [-766.632] (-769.025) * (-766.973) [-767.527] (-767.991) (-767.671) -- 0:01:03
99500 -- (-767.053) [-769.048] (-767.117) (-766.632) * (-766.227) (-772.584) [-765.990] (-765.011) -- 0:01:03
100000 -- [-768.598] (-765.991) (-774.063) (-766.532) * (-767.391) [-768.626] (-767.760) (-770.326) -- 0:01:02
Average standard deviation of split frequencies: 0.023414
100500 -- (-767.738) [-766.053] (-772.883) (-765.290) * (-764.738) (-766.518) (-770.979) [-768.446] -- 0:01:02
101000 -- (-765.027) (-767.742) (-766.068) [-769.906] * (-765.456) (-768.264) (-765.076) [-766.859] -- 0:01:02
101500 -- (-765.140) [-765.386] (-769.387) (-767.134) * (-765.052) (-769.951) (-766.754) [-766.460] -- 0:01:01
102000 -- (-765.177) (-765.517) (-766.923) [-767.827] * [-766.790] (-771.692) (-764.587) (-766.078) -- 0:01:01
102500 -- [-765.779] (-765.065) (-768.188) (-767.796) * (-766.899) (-765.650) (-766.402) [-767.115] -- 0:01:01
103000 -- (-765.281) [-767.211] (-767.270) (-765.516) * (-766.145) [-771.027] (-766.271) (-767.334) -- 0:01:00
103500 -- [-765.747] (-767.101) (-765.761) (-765.046) * (-766.177) (-768.519) (-768.462) [-768.112] -- 0:01:00
104000 -- (-765.170) (-765.867) (-769.301) [-768.579] * (-769.974) (-768.416) (-766.497) [-767.500] -- 0:01:00
104500 -- (-765.485) [-768.780] (-768.487) (-767.701) * (-765.450) (-768.609) (-766.946) [-767.515] -- 0:00:59
105000 -- [-765.361] (-768.242) (-768.731) (-765.010) * (-767.150) (-766.140) [-765.353] (-767.644) -- 0:00:59
Average standard deviation of split frequencies: 0.021177
105500 -- (-765.809) [-765.186] (-766.665) (-767.622) * (-765.793) [-767.628] (-766.012) (-765.173) -- 0:00:59
106000 -- (-764.892) [-768.393] (-768.870) (-768.722) * (-765.889) [-766.065] (-773.782) (-764.918) -- 0:00:59
106500 -- (-764.641) (-765.727) [-766.412] (-766.577) * [-764.654] (-765.680) (-766.111) (-767.915) -- 0:00:58
107000 -- (-764.698) (-767.290) [-767.007] (-770.486) * (-766.462) (-767.029) [-769.040] (-767.959) -- 0:00:58
107500 -- (-767.047) [-768.608] (-765.591) (-769.761) * (-766.438) (-771.338) (-767.784) [-765.403] -- 0:00:58
108000 -- [-766.893] (-772.213) (-766.648) (-765.618) * [-765.611] (-767.661) (-769.992) (-765.273) -- 0:00:57
108500 -- [-767.034] (-769.935) (-765.452) (-766.562) * (-768.105) (-766.710) (-769.666) [-764.563] -- 0:00:57
109000 -- (-766.843) [-773.184] (-764.709) (-764.687) * (-767.244) (-767.123) (-769.151) [-766.797] -- 0:01:05
109500 -- (-767.695) [-770.142] (-767.002) (-767.285) * [-767.248] (-765.671) (-768.442) (-767.435) -- 0:01:05
110000 -- [-765.416] (-768.859) (-767.718) (-766.366) * (-767.419) [-768.959] (-767.105) (-765.699) -- 0:01:04
Average standard deviation of split frequencies: 0.024706
110500 -- (-766.177) [-765.109] (-765.352) (-766.383) * [-766.979] (-769.433) (-769.155) (-767.184) -- 0:01:04
111000 -- (-767.978) [-766.126] (-766.608) (-768.995) * [-764.904] (-768.677) (-768.772) (-768.660) -- 0:01:04
111500 -- [-767.041] (-764.973) (-767.155) (-768.214) * (-764.539) (-769.698) (-768.306) [-767.005] -- 0:01:03
112000 -- (-766.462) [-766.340] (-769.145) (-769.488) * (-768.266) (-765.654) (-770.930) [-766.971] -- 0:01:03
112500 -- (-767.222) [-766.016] (-769.385) (-769.523) * (-765.499) [-766.040] (-765.732) (-766.172) -- 0:01:03
113000 -- (-767.267) (-766.277) (-767.057) [-769.599] * (-769.093) (-767.676) [-767.490] (-770.556) -- 0:01:02
113500 -- [-766.098] (-764.686) (-768.578) (-766.452) * (-767.187) [-765.520] (-765.806) (-768.931) -- 0:01:02
114000 -- [-766.943] (-764.865) (-767.397) (-765.038) * (-768.824) (-765.283) (-765.774) [-768.231] -- 0:01:02
114500 -- [-766.852] (-766.255) (-765.989) (-770.405) * (-769.269) [-765.948] (-768.406) (-767.513) -- 0:01:01
115000 -- (-766.438) (-765.347) (-764.621) [-768.968] * (-767.436) (-766.400) [-767.419] (-768.413) -- 0:01:01
Average standard deviation of split frequencies: 0.022641
115500 -- (-765.272) [-764.894] (-765.092) (-771.198) * [-765.278] (-766.713) (-765.724) (-769.640) -- 0:01:01
116000 -- [-765.623] (-766.090) (-765.396) (-765.748) * [-768.429] (-765.928) (-766.550) (-767.087) -- 0:01:00
116500 -- (-765.535) [-767.131] (-765.416) (-769.745) * (-769.253) (-769.460) [-767.022] (-765.669) -- 0:01:00
117000 -- [-766.625] (-769.000) (-765.617) (-770.353) * (-766.357) [-765.548] (-770.341) (-766.657) -- 0:01:00
117500 -- (-764.995) (-767.740) (-772.169) [-768.783] * (-767.310) (-767.059) (-766.695) [-766.319] -- 0:01:00
118000 -- (-765.355) [-766.994] (-768.529) (-766.530) * [-765.553] (-769.854) (-765.556) (-766.650) -- 0:00:59
118500 -- (-769.780) (-769.579) (-767.569) [-769.416] * (-769.441) (-768.235) [-766.547] (-766.567) -- 0:00:59
119000 -- (-767.221) (-767.933) (-769.574) [-771.284] * (-768.864) [-766.919] (-768.532) (-769.318) -- 0:00:59
119500 -- (-764.863) (-766.682) [-765.996] (-766.614) * (-765.237) (-769.014) (-772.090) [-764.632] -- 0:00:58
120000 -- (-765.167) [-767.821] (-765.930) (-768.733) * (-766.503) (-765.367) (-769.050) [-768.399] -- 0:00:58
Average standard deviation of split frequencies: 0.020561
120500 -- (-765.546) [-765.174] (-768.356) (-767.601) * (-768.073) (-765.653) [-764.719] (-767.337) -- 0:00:58
121000 -- (-766.912) (-765.805) (-766.192) [-766.791] * (-766.406) (-767.410) (-766.802) [-766.236] -- 0:00:58
121500 -- (-765.159) [-765.158] (-767.664) (-766.078) * (-765.167) [-767.976] (-766.258) (-768.422) -- 0:00:57
122000 -- (-765.145) [-769.457] (-765.927) (-768.801) * [-768.017] (-765.652) (-764.509) (-766.314) -- 0:00:57
122500 -- (-768.973) (-766.665) (-766.806) [-772.325] * (-768.443) (-765.153) [-765.653] (-766.163) -- 0:00:57
123000 -- (-768.206) [-766.394] (-765.952) (-765.145) * [-766.287] (-767.291) (-767.036) (-766.889) -- 0:00:57
123500 -- (-768.534) (-767.987) (-765.506) [-769.392] * (-767.314) (-768.745) [-765.862] (-769.498) -- 0:00:56
124000 -- (-768.282) [-767.461] (-766.410) (-768.018) * (-767.272) (-766.744) [-766.645] (-765.378) -- 0:00:56
124500 -- [-765.914] (-771.916) (-765.479) (-768.886) * (-766.620) (-765.863) (-766.112) [-766.768] -- 0:00:56
125000 -- (-775.289) [-768.699] (-768.370) (-768.127) * (-767.163) [-765.429] (-765.131) (-766.539) -- 0:00:56
Average standard deviation of split frequencies: 0.021201
125500 -- (-765.966) (-766.799) (-769.044) [-767.990] * (-765.877) [-765.932] (-765.179) (-767.004) -- 0:00:55
126000 -- (-767.830) (-766.121) (-766.318) [-766.768] * [-766.273] (-768.130) (-767.043) (-766.895) -- 0:01:02
126500 -- (-768.567) [-767.560] (-765.938) (-765.351) * (-765.382) (-765.598) (-768.575) [-766.057] -- 0:01:02
127000 -- (-766.568) (-769.364) [-767.575] (-769.503) * (-765.968) (-766.197) (-769.003) [-766.101] -- 0:01:01
127500 -- (-765.886) (-767.309) [-766.457] (-769.407) * [-766.962] (-766.835) (-768.930) (-770.378) -- 0:01:01
128000 -- (-769.503) (-766.887) [-764.890] (-766.580) * (-767.434) (-766.188) (-769.941) [-768.632] -- 0:01:01
128500 -- [-765.986] (-766.571) (-765.885) (-773.390) * (-768.486) [-768.009] (-766.480) (-765.440) -- 0:01:01
129000 -- (-766.827) (-768.498) [-766.066] (-773.648) * [-769.219] (-767.684) (-771.056) (-765.816) -- 0:01:00
129500 -- [-766.051] (-765.947) (-765.425) (-768.277) * (-767.684) [-769.654] (-768.328) (-769.009) -- 0:01:00
130000 -- (-765.465) (-766.742) [-767.812] (-768.580) * (-769.944) [-767.399] (-767.015) (-770.871) -- 0:01:00
Average standard deviation of split frequencies: 0.022162
130500 -- (-764.956) (-766.129) (-768.546) [-769.146] * (-768.363) (-768.020) [-765.738] (-769.464) -- 0:00:59
131000 -- (-765.988) (-765.824) [-765.306] (-773.095) * (-767.284) (-771.588) (-766.492) [-768.990] -- 0:00:59
131500 -- [-765.203] (-766.283) (-768.138) (-769.257) * (-767.738) [-766.437] (-766.635) (-767.394) -- 0:00:59
132000 -- (-766.390) [-765.388] (-770.643) (-768.270) * (-765.209) (-765.348) (-764.721) [-771.546] -- 0:00:59
132500 -- (-766.023) (-767.417) (-765.915) [-766.150] * (-771.325) [-767.212] (-766.496) (-771.023) -- 0:00:58
133000 -- (-765.204) [-766.973] (-765.961) (-765.422) * (-768.927) (-767.177) (-765.853) [-767.914] -- 0:00:58
133500 -- [-765.164] (-766.525) (-766.231) (-770.770) * (-767.215) [-767.195] (-766.669) (-765.984) -- 0:00:58
134000 -- (-769.278) (-765.999) [-767.875] (-767.315) * (-767.148) (-768.687) [-766.573] (-767.465) -- 0:00:58
134500 -- (-769.126) [-768.164] (-768.077) (-765.745) * [-765.212] (-766.902) (-766.959) (-765.387) -- 0:00:57
135000 -- (-768.050) [-769.401] (-767.629) (-766.648) * (-769.339) (-767.833) [-766.469] (-769.858) -- 0:00:57
Average standard deviation of split frequencies: 0.020797
135500 -- (-767.641) (-766.495) [-767.266] (-765.099) * (-769.980) (-768.942) [-766.837] (-768.582) -- 0:00:57
136000 -- (-765.554) (-767.617) [-765.628] (-764.618) * (-770.203) (-772.294) (-767.977) [-767.663] -- 0:00:57
136500 -- [-767.795] (-768.127) (-766.102) (-770.457) * [-765.627] (-771.412) (-766.203) (-767.305) -- 0:00:56
137000 -- (-770.828) (-765.594) [-765.797] (-766.016) * [-766.864] (-767.085) (-766.806) (-766.896) -- 0:00:56
137500 -- [-769.665] (-765.147) (-769.681) (-768.707) * [-765.079] (-770.958) (-766.896) (-769.431) -- 0:00:56
138000 -- [-765.232] (-764.862) (-766.492) (-771.536) * (-765.967) [-765.317] (-767.167) (-768.123) -- 0:00:56
138500 -- (-766.551) (-766.093) [-765.808] (-768.570) * (-770.091) [-765.959] (-767.975) (-768.679) -- 0:00:55
139000 -- (-765.740) [-767.075] (-766.507) (-767.861) * [-765.464] (-768.391) (-767.532) (-765.433) -- 0:00:55
139500 -- (-770.409) (-766.205) (-766.867) [-768.850] * (-765.747) (-767.755) [-766.071] (-770.869) -- 0:00:55
140000 -- [-771.466] (-766.161) (-770.831) (-767.945) * (-768.000) (-766.826) [-765.376] (-766.293) -- 0:00:55
Average standard deviation of split frequencies: 0.021871
140500 -- (-773.659) (-768.079) (-770.710) [-765.650] * (-766.673) (-766.469) (-765.229) [-768.300] -- 0:00:55
141000 -- (-771.070) (-768.665) (-766.979) [-765.312] * (-769.014) (-765.792) (-769.704) [-765.684] -- 0:00:54
141500 -- (-770.435) (-765.068) [-768.131] (-765.818) * (-766.012) (-766.650) (-769.418) [-766.806] -- 0:00:54
142000 -- (-770.151) [-767.020] (-766.497) (-768.642) * (-770.274) (-770.217) (-768.568) [-768.071] -- 0:00:54
142500 -- (-770.110) (-765.930) [-767.994] (-765.524) * (-764.748) [-768.088] (-766.719) (-769.539) -- 0:01:00
143000 -- (-765.193) [-766.266] (-767.407) (-765.495) * (-766.210) (-768.622) [-765.701] (-769.897) -- 0:00:59
143500 -- (-767.425) (-769.355) (-767.677) [-766.076] * (-767.757) (-767.620) [-766.827] (-770.215) -- 0:00:59
144000 -- (-768.838) (-765.371) (-765.198) [-768.919] * (-766.156) [-767.555] (-767.997) (-767.565) -- 0:00:59
144500 -- (-771.006) (-765.417) [-765.604] (-769.369) * [-765.803] (-767.544) (-768.019) (-767.520) -- 0:00:59
145000 -- (-768.514) (-768.235) [-767.464] (-767.330) * (-767.010) [-769.131] (-769.519) (-768.912) -- 0:00:58
Average standard deviation of split frequencies: 0.022432
145500 -- [-766.729] (-774.135) (-769.927) (-768.927) * (-773.522) [-766.639] (-771.223) (-768.124) -- 0:00:58
146000 -- (-765.444) [-767.648] (-765.101) (-766.867) * (-771.150) (-766.659) (-767.249) [-768.343] -- 0:00:58
146500 -- (-764.778) (-767.726) (-765.117) [-766.011] * (-766.694) [-765.402] (-769.638) (-765.903) -- 0:00:58
147000 -- (-764.978) (-765.254) [-765.352] (-766.332) * (-765.321) (-766.606) [-767.791] (-769.605) -- 0:00:58
147500 -- (-767.967) [-768.357] (-766.631) (-766.939) * (-767.420) (-769.990) [-765.622] (-769.165) -- 0:00:57
148000 -- [-766.722] (-767.633) (-766.840) (-768.885) * (-769.824) (-766.013) [-765.607] (-766.007) -- 0:00:57
148500 -- (-769.119) (-767.559) [-764.951] (-770.538) * (-773.152) (-766.446) (-766.889) [-766.409] -- 0:00:57
149000 -- (-765.870) (-769.706) [-767.820] (-768.163) * (-765.466) (-767.986) [-767.423] (-768.736) -- 0:00:57
149500 -- (-771.292) (-767.143) (-765.036) [-766.833] * (-767.188) (-767.859) [-765.540] (-767.611) -- 0:00:56
150000 -- (-774.077) (-768.398) [-766.514] (-768.879) * [-767.678] (-766.098) (-768.319) (-766.094) -- 0:00:56
Average standard deviation of split frequencies: 0.023219
150500 -- (-768.766) [-767.877] (-767.713) (-767.008) * (-768.415) [-765.192] (-766.706) (-767.200) -- 0:00:56
151000 -- [-768.307] (-773.398) (-767.071) (-765.771) * (-765.883) (-766.140) (-768.042) [-767.885] -- 0:00:56
151500 -- (-768.550) (-767.748) [-765.277] (-764.725) * (-764.955) (-768.326) [-765.062] (-766.012) -- 0:00:56
152000 -- (-769.045) (-765.240) (-765.085) [-768.166] * [-765.694] (-775.617) (-765.454) (-768.276) -- 0:00:55
152500 -- (-767.397) (-767.831) (-765.911) [-766.087] * (-766.581) (-768.396) [-767.602] (-767.557) -- 0:00:55
153000 -- (-767.641) (-766.692) [-767.255] (-766.184) * [-769.015] (-765.556) (-765.973) (-767.974) -- 0:00:55
153500 -- (-765.890) (-767.859) [-767.083] (-767.132) * (-765.901) (-765.380) [-765.428] (-765.682) -- 0:00:55
154000 -- (-766.237) (-768.408) (-766.281) [-765.103] * [-765.324] (-764.518) (-766.643) (-771.049) -- 0:00:54
154500 -- [-767.618] (-767.411) (-771.868) (-767.581) * (-766.839) (-766.274) [-768.344] (-766.920) -- 0:00:54
155000 -- (-772.842) (-769.247) [-770.006] (-765.641) * (-765.337) (-766.934) (-767.542) [-768.360] -- 0:00:54
Average standard deviation of split frequencies: 0.022107
155500 -- (-765.345) (-768.751) [-770.300] (-765.205) * (-766.695) (-766.699) [-768.624] (-765.907) -- 0:00:54
156000 -- (-765.343) [-769.077] (-768.152) (-767.424) * [-767.476] (-768.738) (-767.195) (-765.187) -- 0:00:54
156500 -- (-766.764) [-765.889] (-771.656) (-767.131) * [-767.794] (-768.418) (-765.899) (-766.104) -- 0:00:53
157000 -- [-766.917] (-769.910) (-766.785) (-766.485) * (-767.419) (-766.201) [-767.763] (-765.863) -- 0:00:53
157500 -- [-766.332] (-766.282) (-766.858) (-765.132) * (-766.391) [-765.997] (-771.344) (-768.056) -- 0:00:53
158000 -- (-768.571) (-767.986) [-767.437] (-767.871) * (-770.870) (-767.103) [-767.080] (-767.745) -- 0:00:53
158500 -- (-765.020) (-767.403) [-767.902] (-765.891) * (-770.640) (-767.515) [-768.019] (-766.010) -- 0:00:53
159000 -- (-765.788) (-769.451) (-767.493) [-767.537] * (-768.346) (-765.986) (-772.268) [-767.374] -- 0:00:52
159500 -- (-768.773) [-767.037] (-766.437) (-767.503) * (-768.157) (-765.027) (-766.580) [-771.389] -- 0:00:57
160000 -- (-764.983) (-765.896) (-766.298) [-766.906] * (-772.621) (-768.313) (-765.515) [-766.119] -- 0:00:57
Average standard deviation of split frequencies: 0.021516
160500 -- [-765.436] (-765.589) (-766.576) (-767.530) * (-769.015) (-767.674) [-765.571] (-766.665) -- 0:00:57
161000 -- (-768.400) [-764.527] (-766.312) (-767.316) * (-767.745) (-764.977) [-765.880] (-766.220) -- 0:00:57
161500 -- (-769.218) [-765.658] (-768.102) (-767.411) * (-767.836) [-765.779] (-765.142) (-765.937) -- 0:00:57
162000 -- (-768.819) [-765.305] (-772.485) (-767.664) * (-768.437) (-766.503) (-767.684) [-765.059] -- 0:00:56
162500 -- (-771.455) (-766.272) (-764.820) [-765.730] * (-766.588) [-766.727] (-765.984) (-772.848) -- 0:00:56
163000 -- (-765.460) (-766.087) [-766.432] (-766.528) * (-766.769) (-767.253) [-766.663] (-769.845) -- 0:00:56
163500 -- (-767.379) (-768.123) [-766.432] (-765.494) * (-765.396) (-769.060) (-767.119) [-764.658] -- 0:00:56
164000 -- (-766.229) (-768.322) (-767.152) [-765.922] * (-765.013) (-766.787) [-768.966] (-766.822) -- 0:00:56
164500 -- (-767.455) [-766.059] (-768.082) (-767.947) * (-767.249) [-767.007] (-768.745) (-765.000) -- 0:00:55
165000 -- [-767.253] (-766.311) (-767.016) (-764.803) * (-768.403) [-768.105] (-768.644) (-764.766) -- 0:00:55
Average standard deviation of split frequencies: 0.021523
165500 -- [-765.784] (-770.858) (-769.162) (-766.134) * (-766.436) (-767.887) [-767.830] (-764.891) -- 0:00:55
166000 -- (-768.711) (-770.519) (-769.189) [-765.270] * [-767.196] (-766.445) (-770.689) (-772.530) -- 0:00:55
166500 -- [-764.722] (-770.557) (-766.027) (-769.757) * (-765.739) (-767.358) [-767.379] (-768.245) -- 0:00:55
167000 -- (-767.653) (-766.431) (-771.733) [-767.946] * [-766.854] (-764.770) (-766.353) (-767.751) -- 0:00:54
167500 -- (-766.911) (-766.090) (-770.682) [-769.458] * (-766.396) [-766.627] (-765.296) (-768.998) -- 0:00:54
168000 -- (-769.561) (-765.349) (-770.618) [-768.824] * (-767.908) [-766.563] (-768.096) (-766.606) -- 0:00:54
168500 -- [-771.340] (-765.298) (-770.060) (-766.320) * [-768.224] (-767.675) (-767.364) (-765.864) -- 0:00:54
169000 -- [-768.343] (-764.854) (-768.899) (-766.458) * (-769.055) (-766.578) (-766.911) [-765.661] -- 0:00:54
169500 -- [-766.735] (-765.488) (-765.904) (-766.144) * (-766.202) [-767.016] (-766.718) (-766.286) -- 0:00:53
170000 -- (-765.713) (-764.624) (-765.459) [-767.229] * [-766.076] (-765.059) (-766.964) (-765.953) -- 0:00:53
Average standard deviation of split frequencies: 0.019028
170500 -- [-771.081] (-766.376) (-764.949) (-765.215) * (-765.633) (-765.823) [-766.580] (-764.822) -- 0:00:53
171000 -- [-767.150] (-765.899) (-765.924) (-765.568) * [-767.824] (-767.108) (-771.635) (-766.712) -- 0:00:53
171500 -- (-766.122) (-766.206) [-765.370] (-766.828) * [-766.979] (-767.491) (-766.617) (-768.260) -- 0:00:53
172000 -- (-766.844) [-765.850] (-770.216) (-767.776) * (-767.000) (-766.939) (-766.812) [-765.721] -- 0:00:52
172500 -- [-768.257] (-766.307) (-767.148) (-765.854) * (-766.443) (-771.762) [-774.755] (-769.484) -- 0:00:52
173000 -- (-765.812) (-767.054) [-766.262] (-765.774) * [-770.033] (-768.454) (-767.863) (-766.229) -- 0:00:52
173500 -- (-767.420) (-765.644) [-768.660] (-767.692) * [-766.145] (-766.537) (-765.624) (-773.324) -- 0:00:52
174000 -- (-766.555) (-765.823) [-767.476] (-766.958) * (-768.532) (-771.431) [-765.839] (-774.449) -- 0:00:52
174500 -- (-766.039) (-768.075) (-765.428) [-765.853] * (-766.165) (-769.639) [-766.988] (-765.423) -- 0:00:52
175000 -- (-765.197) (-767.526) [-767.223] (-765.715) * [-765.887] (-768.865) (-767.085) (-767.027) -- 0:00:51
Average standard deviation of split frequencies: 0.018600
175500 -- (-764.761) (-764.640) [-764.933] (-767.292) * (-768.279) (-770.587) (-768.621) [-764.732] -- 0:00:51
176000 -- (-764.714) (-764.776) [-764.999] (-767.393) * (-768.790) (-765.440) (-767.285) [-769.288] -- 0:00:56
176500 -- (-765.550) (-765.014) (-765.658) [-765.236] * [-764.940] (-767.114) (-766.451) (-770.432) -- 0:00:55
177000 -- (-768.017) (-764.823) [-769.063] (-766.374) * (-765.934) [-766.401] (-765.432) (-766.493) -- 0:00:55
177500 -- (-767.415) [-766.049] (-767.209) (-765.658) * [-765.045] (-766.958) (-765.523) (-766.400) -- 0:00:55
178000 -- (-768.236) (-766.796) [-765.626] (-765.699) * [-768.443] (-766.684) (-765.966) (-766.827) -- 0:00:55
178500 -- (-769.400) (-766.788) [-764.511] (-766.129) * (-766.035) (-767.360) (-765.484) [-767.740] -- 0:00:55
179000 -- [-767.870] (-766.964) (-766.006) (-773.580) * (-766.940) (-766.187) (-768.100) [-765.700] -- 0:00:55
179500 -- (-767.979) (-769.207) [-767.159] (-766.499) * (-768.521) [-770.851] (-771.227) (-765.135) -- 0:00:54
180000 -- (-765.640) [-769.004] (-769.755) (-766.222) * [-767.776] (-769.376) (-768.442) (-766.622) -- 0:00:54
Average standard deviation of split frequencies: 0.015800
180500 -- (-768.266) (-771.970) [-771.735] (-766.014) * [-766.925] (-765.006) (-765.549) (-766.809) -- 0:00:54
181000 -- (-768.024) (-769.263) [-767.787] (-769.459) * [-766.241] (-767.304) (-765.939) (-771.430) -- 0:00:54
181500 -- (-765.918) (-766.816) [-769.769] (-766.736) * (-766.423) [-766.280] (-768.271) (-766.661) -- 0:00:54
182000 -- (-775.310) (-767.146) [-768.078] (-766.115) * (-766.883) (-768.093) [-768.093] (-767.531) -- 0:00:53
182500 -- (-765.591) [-765.462] (-769.350) (-768.249) * (-766.423) (-768.349) [-767.742] (-766.020) -- 0:00:53
183000 -- [-767.916] (-765.379) (-767.283) (-766.648) * (-771.751) [-768.307] (-768.761) (-767.855) -- 0:00:53
183500 -- (-765.515) (-766.287) [-767.997] (-766.946) * (-769.541) (-771.909) [-767.688] (-767.039) -- 0:00:53
184000 -- [-771.483] (-766.255) (-768.501) (-766.919) * [-768.711] (-768.522) (-766.494) (-773.737) -- 0:00:53
184500 -- (-766.599) (-767.878) [-766.807] (-765.784) * [-766.214] (-765.156) (-767.429) (-767.401) -- 0:00:53
185000 -- [-765.926] (-768.271) (-765.028) (-769.158) * (-765.827) (-765.204) [-767.734] (-765.958) -- 0:00:52
Average standard deviation of split frequencies: 0.015066
185500 -- (-765.138) [-765.812] (-766.319) (-766.045) * (-765.850) [-766.999] (-769.765) (-767.035) -- 0:00:52
186000 -- (-768.491) [-766.628] (-765.613) (-768.148) * (-766.681) [-766.474] (-766.548) (-769.203) -- 0:00:52
186500 -- (-770.463) (-768.880) (-768.183) [-766.210] * [-768.175] (-768.675) (-765.007) (-767.136) -- 0:00:52
187000 -- (-765.912) (-768.536) [-767.443] (-766.321) * (-767.907) [-767.106] (-768.231) (-767.267) -- 0:00:52
187500 -- [-766.333] (-766.322) (-766.448) (-767.681) * (-767.626) (-767.190) (-766.697) [-767.454] -- 0:00:52
188000 -- (-766.875) (-768.411) [-766.526] (-766.495) * [-766.170] (-765.053) (-768.460) (-768.192) -- 0:00:51
188500 -- [-771.006] (-766.863) (-769.368) (-765.177) * (-764.816) [-765.134] (-767.805) (-765.467) -- 0:00:51
189000 -- (-770.055) (-767.205) (-768.438) [-764.852] * (-765.586) [-767.281] (-768.142) (-767.179) -- 0:00:51
189500 -- (-768.602) [-765.862] (-768.021) (-764.803) * [-767.534] (-765.582) (-766.553) (-764.630) -- 0:00:51
190000 -- [-769.266] (-769.526) (-767.472) (-765.154) * (-765.982) (-767.925) (-765.279) [-766.101] -- 0:00:51
Average standard deviation of split frequencies: 0.014980
190500 -- (-769.085) (-766.796) (-766.110) [-768.339] * (-769.090) (-767.684) [-765.682] (-771.110) -- 0:00:50
191000 -- [-767.896] (-765.500) (-765.190) (-767.292) * (-767.435) [-766.463] (-765.337) (-768.128) -- 0:00:50
191500 -- (-764.831) (-770.029) [-766.844] (-768.033) * (-765.735) (-770.129) (-767.851) [-766.257] -- 0:00:50
192000 -- [-766.741] (-765.607) (-765.925) (-767.738) * (-766.939) (-767.125) [-766.582] (-767.592) -- 0:00:50
192500 -- (-765.920) (-767.477) (-766.305) [-765.784] * (-766.715) (-767.348) (-765.781) [-767.041] -- 0:00:54
193000 -- (-771.377) (-766.659) (-765.969) [-765.606] * [-766.539] (-768.023) (-765.245) (-765.538) -- 0:00:54
193500 -- (-770.620) [-765.272] (-765.487) (-765.555) * (-764.963) (-767.009) [-765.269] (-766.783) -- 0:00:54
194000 -- (-765.514) (-766.696) [-765.906] (-765.254) * (-764.966) (-765.705) (-765.122) [-769.847] -- 0:00:54
194500 -- (-770.282) [-767.975] (-766.341) (-766.576) * (-770.282) (-768.049) (-767.286) [-767.850] -- 0:00:53
195000 -- (-767.776) [-766.508] (-765.114) (-766.135) * (-767.788) [-767.676] (-765.533) (-769.497) -- 0:00:53
Average standard deviation of split frequencies: 0.014832
195500 -- (-766.432) (-767.778) (-765.246) [-765.779] * (-768.542) (-767.594) (-765.137) [-766.480] -- 0:00:53
196000 -- (-765.640) [-766.184] (-765.293) (-765.545) * (-769.161) (-766.635) (-764.976) [-766.815] -- 0:00:53
196500 -- (-766.653) (-767.236) [-765.771] (-765.273) * (-769.281) (-769.183) [-768.082] (-767.319) -- 0:00:53
197000 -- (-767.287) (-766.916) (-768.007) [-764.776] * (-768.779) [-766.786] (-767.371) (-767.003) -- 0:00:52
197500 -- (-767.656) (-765.768) [-766.310] (-765.940) * (-767.700) (-768.109) [-769.525] (-768.719) -- 0:00:52
198000 -- [-765.096] (-766.488) (-765.778) (-765.327) * (-764.729) (-766.809) [-766.032] (-770.902) -- 0:00:52
198500 -- (-765.883) [-766.177] (-767.032) (-768.638) * [-764.526] (-768.100) (-765.654) (-765.821) -- 0:00:52
199000 -- (-766.140) (-766.929) (-770.067) [-768.501] * (-765.380) (-765.878) (-765.845) [-767.816] -- 0:00:52
199500 -- (-766.863) (-765.987) [-767.309] (-767.369) * (-765.343) [-764.773] (-767.780) (-768.227) -- 0:00:52
200000 -- [-771.569] (-765.932) (-766.864) (-767.372) * (-765.458) (-770.852) [-766.690] (-767.454) -- 0:00:51
Average standard deviation of split frequencies: 0.014878
200500 -- (-767.379) (-765.077) (-765.303) [-768.830] * [-766.062] (-767.737) (-767.362) (-771.832) -- 0:00:51
201000 -- [-769.147] (-766.454) (-765.795) (-769.933) * (-767.434) (-766.669) [-765.338] (-769.104) -- 0:00:51
201500 -- [-768.050] (-767.333) (-767.837) (-766.757) * (-767.912) (-766.104) [-765.059] (-765.810) -- 0:00:51
202000 -- [-770.358] (-767.203) (-768.892) (-767.759) * (-767.440) [-764.760] (-765.633) (-766.598) -- 0:00:51
202500 -- (-770.900) [-767.962] (-767.397) (-768.699) * (-768.086) (-766.885) (-767.802) [-768.126] -- 0:00:51
203000 -- (-770.311) (-768.288) (-765.352) [-766.494] * [-765.464] (-766.254) (-768.212) (-764.816) -- 0:00:51
203500 -- (-769.205) (-766.299) (-766.207) [-768.523] * (-764.977) (-769.867) [-769.762] (-767.743) -- 0:00:50
204000 -- (-765.911) (-764.926) [-765.328] (-767.238) * [-764.772] (-768.592) (-767.459) (-767.323) -- 0:00:50
204500 -- [-770.279] (-765.115) (-766.242) (-767.622) * (-765.316) [-765.980] (-770.541) (-766.160) -- 0:00:50
205000 -- (-768.793) [-765.273] (-766.386) (-766.332) * (-769.040) (-769.200) [-766.230] (-767.190) -- 0:00:50
Average standard deviation of split frequencies: 0.015176
205500 -- (-766.532) [-765.602] (-774.224) (-766.794) * [-768.056] (-765.222) (-764.780) (-768.365) -- 0:00:50
206000 -- [-768.056] (-766.532) (-767.924) (-768.007) * (-769.179) [-767.035] (-769.034) (-767.590) -- 0:00:50
206500 -- (-770.224) (-767.597) (-766.792) [-766.806] * (-765.314) (-768.881) (-767.063) [-766.860] -- 0:00:49
207000 -- [-767.254] (-766.049) (-768.892) (-765.357) * (-766.585) (-765.671) [-765.766] (-768.869) -- 0:00:49
207500 -- [-767.222] (-766.822) (-767.005) (-764.803) * (-764.904) [-765.128] (-768.520) (-767.295) -- 0:00:49
208000 -- [-765.885] (-765.516) (-771.057) (-765.023) * (-764.840) (-765.291) [-766.273] (-768.782) -- 0:00:49
208500 -- [-765.925] (-768.590) (-765.728) (-767.128) * [-766.407] (-768.123) (-765.432) (-769.163) -- 0:00:49
209000 -- (-765.527) (-767.921) (-771.285) [-765.350] * (-766.920) (-765.054) (-765.934) [-768.631] -- 0:00:49
209500 -- (-766.583) [-766.053] (-765.969) (-769.670) * [-766.947] (-768.030) (-766.698) (-766.686) -- 0:00:52
210000 -- [-765.297] (-767.378) (-765.756) (-769.463) * (-768.746) (-766.914) (-766.090) [-765.845] -- 0:00:52
Average standard deviation of split frequencies: 0.017313
210500 -- (-767.466) (-770.040) [-769.851] (-765.545) * (-769.359) (-765.509) (-766.860) [-767.109] -- 0:00:52
211000 -- (-765.378) (-766.327) [-768.774] (-767.597) * [-766.697] (-764.920) (-768.505) (-767.010) -- 0:00:52
211500 -- [-766.098] (-766.531) (-768.466) (-766.072) * (-765.705) (-766.749) (-770.461) [-767.614] -- 0:00:52
212000 -- (-766.999) (-766.222) [-764.981] (-770.803) * (-764.630) (-765.100) (-766.147) [-766.482] -- 0:00:52
212500 -- (-766.622) (-767.995) [-766.483] (-768.669) * [-764.872] (-768.047) (-768.002) (-767.470) -- 0:00:51
213000 -- (-764.776) (-766.143) [-766.626] (-765.182) * (-766.466) [-766.263] (-768.185) (-764.708) -- 0:00:51
213500 -- [-769.414] (-765.002) (-766.503) (-765.909) * (-766.574) (-766.042) [-765.442] (-765.593) -- 0:00:51
214000 -- (-768.800) [-766.617] (-766.958) (-766.917) * (-767.278) [-767.140] (-765.341) (-765.824) -- 0:00:51
214500 -- (-767.383) [-766.453] (-764.811) (-767.992) * (-767.189) [-765.753] (-766.693) (-770.829) -- 0:00:51
215000 -- (-764.578) (-765.883) [-767.279] (-770.179) * (-768.001) (-767.306) (-766.993) [-765.198] -- 0:00:51
Average standard deviation of split frequencies: 0.017944
215500 -- (-766.239) [-769.919] (-766.106) (-767.889) * (-765.925) (-767.872) [-766.254] (-766.948) -- 0:00:50
216000 -- (-768.550) (-764.844) (-764.884) [-768.230] * (-765.882) (-764.499) (-767.230) [-767.309] -- 0:00:50
216500 -- (-768.893) (-765.713) (-765.011) [-768.400] * [-765.526] (-766.520) (-769.939) (-766.493) -- 0:00:50
217000 -- [-768.205] (-768.660) (-765.808) (-766.575) * [-766.817] (-765.093) (-766.375) (-770.673) -- 0:00:50
217500 -- (-766.356) (-767.472) (-765.595) [-764.977] * (-773.065) [-765.453] (-768.816) (-765.699) -- 0:00:50
218000 -- (-766.687) [-766.519] (-766.875) (-767.870) * [-766.494] (-765.995) (-768.464) (-768.388) -- 0:00:50
218500 -- (-766.905) (-766.269) (-767.665) [-767.221] * [-766.381] (-765.248) (-767.979) (-766.204) -- 0:00:50
219000 -- (-764.985) (-766.276) [-767.133] (-765.737) * [-765.321] (-766.026) (-766.651) (-767.563) -- 0:00:49
219500 -- [-766.128] (-768.778) (-767.639) (-767.418) * (-765.384) [-764.811] (-766.486) (-765.366) -- 0:00:49
220000 -- (-769.520) [-767.811] (-769.082) (-765.932) * (-766.045) [-765.654] (-767.809) (-769.369) -- 0:00:49
Average standard deviation of split frequencies: 0.016462
220500 -- [-766.359] (-768.283) (-768.410) (-765.295) * [-770.101] (-767.529) (-773.914) (-767.285) -- 0:00:49
221000 -- (-765.699) (-767.062) [-765.836] (-764.888) * (-766.207) (-767.686) [-766.636] (-767.652) -- 0:00:49
221500 -- [-765.723] (-766.845) (-766.206) (-765.634) * (-766.156) (-766.024) [-767.403] (-768.337) -- 0:00:49
222000 -- [-766.769] (-769.164) (-764.683) (-773.008) * (-765.396) (-771.603) (-766.164) [-766.822] -- 0:00:49
222500 -- (-767.981) [-766.650] (-765.549) (-766.877) * (-765.437) [-766.874] (-767.009) (-766.889) -- 0:00:48
223000 -- (-770.774) (-766.047) [-765.278] (-769.114) * (-766.541) [-765.102] (-767.025) (-766.783) -- 0:00:48
223500 -- [-769.579] (-765.868) (-766.459) (-768.849) * (-766.709) [-765.425] (-766.372) (-769.755) -- 0:00:48
224000 -- (-766.502) [-769.086] (-765.785) (-768.118) * (-767.609) [-765.835] (-771.538) (-771.766) -- 0:00:48
224500 -- (-767.585) [-769.601] (-766.555) (-767.121) * [-768.834] (-765.468) (-769.179) (-768.994) -- 0:00:48
225000 -- (-776.494) (-769.734) [-769.348] (-766.951) * (-767.866) [-766.909] (-768.928) (-768.555) -- 0:00:48
Average standard deviation of split frequencies: 0.015040
225500 -- (-773.056) [-769.680] (-766.258) (-765.449) * [-766.218] (-767.505) (-767.864) (-771.265) -- 0:00:48
226000 -- [-769.175] (-769.471) (-769.419) (-767.685) * (-766.481) (-766.978) [-765.932] (-765.077) -- 0:00:51
226500 -- (-768.591) (-765.948) [-766.719] (-766.154) * (-766.014) (-766.518) (-766.361) [-769.179] -- 0:00:51
227000 -- (-771.080) (-768.055) (-767.836) [-767.686] * (-771.874) (-767.109) [-766.412] (-768.575) -- 0:00:51
227500 -- (-768.454) (-769.907) [-766.239] (-767.426) * (-770.640) (-770.742) [-767.591] (-766.917) -- 0:00:50
228000 -- (-770.738) (-766.490) (-765.472) [-765.940] * (-767.544) [-768.847] (-766.749) (-766.238) -- 0:00:50
228500 -- (-768.286) [-767.354] (-766.625) (-765.425) * (-764.632) [-766.764] (-765.799) (-767.237) -- 0:00:50
229000 -- (-766.938) (-766.578) [-765.767] (-767.110) * (-766.510) [-766.541] (-766.924) (-764.885) -- 0:00:50
229500 -- (-765.711) (-768.207) [-767.206] (-766.432) * (-764.881) (-765.976) [-767.039] (-768.791) -- 0:00:50
230000 -- (-765.501) (-769.835) (-766.085) [-766.219] * (-767.919) [-766.039] (-769.951) (-766.890) -- 0:00:50
Average standard deviation of split frequencies: 0.014951
230500 -- [-765.003] (-765.812) (-766.750) (-769.446) * (-765.753) (-770.447) [-765.861] (-765.143) -- 0:00:50
231000 -- (-765.126) (-764.510) [-766.682] (-768.293) * (-766.883) (-768.239) (-767.596) [-771.103] -- 0:00:49
231500 -- [-765.580] (-768.310) (-772.318) (-766.120) * [-768.779] (-767.106) (-767.729) (-775.711) -- 0:00:49
232000 -- [-767.978] (-772.725) (-772.873) (-766.312) * [-768.029] (-767.345) (-767.287) (-768.761) -- 0:00:49
232500 -- [-767.945] (-767.300) (-770.776) (-764.557) * (-767.016) (-767.510) [-768.193] (-768.168) -- 0:00:49
233000 -- (-767.615) (-765.655) [-769.877] (-764.512) * (-764.925) (-765.497) [-768.371] (-765.701) -- 0:00:49
233500 -- (-765.826) (-767.581) (-768.165) [-766.851] * (-772.383) (-766.841) (-769.230) [-769.169] -- 0:00:49
234000 -- (-766.692) [-767.958] (-768.423) (-765.166) * [-765.922] (-767.693) (-772.432) (-769.078) -- 0:00:49
234500 -- (-765.457) (-767.470) (-768.543) [-767.299] * (-766.755) (-769.310) [-769.587] (-766.711) -- 0:00:48
235000 -- (-765.470) [-765.844] (-766.851) (-768.646) * (-768.095) (-768.501) (-768.092) [-772.514] -- 0:00:48
Average standard deviation of split frequencies: 0.014087
235500 -- (-766.225) (-768.423) [-766.199] (-767.354) * [-767.075] (-769.003) (-766.174) (-765.380) -- 0:00:48
236000 -- (-771.990) [-767.971] (-767.705) (-767.704) * (-767.034) (-765.257) (-765.209) [-765.737] -- 0:00:48
236500 -- [-766.721] (-769.622) (-765.879) (-765.185) * (-771.078) (-767.648) (-765.324) [-766.477] -- 0:00:48
237000 -- [-765.353] (-769.405) (-765.759) (-772.236) * (-768.661) (-766.305) [-764.535] (-765.392) -- 0:00:48
237500 -- (-768.602) [-768.170] (-765.897) (-768.180) * (-769.653) (-764.963) (-768.701) [-766.287] -- 0:00:48
238000 -- (-764.813) (-766.968) [-765.960] (-766.603) * (-767.272) (-768.355) (-770.182) [-765.601] -- 0:00:48
238500 -- (-764.699) (-772.865) (-767.180) [-765.838] * [-766.740] (-765.473) (-768.155) (-765.694) -- 0:00:47
239000 -- [-768.897] (-768.854) (-769.495) (-765.805) * (-766.511) (-767.443) (-767.632) [-764.775] -- 0:00:47
239500 -- (-769.866) (-766.731) (-770.244) [-770.030] * (-766.452) (-765.876) (-770.295) [-765.206] -- 0:00:47
240000 -- (-766.923) (-766.772) (-767.541) [-768.423] * (-765.995) (-765.671) [-769.236] (-766.155) -- 0:00:47
Average standard deviation of split frequencies: 0.012577
240500 -- (-767.507) [-764.952] (-767.118) (-772.672) * (-766.485) [-768.939] (-770.895) (-766.877) -- 0:00:47
241000 -- (-767.022) [-766.910] (-766.472) (-766.249) * (-766.526) (-765.850) (-766.779) [-769.145] -- 0:00:47
241500 -- (-771.300) (-770.176) [-765.586] (-767.619) * (-768.230) [-766.329] (-767.514) (-773.223) -- 0:00:47
242000 -- (-770.526) (-766.554) [-766.156] (-768.596) * (-768.363) (-766.437) (-765.560) [-766.980] -- 0:00:46
242500 -- (-765.945) (-765.851) (-767.149) [-767.778] * (-766.650) (-767.226) [-766.975] (-769.498) -- 0:00:46
243000 -- (-765.554) [-766.941] (-767.565) (-765.497) * [-769.078] (-766.826) (-767.804) (-768.211) -- 0:00:49
243500 -- (-765.881) (-769.134) (-768.165) [-766.537] * (-768.146) [-768.281] (-769.491) (-767.970) -- 0:00:49
244000 -- (-768.942) (-768.655) [-767.049] (-766.919) * (-767.468) [-770.543] (-769.795) (-769.003) -- 0:00:49
244500 -- (-769.628) [-768.847] (-768.569) (-766.792) * (-764.580) [-767.825] (-767.018) (-770.040) -- 0:00:49
245000 -- [-765.156] (-767.336) (-766.978) (-766.795) * (-765.855) [-765.512] (-766.236) (-766.914) -- 0:00:49
Average standard deviation of split frequencies: 0.012002
245500 -- (-768.183) (-766.721) [-765.441] (-769.675) * (-768.629) [-768.540] (-768.114) (-765.664) -- 0:00:49
246000 -- (-773.582) [-766.033] (-767.670) (-767.182) * (-768.074) (-765.993) [-766.106] (-766.054) -- 0:00:49
246500 -- (-765.519) [-765.237] (-766.195) (-767.154) * [-767.241] (-767.245) (-768.531) (-770.170) -- 0:00:48
247000 -- (-767.236) (-764.911) (-769.272) [-765.673] * (-765.024) (-766.033) [-767.456] (-766.322) -- 0:00:48
247500 -- (-767.125) (-766.939) [-767.697] (-766.590) * (-767.550) [-765.139] (-765.012) (-765.516) -- 0:00:48
248000 -- (-766.778) (-769.765) [-770.476] (-770.284) * [-765.130] (-766.733) (-770.364) (-766.907) -- 0:00:48
248500 -- (-765.257) [-768.201] (-766.649) (-771.261) * [-765.770] (-767.543) (-770.434) (-765.931) -- 0:00:48
249000 -- (-766.169) (-767.055) [-769.745] (-765.831) * (-764.903) (-768.805) [-765.504] (-764.650) -- 0:00:48
249500 -- (-765.776) [-765.561] (-765.669) (-767.811) * (-765.821) (-765.713) [-765.712] (-769.706) -- 0:00:48
250000 -- (-765.776) (-764.896) (-766.621) [-770.406] * (-765.962) [-766.559] (-766.236) (-766.718) -- 0:00:48
Average standard deviation of split frequencies: 0.012506
250500 -- (-766.296) (-765.463) [-765.219] (-765.101) * (-767.967) [-768.603] (-766.672) (-767.158) -- 0:00:47
251000 -- (-765.596) [-765.553] (-766.621) (-765.083) * (-773.449) (-766.993) (-765.265) [-764.680] -- 0:00:47
251500 -- [-765.407] (-767.187) (-769.170) (-766.493) * (-770.246) [-765.249] (-767.254) (-766.569) -- 0:00:47
252000 -- [-766.640] (-767.362) (-766.642) (-767.703) * [-770.959] (-765.553) (-768.372) (-765.377) -- 0:00:47
252500 -- (-767.179) (-768.214) [-765.028] (-766.025) * (-765.939) [-764.546] (-768.116) (-766.451) -- 0:00:47
253000 -- (-767.121) (-766.260) [-767.687] (-769.811) * [-765.380] (-765.532) (-768.433) (-765.933) -- 0:00:47
253500 -- (-768.218) [-765.593] (-766.363) (-767.176) * (-766.147) [-765.703] (-771.033) (-770.899) -- 0:00:47
254000 -- (-772.748) [-766.450] (-766.861) (-766.779) * (-766.671) (-766.079) [-766.314] (-769.746) -- 0:00:46
254500 -- [-766.614] (-771.289) (-765.441) (-766.970) * (-765.077) (-767.064) (-764.707) [-769.251] -- 0:00:46
255000 -- (-767.636) [-769.650] (-765.413) (-766.861) * (-765.752) [-769.902] (-766.476) (-775.277) -- 0:00:46
Average standard deviation of split frequencies: 0.010467
255500 -- (-765.306) (-768.959) (-765.701) [-766.526] * [-765.660] (-765.439) (-769.665) (-768.440) -- 0:00:46
256000 -- (-768.482) (-767.203) [-765.850] (-767.005) * (-767.731) [-769.772] (-765.445) (-766.351) -- 0:00:46
256500 -- (-766.733) (-764.541) (-766.877) [-765.947] * (-766.464) (-766.425) [-767.278] (-770.363) -- 0:00:46
257000 -- (-767.222) [-764.885] (-770.435) (-766.390) * (-771.011) (-766.095) (-765.935) [-764.759] -- 0:00:46
257500 -- (-768.596) (-765.752) (-768.785) [-768.800] * (-766.426) (-765.728) (-766.051) [-765.595] -- 0:00:46
258000 -- [-770.351] (-765.708) (-768.367) (-771.086) * [-766.775] (-765.149) (-766.118) (-769.440) -- 0:00:46
258500 -- (-769.740) [-764.764] (-765.823) (-769.189) * (-767.295) (-768.989) [-766.703] (-767.596) -- 0:00:45
259000 -- (-770.481) (-767.122) [-765.476] (-768.612) * (-765.194) (-767.785) (-767.869) [-770.596] -- 0:00:45
259500 -- (-766.251) (-765.320) (-765.414) [-768.986] * [-765.307] (-765.334) (-769.730) (-770.882) -- 0:00:45
260000 -- (-766.399) [-766.130] (-764.772) (-767.287) * [-767.775] (-771.325) (-766.622) (-766.787) -- 0:00:48
Average standard deviation of split frequencies: 0.010147
260500 -- (-765.823) (-768.080) (-765.308) [-770.040] * (-767.703) (-765.801) (-767.164) [-765.792] -- 0:00:48
261000 -- (-767.125) [-771.588] (-767.565) (-766.974) * (-766.191) (-767.785) (-766.078) [-766.096] -- 0:00:48
261500 -- (-765.996) (-771.024) [-767.041] (-767.183) * (-769.010) [-766.585] (-765.577) (-765.963) -- 0:00:48
262000 -- [-765.838] (-770.453) (-766.039) (-773.597) * (-771.248) (-766.277) [-767.688] (-769.099) -- 0:00:47
262500 -- (-767.521) [-766.391] (-766.406) (-771.870) * (-770.063) [-765.617] (-767.069) (-764.845) -- 0:00:47
263000 -- (-767.185) [-773.520] (-765.633) (-766.040) * (-767.442) (-765.508) (-765.864) [-765.723] -- 0:00:47
263500 -- (-767.386) (-768.367) (-767.333) [-766.032] * (-766.020) (-767.823) [-766.593] (-769.915) -- 0:00:47
264000 -- (-765.840) [-766.980] (-765.754) (-769.683) * (-766.709) (-766.423) (-767.138) [-769.367] -- 0:00:47
264500 -- (-767.071) (-768.527) (-767.460) [-766.700] * (-765.843) [-766.020] (-769.993) (-768.186) -- 0:00:47
265000 -- (-765.182) [-764.883] (-766.631) (-771.575) * (-769.667) (-768.500) [-768.784] (-771.761) -- 0:00:47
Average standard deviation of split frequencies: 0.010074
265500 -- (-765.835) (-769.821) [-766.973] (-770.458) * (-765.536) (-767.647) [-766.844] (-766.548) -- 0:00:47
266000 -- (-766.034) (-775.224) (-765.956) [-765.926] * (-765.987) [-766.207] (-767.931) (-765.888) -- 0:00:46
266500 -- (-770.761) (-768.927) (-766.689) [-766.140] * (-766.052) (-766.812) [-766.056] (-767.798) -- 0:00:46
267000 -- (-767.668) (-771.343) (-764.882) [-765.293] * [-765.131] (-766.100) (-767.790) (-769.586) -- 0:00:46
267500 -- (-767.639) [-765.574] (-766.615) (-765.813) * [-766.826] (-766.248) (-766.895) (-767.729) -- 0:00:46
268000 -- (-766.176) (-768.868) (-766.289) [-765.487] * [-765.577] (-766.558) (-766.623) (-767.466) -- 0:00:46
268500 -- (-765.506) (-769.392) [-765.482] (-766.482) * (-765.941) (-765.589) [-770.779] (-766.920) -- 0:00:46
269000 -- [-768.702] (-770.773) (-768.233) (-765.603) * [-767.993] (-766.683) (-766.098) (-766.680) -- 0:00:46
269500 -- (-767.673) (-767.509) (-771.315) [-767.560] * (-764.775) (-765.299) [-765.790] (-768.405) -- 0:00:46
270000 -- [-766.711] (-768.558) (-767.910) (-765.749) * (-766.913) [-765.584] (-765.745) (-767.892) -- 0:00:45
Average standard deviation of split frequencies: 0.011825
270500 -- [-766.151] (-767.011) (-768.897) (-766.208) * (-766.814) (-766.165) [-766.176] (-770.319) -- 0:00:45
271000 -- [-766.406] (-765.742) (-769.534) (-766.785) * (-766.667) [-767.422] (-766.695) (-770.129) -- 0:00:45
271500 -- (-764.993) (-766.545) (-768.117) [-769.033] * (-766.497) [-765.016] (-769.181) (-766.616) -- 0:00:45
272000 -- (-765.815) (-765.060) (-768.189) [-766.423] * (-768.242) (-764.906) (-766.732) [-766.499] -- 0:00:45
272500 -- (-766.457) [-767.252] (-769.805) (-765.885) * (-767.488) [-766.120] (-765.535) (-766.910) -- 0:00:45
273000 -- [-767.278] (-768.306) (-768.802) (-767.591) * (-765.636) (-765.364) (-765.717) [-768.567] -- 0:00:45
273500 -- (-766.930) [-765.738] (-767.963) (-770.137) * (-765.626) (-765.159) (-770.127) [-768.231] -- 0:00:45
274000 -- [-767.551] (-765.347) (-769.386) (-766.814) * (-764.726) (-769.283) [-766.190] (-766.410) -- 0:00:45
274500 -- [-767.735] (-765.199) (-768.574) (-767.234) * (-770.144) [-767.847] (-766.002) (-766.643) -- 0:00:44
275000 -- [-768.883] (-766.635) (-766.010) (-768.715) * (-766.370) (-766.343) (-766.843) [-765.732] -- 0:00:44
Average standard deviation of split frequencies: 0.011671
275500 -- (-767.421) [-767.442] (-767.195) (-766.852) * (-764.530) [-771.165] (-767.376) (-765.891) -- 0:00:44
276000 -- (-767.337) (-765.087) [-767.453] (-767.432) * (-764.915) [-768.196] (-766.332) (-768.496) -- 0:00:44
276500 -- (-767.200) [-766.497] (-765.320) (-766.516) * [-766.614] (-765.517) (-765.613) (-765.313) -- 0:00:47
277000 -- [-766.086] (-766.610) (-769.681) (-766.288) * [-767.053] (-767.050) (-765.959) (-765.617) -- 0:00:46
277500 -- (-765.295) (-765.986) (-776.402) [-767.049] * (-770.245) (-766.303) [-766.868] (-765.573) -- 0:00:46
278000 -- (-765.983) [-768.968] (-772.262) (-770.350) * (-766.276) (-767.533) [-767.189] (-764.752) -- 0:00:46
278500 -- (-767.294) (-768.664) [-765.300] (-765.133) * (-770.712) [-764.976] (-766.250) (-765.077) -- 0:00:46
279000 -- (-766.831) (-766.249) (-766.345) [-767.965] * (-767.676) (-766.081) (-767.096) [-767.203] -- 0:00:46
279500 -- (-767.096) [-765.352] (-768.095) (-766.527) * (-766.596) (-766.495) (-770.017) [-766.486] -- 0:00:46
280000 -- (-766.848) (-767.396) (-771.167) [-770.712] * (-768.828) [-764.965] (-766.032) (-765.611) -- 0:00:46
Average standard deviation of split frequencies: 0.012317
280500 -- (-765.373) (-767.654) (-770.813) [-767.365] * [-767.314] (-768.276) (-771.099) (-766.007) -- 0:00:46
281000 -- (-765.617) [-766.755] (-767.020) (-765.504) * (-766.234) (-766.344) [-766.446] (-768.378) -- 0:00:46
281500 -- (-764.878) (-765.924) [-767.588] (-767.599) * [-767.312] (-766.777) (-769.195) (-769.046) -- 0:00:45
282000 -- (-768.368) [-766.722] (-773.536) (-768.282) * [-766.373] (-769.120) (-768.430) (-772.074) -- 0:00:45
282500 -- (-773.478) (-768.962) (-768.715) [-764.912] * (-768.061) (-766.716) [-769.316] (-771.279) -- 0:00:45
283000 -- (-765.486) (-769.584) [-766.520] (-766.323) * [-767.312] (-767.089) (-769.423) (-766.029) -- 0:00:45
283500 -- (-766.825) (-768.290) (-766.180) [-765.648] * [-769.231] (-770.585) (-767.002) (-765.917) -- 0:00:45
284000 -- (-767.782) (-766.009) (-766.279) [-766.120] * (-769.433) (-769.363) [-764.868] (-765.573) -- 0:00:45
284500 -- (-766.141) (-765.171) [-768.428] (-765.657) * (-767.312) (-766.666) [-767.582] (-765.685) -- 0:00:45
285000 -- (-765.146) (-767.340) [-768.683] (-766.733) * (-768.349) [-767.565] (-766.985) (-766.500) -- 0:00:45
Average standard deviation of split frequencies: 0.011972
285500 -- (-773.211) [-766.399] (-770.114) (-766.086) * (-766.249) [-766.429] (-765.267) (-769.894) -- 0:00:45
286000 -- (-768.467) [-766.745] (-770.876) (-765.688) * (-764.901) (-765.141) [-765.350] (-765.851) -- 0:00:44
286500 -- (-765.739) (-764.740) [-767.441] (-768.370) * (-767.479) (-767.396) (-770.396) [-767.814] -- 0:00:44
287000 -- (-769.245) (-769.227) [-766.277] (-768.386) * (-771.277) (-767.639) (-773.055) [-765.311] -- 0:00:44
287500 -- (-766.144) (-766.288) [-766.942] (-767.689) * (-768.540) (-765.735) (-773.711) [-767.866] -- 0:00:44
288000 -- (-767.261) (-772.915) (-766.299) [-766.717] * [-768.765] (-769.204) (-766.685) (-769.581) -- 0:00:44
288500 -- [-766.869] (-768.197) (-767.818) (-766.442) * (-768.963) [-766.410] (-765.711) (-765.643) -- 0:00:44
289000 -- (-770.946) [-765.024] (-765.512) (-768.087) * (-765.053) [-765.243] (-767.205) (-770.751) -- 0:00:44
289500 -- [-766.778] (-764.778) (-769.609) (-769.965) * [-765.158] (-767.575) (-767.056) (-767.381) -- 0:00:44
290000 -- (-766.736) (-765.347) [-765.849] (-770.308) * (-765.444) [-764.714] (-766.352) (-768.697) -- 0:00:44
Average standard deviation of split frequencies: 0.011011
290500 -- (-766.075) (-769.369) [-765.392] (-765.108) * [-765.777] (-766.682) (-765.531) (-768.289) -- 0:00:43
291000 -- (-766.753) [-768.086] (-766.274) (-766.186) * (-766.541) (-767.320) [-765.280] (-766.574) -- 0:00:43
291500 -- (-766.797) [-766.752] (-766.185) (-769.693) * (-766.673) (-764.659) (-766.344) [-767.212] -- 0:00:43
292000 -- [-766.714] (-767.180) (-766.746) (-767.471) * (-766.877) (-765.055) [-767.531] (-766.374) -- 0:00:43
292500 -- (-768.022) (-767.185) [-767.745] (-767.258) * (-766.281) (-764.910) (-768.564) [-766.855] -- 0:00:43
293000 -- (-769.092) (-770.560) (-770.325) [-767.040] * [-768.507] (-766.658) (-765.481) (-767.295) -- 0:00:45
293500 -- (-767.786) [-766.176] (-765.571) (-767.737) * (-766.535) [-770.032] (-765.469) (-766.375) -- 0:00:45
294000 -- (-764.768) (-767.405) [-765.892] (-768.117) * (-767.698) [-766.708] (-767.256) (-767.665) -- 0:00:45
294500 -- (-764.654) (-767.050) (-768.068) [-766.384] * (-771.589) [-768.512] (-765.147) (-768.806) -- 0:00:45
295000 -- [-765.533] (-768.491) (-769.809) (-765.957) * (-768.169) (-767.158) (-767.516) [-770.927] -- 0:00:45
Average standard deviation of split frequencies: 0.010883
295500 -- (-765.294) [-766.931] (-765.765) (-767.059) * (-766.615) (-765.218) [-766.689] (-768.325) -- 0:00:45
296000 -- (-765.032) [-766.520] (-766.442) (-768.113) * (-768.810) (-767.665) [-769.654] (-764.953) -- 0:00:45
296500 -- (-764.859) [-767.023] (-765.854) (-766.137) * (-766.958) (-769.609) [-766.993] (-767.615) -- 0:00:45
297000 -- (-766.741) (-767.102) (-766.633) [-767.709] * (-766.373) (-769.357) (-766.874) [-765.453] -- 0:00:44
297500 -- [-768.678] (-765.188) (-768.212) (-771.057) * (-769.246) (-769.016) (-766.578) [-766.038] -- 0:00:44
298000 -- (-765.855) (-766.693) (-767.105) [-766.289] * (-768.802) [-766.146] (-767.728) (-766.301) -- 0:00:44
298500 -- [-768.377] (-766.043) (-766.807) (-766.033) * [-767.653] (-768.387) (-771.022) (-769.668) -- 0:00:44
299000 -- (-771.940) (-767.471) [-765.409] (-771.895) * (-765.109) (-765.632) [-765.849] (-766.680) -- 0:00:44
299500 -- (-767.999) (-766.925) [-766.415] (-767.572) * (-765.521) (-765.084) [-768.952] (-767.108) -- 0:00:44
300000 -- (-768.165) (-765.796) (-765.929) [-765.110] * (-765.418) [-767.369] (-765.653) (-766.402) -- 0:00:44
Average standard deviation of split frequencies: 0.010053
300500 -- [-764.530] (-767.183) (-765.111) (-764.783) * [-766.712] (-766.730) (-765.347) (-767.994) -- 0:00:44
301000 -- (-767.132) (-769.540) [-764.911] (-766.000) * (-767.114) (-765.926) [-767.866] (-767.937) -- 0:00:44
301500 -- (-768.244) [-767.850] (-765.492) (-765.767) * (-766.459) (-766.752) (-768.223) [-768.778] -- 0:00:44
302000 -- (-768.406) [-770.550] (-767.860) (-766.657) * [-764.598] (-767.172) (-770.980) (-769.197) -- 0:00:43
302500 -- (-769.133) [-772.058] (-766.321) (-765.393) * (-765.344) (-765.950) [-766.751] (-766.526) -- 0:00:43
303000 -- (-767.809) (-767.085) (-769.374) [-767.773] * (-766.609) (-766.603) [-771.122] (-766.095) -- 0:00:43
303500 -- (-765.217) (-766.712) (-765.922) [-768.493] * (-764.997) [-765.187] (-769.969) (-771.221) -- 0:00:43
304000 -- (-765.129) [-767.948] (-767.656) (-769.377) * (-770.298) (-767.416) (-769.066) [-765.153] -- 0:00:43
304500 -- (-766.688) (-767.393) (-766.023) [-768.613] * (-765.576) [-767.087] (-770.979) (-765.244) -- 0:00:43
305000 -- (-767.394) (-766.059) [-765.431] (-768.861) * [-767.283] (-769.416) (-767.679) (-765.340) -- 0:00:43
Average standard deviation of split frequencies: 0.009329
305500 -- (-767.330) (-770.444) (-768.977) [-767.919] * (-767.075) (-771.025) [-766.024] (-765.383) -- 0:00:43
306000 -- (-768.279) (-769.564) [-765.260] (-767.022) * (-766.946) (-770.146) [-765.488] (-766.965) -- 0:00:43
306500 -- [-765.327] (-772.217) (-764.976) (-766.749) * (-767.379) [-767.410] (-766.575) (-766.751) -- 0:00:42
307000 -- (-765.370) [-765.239] (-770.370) (-766.596) * (-769.036) [-766.459] (-767.127) (-768.243) -- 0:00:42
307500 -- [-765.146] (-764.820) (-766.147) (-764.687) * (-770.162) [-767.651] (-766.359) (-766.871) -- 0:00:42
308000 -- [-765.184] (-765.046) (-767.604) (-770.265) * [-767.300] (-767.713) (-766.001) (-769.408) -- 0:00:42
308500 -- (-764.885) (-765.622) (-766.728) [-767.708] * (-767.262) [-768.550] (-766.143) (-767.354) -- 0:00:42
309000 -- (-770.278) [-765.055] (-769.487) (-765.871) * (-766.616) (-768.518) (-766.105) [-766.466] -- 0:00:42
309500 -- (-768.044) (-766.344) [-766.092] (-767.815) * (-765.390) (-765.013) (-765.622) [-768.946] -- 0:00:42
310000 -- (-767.214) (-767.908) [-767.915] (-765.389) * (-770.090) (-766.666) [-765.300] (-767.788) -- 0:00:44
Average standard deviation of split frequencies: 0.009104
310500 -- (-767.654) [-767.482] (-766.121) (-766.984) * [-765.149] (-768.336) (-765.264) (-768.109) -- 0:00:44
311000 -- (-767.189) (-765.387) (-767.312) [-765.087] * (-764.735) (-768.499) [-765.283] (-769.818) -- 0:00:44
311500 -- (-769.088) (-767.823) (-766.075) [-764.645] * [-767.681] (-767.037) (-765.046) (-765.883) -- 0:00:44
312000 -- (-776.437) (-766.377) (-769.099) [-767.320] * (-770.580) [-767.617] (-765.540) (-764.915) -- 0:00:44
312500 -- [-765.886] (-766.447) (-768.236) (-766.470) * (-768.044) [-765.603] (-766.132) (-767.715) -- 0:00:44
313000 -- (-765.520) [-765.017] (-767.709) (-769.267) * (-765.583) (-766.052) (-766.533) [-769.474] -- 0:00:43
313500 -- [-765.695] (-766.064) (-766.021) (-768.991) * [-765.607] (-772.701) (-765.112) (-764.913) -- 0:00:43
314000 -- (-765.850) [-766.455] (-769.794) (-773.351) * (-764.428) (-768.717) (-765.849) [-766.664] -- 0:00:43
314500 -- [-764.889] (-765.349) (-766.089) (-769.105) * (-766.978) (-768.095) (-765.876) [-766.763] -- 0:00:43
315000 -- (-765.742) (-766.355) [-767.330] (-767.887) * [-766.330] (-767.169) (-765.627) (-765.409) -- 0:00:43
Average standard deviation of split frequencies: 0.010091
315500 -- (-764.928) (-766.699) (-766.363) [-766.741] * [-765.295] (-767.886) (-766.055) (-767.305) -- 0:00:43
316000 -- (-765.432) (-765.490) (-767.540) [-765.550] * (-764.828) (-766.208) [-765.942] (-772.010) -- 0:00:43
316500 -- (-765.427) (-766.706) (-766.707) [-765.697] * (-765.995) (-766.314) (-767.406) [-769.901] -- 0:00:43
317000 -- [-765.812] (-765.712) (-765.562) (-765.804) * [-765.924] (-767.810) (-768.153) (-769.649) -- 0:00:43
317500 -- (-767.034) [-765.911] (-766.222) (-767.502) * (-765.876) (-766.272) (-767.889) [-767.642] -- 0:00:42
318000 -- [-766.043] (-765.177) (-768.120) (-768.748) * (-766.683) (-768.404) (-768.640) [-774.038] -- 0:00:42
318500 -- (-769.591) [-766.338] (-769.308) (-767.993) * (-766.837) (-769.862) [-766.402] (-771.905) -- 0:00:42
319000 -- (-766.211) (-768.290) (-770.372) [-765.800] * [-765.691] (-770.035) (-766.696) (-765.267) -- 0:00:42
319500 -- (-766.175) (-766.293) (-766.522) [-764.808] * (-766.157) [-767.133] (-771.266) (-766.069) -- 0:00:42
320000 -- (-767.329) [-766.139] (-766.549) (-764.677) * (-764.854) (-765.740) [-767.545] (-767.150) -- 0:00:42
Average standard deviation of split frequencies: 0.009555
320500 -- [-767.849] (-766.349) (-766.097) (-765.290) * (-766.662) (-765.959) (-764.690) [-765.551] -- 0:00:42
321000 -- (-773.497) [-765.729] (-768.259) (-765.342) * (-765.817) (-764.654) (-765.600) [-765.541] -- 0:00:42
321500 -- (-767.909) (-765.867) (-768.084) [-768.013] * (-766.610) (-766.197) (-768.998) [-765.571] -- 0:00:42
322000 -- [-767.244] (-765.795) (-765.913) (-767.143) * (-767.865) [-765.285] (-769.386) (-766.098) -- 0:00:42
322500 -- (-776.545) (-765.035) [-766.005] (-765.893) * (-766.887) (-766.051) (-765.089) [-766.991] -- 0:00:42
323000 -- [-765.930] (-764.989) (-767.003) (-766.982) * [-765.134] (-765.204) (-768.226) (-766.254) -- 0:00:41
323500 -- (-766.002) [-765.808] (-765.143) (-766.512) * (-765.457) (-765.809) (-765.053) [-766.995] -- 0:00:41
324000 -- (-768.006) (-765.550) [-765.368] (-768.972) * [-765.482] (-766.806) (-765.156) (-769.142) -- 0:00:41
324500 -- [-765.902] (-766.952) (-771.652) (-767.593) * (-766.805) (-768.440) [-765.801] (-768.929) -- 0:00:41
325000 -- (-767.903) (-767.362) (-774.270) [-769.810] * (-770.142) [-768.366] (-765.902) (-777.492) -- 0:00:41
Average standard deviation of split frequencies: 0.010292
325500 -- (-765.997) (-771.675) (-770.232) [-766.552] * (-767.331) (-768.956) [-766.184] (-772.690) -- 0:00:41
326000 -- [-765.594] (-768.585) (-768.260) (-767.132) * [-769.475] (-767.140) (-766.004) (-766.016) -- 0:00:41
326500 -- (-766.677) [-766.873] (-765.126) (-766.280) * (-765.795) [-765.977] (-766.695) (-767.828) -- 0:00:43
327000 -- (-765.727) (-766.714) [-765.485] (-767.451) * [-770.016] (-768.798) (-767.418) (-766.579) -- 0:00:43
327500 -- [-766.690] (-767.515) (-765.970) (-768.746) * (-767.600) [-768.424] (-771.130) (-768.638) -- 0:00:43
328000 -- (-766.212) [-766.358] (-766.336) (-769.289) * [-764.755] (-765.435) (-771.089) (-766.244) -- 0:00:43
328500 -- (-765.510) (-771.393) [-765.648] (-768.628) * (-765.542) (-766.887) [-766.745] (-765.997) -- 0:00:42
329000 -- [-767.076] (-765.359) (-768.722) (-765.737) * (-766.193) [-767.250] (-769.384) (-766.555) -- 0:00:42
329500 -- (-765.729) [-765.451] (-769.641) (-765.681) * (-764.603) (-765.070) (-766.760) [-770.267] -- 0:00:42
330000 -- [-767.256] (-765.645) (-769.772) (-765.102) * (-768.679) (-767.714) (-765.027) [-765.790] -- 0:00:42
Average standard deviation of split frequencies: 0.010231
330500 -- (-766.343) [-765.875] (-767.481) (-765.927) * (-767.864) (-769.759) [-765.004] (-765.023) -- 0:00:42
331000 -- (-767.115) [-766.605] (-765.714) (-767.749) * [-766.228] (-769.764) (-765.309) (-768.928) -- 0:00:42
331500 -- (-767.510) (-769.030) (-768.798) [-768.294] * [-766.275] (-769.687) (-767.758) (-767.045) -- 0:00:42
332000 -- [-767.130] (-770.382) (-766.585) (-767.838) * (-769.265) (-768.442) (-765.543) [-769.106] -- 0:00:42
332500 -- [-765.701] (-766.462) (-765.379) (-767.558) * (-766.289) (-766.332) [-764.913] (-766.899) -- 0:00:42
333000 -- (-769.474) [-768.760] (-764.999) (-765.164) * [-766.390] (-766.223) (-766.212) (-766.788) -- 0:00:42
333500 -- (-767.109) [-765.924] (-766.820) (-768.597) * (-765.814) [-765.768] (-766.453) (-766.864) -- 0:00:41
334000 -- (-765.891) (-768.444) (-768.440) [-765.458] * (-765.425) [-766.504] (-765.639) (-765.961) -- 0:00:41
334500 -- (-766.741) [-768.871] (-767.331) (-767.999) * (-765.172) (-765.269) [-764.771] (-764.997) -- 0:00:41
335000 -- [-766.613] (-765.729) (-766.612) (-766.108) * [-765.772] (-765.451) (-764.656) (-764.750) -- 0:00:41
Average standard deviation of split frequencies: 0.010811
335500 -- (-766.090) (-770.202) (-767.092) [-768.754] * (-767.604) [-765.988] (-765.799) (-764.746) -- 0:00:41
336000 -- (-765.717) (-768.516) [-765.719] (-765.296) * (-767.477) (-767.255) (-766.573) [-766.945] -- 0:00:41
336500 -- (-767.969) (-773.133) (-766.540) [-766.851] * [-769.011] (-768.236) (-766.601) (-767.006) -- 0:00:41
337000 -- (-767.780) [-766.806] (-765.525) (-768.112) * [-766.696] (-767.298) (-767.322) (-766.426) -- 0:00:41
337500 -- (-767.319) [-767.372] (-765.416) (-767.525) * (-766.719) [-769.726] (-765.886) (-767.422) -- 0:00:41
338000 -- (-766.763) [-767.719] (-765.527) (-768.725) * (-766.673) [-765.951] (-768.289) (-766.779) -- 0:00:41
338500 -- (-765.682) (-768.100) (-765.460) [-766.529] * (-767.687) [-766.900] (-767.820) (-765.875) -- 0:00:41
339000 -- (-765.886) (-766.718) [-769.619] (-767.999) * (-765.458) (-765.901) [-766.990] (-767.127) -- 0:00:40
339500 -- (-768.384) [-765.968] (-766.794) (-766.695) * (-772.226) (-766.690) (-767.647) [-771.968] -- 0:00:40
340000 -- (-767.168) (-766.156) [-764.890] (-765.501) * [-765.761] (-770.682) (-767.215) (-767.449) -- 0:00:40
Average standard deviation of split frequencies: 0.011152
340500 -- (-765.539) (-767.571) (-765.997) [-769.286] * (-765.732) (-774.068) (-765.483) [-766.160] -- 0:00:40
341000 -- (-765.032) (-771.301) [-766.802] (-766.235) * [-765.934] (-766.145) (-765.324) (-774.356) -- 0:00:40
341500 -- (-766.081) (-769.279) (-765.914) [-766.241] * (-767.368) (-770.164) [-765.006] (-766.562) -- 0:00:40
342000 -- [-765.774] (-768.891) (-765.931) (-766.931) * (-768.667) [-768.252] (-765.540) (-765.720) -- 0:00:40
342500 -- (-766.386) [-766.032] (-766.475) (-764.924) * (-766.792) (-765.877) (-766.255) [-766.158] -- 0:00:40
343000 -- [-767.134] (-765.514) (-766.633) (-766.354) * (-770.441) (-766.870) (-765.899) [-767.755] -- 0:00:40
343500 -- [-767.655] (-766.120) (-765.939) (-766.355) * (-766.550) (-766.246) (-765.647) [-764.962] -- 0:00:42
344000 -- (-767.816) (-768.161) [-767.122] (-767.344) * (-769.122) [-768.654] (-765.676) (-764.928) -- 0:00:41
344500 -- [-766.137] (-764.572) (-770.748) (-765.882) * (-768.249) (-768.753) (-766.721) [-766.851] -- 0:00:41
345000 -- [-768.498] (-766.476) (-766.191) (-768.209) * (-767.335) (-767.534) [-766.778] (-766.732) -- 0:00:41
Average standard deviation of split frequencies: 0.011429
345500 -- (-767.334) (-766.895) [-765.335] (-769.665) * [-765.518] (-766.051) (-766.710) (-766.321) -- 0:00:41
346000 -- (-767.390) (-772.546) [-767.490] (-769.796) * (-766.878) [-766.427] (-768.312) (-770.043) -- 0:00:41
346500 -- (-765.577) (-767.681) (-768.166) [-766.904] * [-764.627] (-765.297) (-765.425) (-767.112) -- 0:00:41
347000 -- (-766.584) [-765.284] (-769.209) (-766.633) * (-765.701) (-765.772) [-765.452] (-768.377) -- 0:00:41
347500 -- [-766.155] (-768.598) (-766.414) (-769.842) * (-769.208) [-768.681] (-767.172) (-766.943) -- 0:00:41
348000 -- (-768.075) (-768.391) [-765.460] (-767.280) * (-767.224) [-766.095] (-765.785) (-766.422) -- 0:00:41
348500 -- (-770.924) (-766.261) [-767.257] (-769.300) * (-765.373) [-766.748] (-769.882) (-768.634) -- 0:00:41
349000 -- (-775.129) [-768.056] (-770.079) (-767.634) * (-767.363) [-767.074] (-767.836) (-768.504) -- 0:00:41
349500 -- (-769.238) (-768.322) [-766.371] (-770.727) * (-768.618) [-766.412] (-766.549) (-766.933) -- 0:00:40
350000 -- (-773.232) (-766.576) (-767.346) [-767.120] * [-767.749] (-765.799) (-769.688) (-766.203) -- 0:00:40
Average standard deviation of split frequencies: 0.010530
350500 -- (-768.597) (-767.589) (-765.813) [-767.646] * (-766.118) [-765.700] (-766.550) (-767.809) -- 0:00:40
351000 -- (-771.187) (-768.183) (-764.888) [-767.215] * [-766.294] (-766.841) (-766.441) (-766.213) -- 0:00:40
351500 -- (-770.074) [-764.848] (-765.273) (-767.997) * [-767.801] (-766.656) (-766.294) (-767.052) -- 0:00:40
352000 -- [-766.094] (-764.817) (-765.796) (-765.960) * (-771.553) (-765.697) [-764.743] (-767.975) -- 0:00:40
352500 -- [-765.827] (-766.016) (-766.409) (-764.970) * [-766.513] (-767.259) (-767.736) (-766.116) -- 0:00:40
353000 -- (-765.399) (-765.157) (-766.687) [-767.749] * (-766.294) (-767.534) (-767.458) [-765.466] -- 0:00:40
353500 -- [-768.641] (-765.720) (-766.815) (-767.908) * (-764.915) (-770.436) [-764.978] (-766.512) -- 0:00:40
354000 -- (-769.846) (-764.800) (-768.452) [-765.910] * (-765.255) (-767.496) (-767.284) [-764.813] -- 0:00:40
354500 -- (-767.743) (-765.882) [-767.133] (-767.988) * (-766.046) (-766.107) [-767.208] (-767.371) -- 0:00:40
355000 -- (-767.830) (-765.768) [-765.633] (-768.987) * (-768.424) (-769.086) [-765.504] (-770.566) -- 0:00:39
Average standard deviation of split frequencies: 0.010593
355500 -- [-766.942] (-767.407) (-767.855) (-769.005) * [-764.975] (-767.874) (-768.060) (-767.027) -- 0:00:39
356000 -- (-766.649) [-765.562] (-768.311) (-766.372) * (-765.103) (-766.836) [-766.285] (-775.163) -- 0:00:39
356500 -- (-765.435) (-766.174) (-769.431) [-767.879] * [-765.984] (-766.915) (-768.391) (-770.991) -- 0:00:39
357000 -- (-767.287) [-764.570] (-765.607) (-766.600) * (-765.146) [-767.320] (-765.980) (-765.479) -- 0:00:39
357500 -- (-767.121) (-766.225) (-765.653) [-766.433] * (-765.643) (-766.440) (-765.347) [-768.049] -- 0:00:39
358000 -- (-765.077) (-769.027) (-765.272) [-765.858] * [-764.946] (-766.078) (-769.738) (-766.387) -- 0:00:39
358500 -- (-766.970) [-768.331] (-766.346) (-773.953) * (-764.808) (-769.371) [-766.175] (-766.260) -- 0:00:39
359000 -- (-767.587) [-767.584] (-766.603) (-768.001) * (-764.529) (-768.543) (-764.581) [-765.246] -- 0:00:39
359500 -- [-764.806] (-766.197) (-766.140) (-765.534) * (-766.330) [-765.470] (-766.039) (-767.439) -- 0:00:40
360000 -- (-766.379) (-769.997) (-766.910) [-765.958] * (-767.588) [-766.466] (-765.631) (-768.735) -- 0:00:40
Average standard deviation of split frequencies: 0.010747
360500 -- (-769.921) (-769.426) (-767.490) [-767.496] * (-768.285) [-767.627] (-767.976) (-766.678) -- 0:00:40
361000 -- (-770.019) (-766.286) (-765.428) [-766.596] * (-767.315) [-766.178] (-767.878) (-766.988) -- 0:00:40
361500 -- (-766.465) (-767.455) [-768.166] (-765.389) * (-766.960) [-767.779] (-767.948) (-766.816) -- 0:00:40
362000 -- (-767.023) [-766.123] (-769.169) (-766.897) * (-765.367) (-765.554) (-769.070) [-767.212] -- 0:00:40
362500 -- (-766.129) [-765.226] (-766.855) (-767.454) * (-765.790) (-766.865) (-766.980) [-767.796] -- 0:00:40
363000 -- [-764.772] (-765.359) (-767.574) (-768.580) * (-767.462) [-767.966] (-766.173) (-766.204) -- 0:00:40
363500 -- [-765.466] (-766.925) (-767.711) (-766.178) * (-765.613) (-767.261) [-766.369] (-765.574) -- 0:00:40
364000 -- [-764.963] (-769.709) (-765.208) (-767.998) * (-766.987) (-768.096) (-766.731) [-765.497] -- 0:00:40
364500 -- (-766.811) (-767.768) [-766.251] (-766.462) * [-767.614] (-766.133) (-766.004) (-766.723) -- 0:00:40
365000 -- [-765.136] (-765.013) (-766.046) (-766.895) * (-766.405) [-767.148] (-769.506) (-766.614) -- 0:00:40
Average standard deviation of split frequencies: 0.009946
365500 -- (-768.336) [-766.772] (-771.055) (-768.482) * [-767.040] (-765.677) (-768.988) (-775.352) -- 0:00:39
366000 -- (-768.159) (-769.711) [-766.385] (-768.910) * (-770.175) [-767.721] (-765.671) (-765.215) -- 0:00:39
366500 -- (-765.705) (-765.626) (-766.260) [-766.998] * (-768.699) (-766.667) (-765.519) [-767.024] -- 0:00:39
367000 -- [-767.327] (-768.870) (-768.899) (-766.683) * [-771.719] (-767.172) (-766.451) (-766.483) -- 0:00:39
367500 -- (-767.039) [-765.177] (-767.956) (-766.655) * (-777.778) (-770.087) (-765.828) [-765.669] -- 0:00:39
368000 -- (-767.338) (-765.806) (-766.915) [-765.319] * (-767.760) (-770.648) (-765.578) [-766.059] -- 0:00:39
368500 -- (-766.770) [-766.156] (-769.001) (-765.941) * (-767.593) (-769.374) (-766.301) [-766.771] -- 0:00:39
369000 -- (-765.797) (-766.522) [-768.386] (-767.322) * (-766.235) (-766.855) [-765.847] (-764.987) -- 0:00:39
369500 -- (-768.498) [-767.514] (-768.337) (-764.916) * [-767.473] (-765.797) (-766.714) (-766.093) -- 0:00:39
370000 -- (-766.729) (-769.846) (-770.242) [-768.163] * [-768.348] (-765.489) (-769.518) (-765.902) -- 0:00:39
Average standard deviation of split frequencies: 0.010997
370500 -- [-769.204] (-768.859) (-768.719) (-765.623) * (-767.521) [-767.313] (-766.557) (-768.057) -- 0:00:39
371000 -- [-766.980] (-766.125) (-765.456) (-768.088) * (-765.341) (-767.232) (-768.073) [-766.760] -- 0:00:38
371500 -- (-774.877) (-766.626) (-764.784) [-769.141] * (-764.525) (-765.255) (-767.603) [-767.740] -- 0:00:38
372000 -- (-775.346) [-765.873] (-772.968) (-765.908) * (-769.150) (-768.916) (-768.959) [-767.917] -- 0:00:38
372500 -- [-772.053] (-770.462) (-771.951) (-768.849) * [-769.646] (-767.905) (-768.590) (-767.029) -- 0:00:38
373000 -- (-768.443) [-766.823] (-765.553) (-772.705) * [-765.946] (-767.079) (-768.427) (-770.068) -- 0:00:38
373500 -- (-772.725) [-767.103] (-765.044) (-770.086) * (-767.904) (-768.624) [-766.183] (-770.424) -- 0:00:38
374000 -- (-767.076) [-765.628] (-768.221) (-764.587) * (-765.550) [-768.093] (-769.511) (-775.116) -- 0:00:38
374500 -- (-765.280) [-766.403] (-765.090) (-768.074) * (-767.834) (-766.580) (-770.370) [-769.906] -- 0:00:38
375000 -- (-766.117) (-767.040) [-765.140] (-766.516) * (-767.381) (-765.421) (-772.525) [-770.483] -- 0:00:38
Average standard deviation of split frequencies: 0.011357
375500 -- [-766.082] (-767.269) (-766.360) (-766.907) * [-766.874] (-769.402) (-766.236) (-770.264) -- 0:00:38
376000 -- (-765.876) (-767.187) (-766.483) [-766.430] * [-766.861] (-768.627) (-771.203) (-770.796) -- 0:00:39
376500 -- (-766.467) (-769.861) [-764.793] (-767.789) * (-771.139) (-768.326) (-766.695) [-764.905] -- 0:00:39
377000 -- (-766.863) (-770.778) (-764.980) [-768.683] * (-767.200) [-767.014] (-766.579) (-765.104) -- 0:00:39
377500 -- (-765.786) (-766.206) [-766.515] (-766.758) * (-770.350) [-765.447] (-764.761) (-765.861) -- 0:00:39
378000 -- [-768.499] (-765.870) (-766.641) (-767.801) * (-767.050) (-766.773) (-765.172) [-765.860] -- 0:00:39
378500 -- [-766.585] (-767.513) (-765.617) (-766.344) * [-765.280] (-765.958) (-766.501) (-766.031) -- 0:00:39
379000 -- (-771.154) (-766.772) (-766.211) [-766.720] * (-768.897) (-765.291) [-766.472] (-771.024) -- 0:00:39
379500 -- [-769.601] (-768.432) (-767.402) (-769.022) * (-767.767) (-765.654) (-771.050) [-768.266] -- 0:00:39
380000 -- [-769.135] (-768.342) (-769.785) (-765.890) * [-769.233] (-771.452) (-768.420) (-768.112) -- 0:00:39
Average standard deviation of split frequencies: 0.010781
380500 -- [-766.216] (-767.364) (-766.140) (-765.269) * (-770.108) [-768.743] (-770.422) (-766.195) -- 0:00:39
381000 -- (-768.496) (-766.492) (-765.580) [-765.744] * (-767.061) [-768.338] (-765.648) (-765.954) -- 0:00:38
381500 -- (-766.695) (-765.360) (-766.351) [-768.264] * (-768.259) (-765.354) (-768.159) [-773.387] -- 0:00:38
382000 -- (-770.994) (-773.089) [-768.225] (-768.480) * (-766.786) [-767.210] (-766.650) (-769.125) -- 0:00:38
382500 -- (-768.211) (-765.828) (-768.254) [-766.089] * [-765.600] (-768.440) (-765.476) (-768.716) -- 0:00:38
383000 -- (-765.706) (-769.412) (-766.289) [-767.441] * (-765.075) (-767.317) (-769.550) [-766.473] -- 0:00:38
383500 -- (-769.282) [-765.516] (-768.086) (-767.827) * (-765.881) (-765.409) (-765.052) [-764.550] -- 0:00:38
384000 -- [-765.822] (-766.555) (-766.587) (-767.366) * (-767.827) [-767.165] (-765.407) (-766.514) -- 0:00:38
384500 -- [-765.569] (-766.259) (-766.898) (-765.175) * (-765.049) [-767.260] (-765.889) (-767.611) -- 0:00:38
385000 -- (-766.647) (-765.934) (-765.503) [-765.046] * [-766.544] (-766.508) (-770.798) (-765.915) -- 0:00:38
Average standard deviation of split frequencies: 0.010919
385500 -- [-765.849] (-768.133) (-766.630) (-768.253) * (-765.822) [-765.475] (-767.661) (-766.905) -- 0:00:38
386000 -- (-766.152) [-767.614] (-767.197) (-766.506) * (-766.205) (-764.977) [-766.034] (-766.867) -- 0:00:38
386500 -- (-770.464) [-765.385] (-766.509) (-768.554) * (-766.523) [-765.780] (-766.504) (-767.857) -- 0:00:38
387000 -- [-764.894] (-769.751) (-767.482) (-770.521) * (-765.665) (-767.177) (-765.608) [-765.455] -- 0:00:38
387500 -- (-765.432) (-769.312) (-765.699) [-766.024] * (-768.381) (-768.553) [-767.892] (-766.299) -- 0:00:37
388000 -- [-765.099] (-773.363) (-769.437) (-765.812) * (-768.458) [-768.049] (-767.844) (-768.496) -- 0:00:37
388500 -- [-764.803] (-771.319) (-768.471) (-766.827) * (-771.521) [-767.625] (-765.421) (-771.198) -- 0:00:37
389000 -- (-765.637) (-765.755) (-769.540) [-767.326] * (-766.428) (-765.387) [-768.794] (-769.273) -- 0:00:37
389500 -- [-768.193] (-765.551) (-765.659) (-767.499) * (-768.181) (-765.580) (-766.079) [-766.596] -- 0:00:37
390000 -- (-766.760) [-765.257] (-768.093) (-765.426) * (-765.735) [-766.534] (-765.340) (-765.290) -- 0:00:37
Average standard deviation of split frequencies: 0.010221
390500 -- (-769.379) (-766.333) (-767.243) [-769.668] * [-768.427] (-765.046) (-767.219) (-765.841) -- 0:00:37
391000 -- (-768.553) [-766.022] (-766.461) (-766.500) * (-766.610) (-766.226) [-767.121] (-769.166) -- 0:00:37
391500 -- [-766.754] (-765.725) (-766.691) (-765.079) * (-772.696) [-766.623] (-768.206) (-765.861) -- 0:00:37
392000 -- (-765.098) [-765.990] (-769.178) (-767.054) * (-767.045) (-770.217) [-768.347] (-766.352) -- 0:00:37
392500 -- (-769.771) (-767.185) (-765.360) [-769.542] * (-765.953) [-766.375] (-768.928) (-766.919) -- 0:00:38
393000 -- (-766.571) (-767.485) [-767.628] (-765.843) * (-769.976) [-770.724] (-766.034) (-765.723) -- 0:00:38
393500 -- (-765.735) [-765.284] (-765.674) (-765.827) * (-767.314) [-771.124] (-767.855) (-766.571) -- 0:00:38
394000 -- (-765.905) (-765.270) [-766.003] (-766.192) * (-768.591) (-765.178) [-766.343] (-767.055) -- 0:00:38
394500 -- (-765.680) (-767.511) (-769.084) [-765.090] * (-765.719) (-766.929) [-765.501] (-765.902) -- 0:00:38
395000 -- (-765.763) (-765.337) [-768.603] (-767.999) * (-766.242) (-771.086) (-765.272) [-766.152] -- 0:00:38
Average standard deviation of split frequencies: 0.010714
395500 -- (-767.643) (-767.940) [-767.303] (-766.518) * (-764.960) (-767.448) [-764.811] (-769.022) -- 0:00:38
396000 -- (-766.283) [-766.353] (-769.157) (-767.213) * (-767.171) (-766.668) (-765.064) [-765.669] -- 0:00:38
396500 -- (-772.116) (-765.410) (-767.684) [-765.123] * (-765.316) (-766.609) (-767.718) [-765.154] -- 0:00:38
397000 -- (-770.142) (-773.385) (-767.695) [-768.116] * [-765.176] (-765.819) (-768.232) (-766.340) -- 0:00:37
397500 -- (-770.217) [-765.563] (-767.648) (-765.495) * [-766.057] (-765.080) (-767.456) (-767.026) -- 0:00:37
398000 -- [-769.377] (-767.708) (-766.395) (-766.422) * (-765.597) [-765.652] (-768.639) (-767.524) -- 0:00:37
398500 -- (-768.265) [-766.231] (-765.975) (-768.653) * (-764.925) (-766.621) (-767.944) [-765.976] -- 0:00:37
399000 -- (-767.317) (-773.099) (-770.140) [-766.883] * [-765.900] (-765.791) (-774.125) (-765.873) -- 0:00:37
399500 -- [-765.330] (-770.858) (-766.915) (-765.502) * (-766.070) [-765.706] (-767.485) (-771.571) -- 0:00:37
400000 -- (-766.269) [-766.441] (-765.529) (-766.547) * [-764.901] (-765.508) (-767.640) (-766.509) -- 0:00:37
Average standard deviation of split frequencies: 0.010866
400500 -- [-770.202] (-767.774) (-767.797) (-766.352) * (-767.500) (-766.053) [-765.085] (-770.097) -- 0:00:37
401000 -- [-768.965] (-770.230) (-768.578) (-765.768) * [-764.626] (-768.068) (-766.788) (-768.105) -- 0:00:37
401500 -- (-768.206) (-766.677) [-766.363] (-768.331) * (-772.173) (-764.817) (-765.928) [-767.302] -- 0:00:37
402000 -- (-765.673) (-766.697) [-767.753] (-766.915) * (-766.265) (-765.124) [-766.608] (-770.269) -- 0:00:37
402500 -- [-766.103] (-768.776) (-767.216) (-765.684) * (-766.347) [-766.122] (-767.608) (-767.165) -- 0:00:37
403000 -- (-765.240) [-767.628] (-766.136) (-767.023) * [-765.505] (-767.466) (-768.027) (-766.736) -- 0:00:37
403500 -- [-764.678] (-766.772) (-767.439) (-769.434) * [-766.919] (-765.106) (-769.864) (-767.603) -- 0:00:36
404000 -- [-773.431] (-767.402) (-769.700) (-768.385) * (-765.827) (-769.418) (-767.702) [-766.275] -- 0:00:36
404500 -- (-767.163) [-766.441] (-769.981) (-766.728) * (-765.576) (-769.050) (-766.277) [-766.060] -- 0:00:36
405000 -- (-767.002) [-766.967] (-767.655) (-765.926) * [-768.422] (-770.624) (-765.118) (-769.063) -- 0:00:36
Average standard deviation of split frequencies: 0.010996
405500 -- (-769.145) (-769.270) (-768.226) [-765.050] * (-765.622) (-766.149) (-767.128) [-767.295] -- 0:00:36
406000 -- (-767.619) [-765.692] (-766.835) (-765.062) * (-766.361) [-766.814] (-765.232) (-766.984) -- 0:00:36
406500 -- (-769.518) (-766.677) (-767.530) [-766.584] * [-766.172] (-767.243) (-766.825) (-766.887) -- 0:00:36
407000 -- [-767.979] (-767.920) (-766.595) (-765.526) * (-767.866) (-766.404) [-765.991] (-767.150) -- 0:00:36
407500 -- (-768.376) (-764.796) [-765.675] (-765.503) * (-767.906) (-766.668) [-767.241] (-770.112) -- 0:00:36
408000 -- (-766.692) (-766.021) [-769.887] (-765.628) * (-767.226) (-771.627) (-768.317) [-768.654] -- 0:00:36
408500 -- [-768.077] (-768.496) (-771.430) (-766.146) * (-767.328) (-767.472) [-766.786] (-770.557) -- 0:00:36
409000 -- (-765.289) [-766.287] (-767.542) (-766.778) * [-765.788] (-769.418) (-767.398) (-766.146) -- 0:00:37
409500 -- (-765.840) (-767.839) (-769.822) [-767.426] * (-767.353) [-765.710] (-765.111) (-767.108) -- 0:00:37
410000 -- (-767.362) [-765.895] (-766.293) (-764.803) * [-766.108] (-765.176) (-767.119) (-767.598) -- 0:00:37
Average standard deviation of split frequencies: 0.010804
410500 -- [-766.391] (-771.023) (-768.255) (-769.457) * (-767.698) (-770.217) [-768.892] (-766.985) -- 0:00:37
411000 -- (-765.724) [-765.734] (-766.251) (-771.134) * (-766.615) (-765.293) [-765.701] (-764.913) -- 0:00:37
411500 -- (-771.753) [-768.275] (-764.585) (-767.923) * (-768.006) (-767.440) [-768.170] (-768.699) -- 0:00:37
412000 -- (-771.884) (-768.815) [-764.741] (-767.689) * (-765.723) [-766.510] (-767.100) (-767.077) -- 0:00:37
412500 -- (-765.854) (-768.965) (-766.149) [-770.560] * (-770.181) (-766.891) [-767.804] (-766.244) -- 0:00:37
413000 -- [-766.099] (-767.082) (-765.787) (-765.505) * (-765.150) (-769.390) [-766.165] (-767.830) -- 0:00:36
413500 -- [-766.245] (-767.823) (-769.703) (-767.019) * (-769.439) (-766.029) (-767.839) [-768.257] -- 0:00:36
414000 -- [-765.156] (-765.713) (-765.901) (-766.510) * (-765.225) (-766.122) (-764.872) [-767.501] -- 0:00:36
414500 -- (-767.709) (-764.653) (-766.674) [-769.293] * (-766.990) (-765.862) [-772.584] (-766.200) -- 0:00:36
415000 -- (-769.991) (-771.274) (-766.252) [-767.488] * (-766.788) [-765.624] (-766.392) (-766.436) -- 0:00:36
Average standard deviation of split frequencies: 0.011332
415500 -- [-766.843] (-765.705) (-767.195) (-767.707) * [-765.598] (-765.021) (-767.755) (-764.585) -- 0:00:36
416000 -- (-767.571) [-765.076] (-767.813) (-765.451) * [-769.543] (-764.801) (-768.704) (-768.596) -- 0:00:36
416500 -- (-767.168) [-766.102] (-766.996) (-770.549) * [-765.882] (-765.266) (-764.730) (-766.724) -- 0:00:36
417000 -- (-768.487) (-764.987) [-766.619] (-765.088) * [-766.879] (-764.852) (-764.700) (-768.140) -- 0:00:36
417500 -- (-769.923) (-766.532) [-767.332] (-767.270) * [-766.278] (-765.539) (-770.100) (-766.934) -- 0:00:36
418000 -- [-766.820] (-767.008) (-765.937) (-766.041) * [-766.079] (-766.546) (-770.403) (-766.680) -- 0:00:36
418500 -- (-766.862) [-766.245] (-767.658) (-766.386) * [-765.170] (-767.203) (-769.181) (-768.041) -- 0:00:36
419000 -- [-767.306] (-768.699) (-766.558) (-765.911) * (-769.673) [-766.466] (-765.975) (-765.586) -- 0:00:36
419500 -- [-766.439] (-765.037) (-768.072) (-765.007) * (-766.136) (-764.824) (-766.682) [-765.420] -- 0:00:35
420000 -- [-765.447] (-765.942) (-764.930) (-765.164) * (-768.061) [-765.317] (-767.070) (-764.708) -- 0:00:35
Average standard deviation of split frequencies: 0.011066
420500 -- (-765.806) (-766.314) (-765.172) [-765.562] * (-765.991) [-765.226] (-765.956) (-766.711) -- 0:00:35
421000 -- [-766.999] (-767.480) (-765.874) (-766.390) * (-766.109) (-766.828) (-767.390) [-765.936] -- 0:00:35
421500 -- (-766.748) [-769.196] (-765.732) (-768.111) * (-766.331) (-767.184) (-765.333) [-766.185] -- 0:00:35
422000 -- (-766.096) [-767.972] (-766.691) (-766.665) * (-767.091) (-768.771) (-765.494) [-765.702] -- 0:00:35
422500 -- (-765.873) (-765.445) (-767.305) [-766.468] * (-767.634) (-768.256) (-767.336) [-765.865] -- 0:00:35
423000 -- (-768.583) (-766.100) (-769.283) [-766.862] * [-766.300] (-770.442) (-765.696) (-767.097) -- 0:00:35
423500 -- [-765.952] (-766.044) (-769.127) (-767.070) * [-768.026] (-770.256) (-770.267) (-768.000) -- 0:00:35
424000 -- (-765.071) (-771.479) [-765.967] (-767.179) * (-765.428) (-764.614) [-769.968] (-764.570) -- 0:00:35
424500 -- (-766.308) (-770.086) (-769.597) [-767.795] * (-765.947) (-765.943) (-766.962) [-764.757] -- 0:00:35
425000 -- (-766.169) (-770.321) (-767.322) [-767.366] * (-766.364) (-765.625) (-767.637) [-766.856] -- 0:00:35
Average standard deviation of split frequencies: 0.011412
425500 -- (-766.699) [-765.642] (-767.305) (-767.341) * (-766.179) (-766.024) [-765.175] (-766.056) -- 0:00:35
426000 -- (-767.885) [-765.966] (-765.465) (-769.081) * [-767.277] (-766.620) (-764.739) (-768.025) -- 0:00:36
426500 -- (-770.757) (-768.691) [-765.467] (-766.362) * (-767.651) (-769.473) [-765.514] (-767.049) -- 0:00:36
427000 -- (-767.242) [-767.295] (-765.731) (-771.091) * (-767.491) (-765.445) (-767.050) [-767.852] -- 0:00:36
427500 -- [-766.593] (-767.661) (-767.613) (-767.652) * (-766.162) (-768.452) (-769.746) [-766.445] -- 0:00:36
428000 -- (-766.961) [-767.376] (-767.396) (-766.457) * [-765.370] (-772.890) (-770.092) (-765.879) -- 0:00:36
428500 -- [-764.923] (-766.515) (-767.200) (-766.002) * (-768.225) [-766.254] (-764.527) (-766.123) -- 0:00:36
429000 -- (-766.529) (-766.748) (-765.417) [-767.306] * (-767.084) (-768.829) (-766.340) [-765.901] -- 0:00:35
429500 -- (-769.368) [-766.741] (-767.046) (-765.562) * (-765.344) (-767.514) (-765.019) [-765.038] -- 0:00:35
430000 -- [-765.475] (-766.598) (-770.224) (-766.383) * [-765.807] (-770.024) (-765.964) (-767.711) -- 0:00:35
Average standard deviation of split frequencies: 0.011332
430500 -- (-768.263) (-766.258) [-766.773] (-768.953) * (-767.439) (-765.843) [-769.086] (-764.977) -- 0:00:35
431000 -- (-768.923) (-765.707) (-766.498) [-766.307] * (-768.976) (-765.606) [-764.748] (-767.319) -- 0:00:35
431500 -- (-765.366) (-765.468) [-766.248] (-767.313) * (-769.547) (-766.744) (-766.408) [-767.485] -- 0:00:35
432000 -- (-769.293) [-766.579] (-765.877) (-768.324) * [-768.022] (-768.658) (-766.621) (-766.228) -- 0:00:35
432500 -- (-765.887) (-765.044) (-766.339) [-764.986] * [-765.724] (-767.191) (-765.468) (-767.318) -- 0:00:35
433000 -- [-765.898] (-767.302) (-766.176) (-765.360) * [-765.374] (-766.574) (-765.384) (-765.046) -- 0:00:35
433500 -- (-766.692) (-768.521) [-765.830] (-765.354) * [-767.898] (-767.076) (-765.682) (-767.887) -- 0:00:35
434000 -- (-767.002) (-767.794) [-765.014] (-767.834) * (-771.911) [-765.682] (-769.899) (-766.329) -- 0:00:35
434500 -- [-766.412] (-766.802) (-768.189) (-767.371) * (-767.096) (-765.274) [-768.557] (-768.162) -- 0:00:35
435000 -- (-767.125) (-767.134) [-767.501] (-766.259) * (-769.232) [-768.469] (-775.495) (-770.901) -- 0:00:35
Average standard deviation of split frequencies: 0.011082
435500 -- (-765.639) (-768.528) (-766.041) [-766.314] * (-765.140) [-766.173] (-767.933) (-767.333) -- 0:00:34
436000 -- (-765.895) [-765.235] (-765.960) (-766.147) * (-765.647) (-767.632) [-765.204] (-767.910) -- 0:00:34
436500 -- (-767.608) (-765.118) [-766.933] (-767.163) * (-768.654) (-768.523) [-765.274] (-766.882) -- 0:00:34
437000 -- (-769.361) [-765.767] (-767.333) (-768.332) * (-765.365) [-767.481] (-768.960) (-767.020) -- 0:00:34
437500 -- [-768.324] (-767.108) (-766.699) (-766.882) * (-765.150) [-766.975] (-766.443) (-770.147) -- 0:00:34
438000 -- (-766.921) (-768.037) (-766.066) [-765.708] * [-767.268] (-765.900) (-767.564) (-767.813) -- 0:00:34
438500 -- [-766.705] (-770.908) (-764.946) (-765.427) * [-771.897] (-765.945) (-767.877) (-766.093) -- 0:00:34
439000 -- [-766.780] (-767.796) (-765.872) (-765.864) * (-770.369) (-765.701) [-766.718] (-767.394) -- 0:00:34
439500 -- [-769.322] (-767.554) (-765.894) (-766.757) * (-769.742) (-770.051) (-767.778) [-766.397] -- 0:00:34
440000 -- (-770.741) (-766.481) [-765.732] (-766.734) * (-766.008) (-770.390) [-769.618] (-766.811) -- 0:00:34
Average standard deviation of split frequencies: 0.011634
440500 -- [-771.813] (-769.485) (-768.005) (-770.147) * (-765.663) [-767.138] (-766.717) (-766.351) -- 0:00:34
441000 -- [-765.348] (-767.097) (-766.752) (-766.132) * (-772.256) (-769.959) [-766.362] (-766.739) -- 0:00:34
441500 -- (-765.131) (-770.839) [-767.307] (-766.848) * (-773.273) (-766.185) [-765.568] (-769.342) -- 0:00:34
442000 -- (-765.693) [-767.452] (-766.002) (-768.168) * (-766.810) [-767.509] (-766.457) (-765.718) -- 0:00:34
442500 -- (-766.692) (-767.819) (-765.244) [-768.064] * (-767.352) (-766.708) [-765.916] (-768.777) -- 0:00:35
443000 -- (-769.505) (-766.534) [-768.092] (-768.890) * (-766.923) [-766.679] (-764.989) (-767.355) -- 0:00:35
443500 -- (-766.802) (-768.372) (-769.355) [-768.455] * [-767.738] (-767.009) (-766.562) (-769.398) -- 0:00:35
444000 -- (-768.297) (-767.839) [-767.466] (-768.798) * (-767.078) (-768.558) [-767.118] (-766.341) -- 0:00:35
444500 -- (-765.775) [-770.307] (-765.722) (-767.562) * (-768.242) (-765.917) [-769.610] (-767.790) -- 0:00:34
445000 -- (-770.227) (-765.157) (-766.067) [-765.986] * (-765.549) (-765.893) (-767.827) [-767.045] -- 0:00:34
Average standard deviation of split frequencies: 0.011759
445500 -- (-766.040) [-765.970] (-767.126) (-767.738) * (-764.919) [-768.352] (-768.983) (-764.862) -- 0:00:34
446000 -- (-768.649) (-766.703) (-765.604) [-766.781] * [-767.961] (-770.516) (-767.337) (-765.914) -- 0:00:34
446500 -- (-765.929) (-769.514) (-765.524) [-765.156] * (-765.456) (-766.030) [-765.582] (-766.663) -- 0:00:34
447000 -- (-766.770) [-767.126] (-766.216) (-765.764) * [-765.273] (-767.734) (-767.115) (-766.809) -- 0:00:34
447500 -- [-765.738] (-766.208) (-769.053) (-766.775) * [-765.729] (-767.693) (-766.254) (-767.518) -- 0:00:34
448000 -- [-768.346] (-764.999) (-769.198) (-766.609) * (-766.201) (-766.873) (-765.790) [-766.555] -- 0:00:34
448500 -- (-765.932) (-765.162) [-765.575] (-767.310) * (-768.375) (-765.230) (-771.574) [-765.469] -- 0:00:34
449000 -- (-766.255) [-768.587] (-768.664) (-768.017) * [-765.623] (-767.279) (-770.545) (-765.981) -- 0:00:34
449500 -- (-771.935) (-770.966) (-768.642) [-767.210] * (-766.695) [-765.606] (-767.966) (-765.938) -- 0:00:34
450000 -- (-767.693) (-768.475) (-766.369) [-765.030] * (-766.646) (-766.986) (-766.431) [-764.844] -- 0:00:34
Average standard deviation of split frequencies: 0.011768
450500 -- [-767.436] (-768.322) (-768.223) (-768.004) * (-768.533) (-765.611) (-765.919) [-765.140] -- 0:00:34
451000 -- (-767.388) (-767.452) [-770.523] (-767.269) * (-765.150) (-766.950) [-767.305] (-766.670) -- 0:00:34
451500 -- (-765.550) (-765.481) (-768.407) [-767.796] * (-765.283) (-768.005) [-766.196] (-766.441) -- 0:00:34
452000 -- (-765.026) [-766.024] (-766.703) (-769.623) * [-769.513] (-768.789) (-767.247) (-767.310) -- 0:00:33
452500 -- (-768.685) (-767.390) [-765.838] (-768.461) * (-767.439) (-766.188) [-767.568] (-765.243) -- 0:00:33
453000 -- [-766.275] (-765.645) (-766.467) (-769.955) * [-767.569] (-766.973) (-768.208) (-765.221) -- 0:00:33
453500 -- (-765.244) [-765.564] (-766.169) (-767.783) * (-765.684) [-768.255] (-767.947) (-765.264) -- 0:00:33
454000 -- (-765.244) [-769.228] (-768.197) (-768.336) * (-769.223) [-766.061] (-767.067) (-768.935) -- 0:00:33
454500 -- (-766.901) [-766.544] (-766.429) (-768.014) * [-770.097] (-765.789) (-764.777) (-766.403) -- 0:00:33
455000 -- (-768.703) (-765.737) (-765.978) [-771.048] * (-767.869) (-766.120) [-765.380] (-765.940) -- 0:00:33
Average standard deviation of split frequencies: 0.010970
455500 -- (-767.066) (-767.495) [-764.862] (-768.032) * (-771.193) [-767.183] (-765.718) (-765.919) -- 0:00:33
456000 -- (-769.255) [-767.882] (-769.459) (-764.897) * (-765.540) (-766.137) (-766.495) [-765.905] -- 0:00:33
456500 -- (-767.234) (-765.981) [-766.659] (-767.844) * (-766.294) (-765.460) (-767.492) [-765.988] -- 0:00:33
457000 -- (-765.406) (-767.205) [-766.415] (-771.941) * (-767.537) (-765.928) [-764.679] (-766.341) -- 0:00:33
457500 -- (-767.421) (-765.687) [-766.547] (-776.520) * (-767.372) (-770.914) (-766.490) [-768.386] -- 0:00:33
458000 -- (-766.997) (-766.190) (-765.040) [-765.639] * (-769.108) (-766.640) [-768.019] (-767.776) -- 0:00:33
458500 -- (-767.112) (-768.474) (-765.222) [-765.874] * (-766.206) [-767.428] (-766.814) (-767.637) -- 0:00:33
459000 -- [-765.298] (-767.356) (-768.538) (-766.137) * (-765.742) [-770.885] (-766.117) (-766.512) -- 0:00:33
459500 -- (-765.268) (-768.468) [-765.709] (-766.537) * (-765.233) [-769.421] (-764.564) (-768.051) -- 0:00:34
460000 -- (-774.453) (-768.214) [-765.084] (-768.705) * (-767.776) (-769.769) [-765.483] (-766.499) -- 0:00:34
Average standard deviation of split frequencies: 0.011768
460500 -- (-767.149) (-770.249) (-765.050) [-766.127] * (-766.407) (-771.387) (-765.408) [-766.476] -- 0:00:33
461000 -- (-766.458) (-770.158) [-767.000] (-766.408) * [-767.835] (-768.811) (-769.148) (-770.540) -- 0:00:33
461500 -- (-771.869) (-765.991) (-764.661) [-767.114] * [-765.529] (-767.783) (-765.716) (-765.720) -- 0:00:33
462000 -- (-770.829) (-767.531) [-770.623] (-765.676) * (-765.487) (-767.561) [-769.370] (-766.055) -- 0:00:33
462500 -- (-768.050) (-765.461) (-769.136) [-767.163] * (-764.743) [-766.516] (-765.923) (-767.863) -- 0:00:33
463000 -- (-767.792) [-764.843] (-767.223) (-765.449) * (-766.315) [-767.361] (-768.090) (-768.937) -- 0:00:33
463500 -- (-769.555) (-768.577) (-765.324) [-769.739] * (-765.596) (-767.454) [-766.351] (-768.127) -- 0:00:33
464000 -- [-766.860] (-765.947) (-766.651) (-768.710) * (-765.854) (-767.776) [-768.048] (-768.023) -- 0:00:33
464500 -- (-766.472) (-766.382) [-765.552] (-769.066) * [-768.477] (-769.157) (-766.107) (-766.821) -- 0:00:33
465000 -- (-766.308) [-769.318] (-768.286) (-774.023) * [-767.086] (-766.682) (-766.615) (-765.090) -- 0:00:33
Average standard deviation of split frequencies: 0.011521
465500 -- (-766.525) (-766.836) [-766.749] (-765.313) * (-769.218) (-765.934) (-765.656) [-765.266] -- 0:00:33
466000 -- [-766.999] (-767.346) (-766.340) (-765.482) * [-770.302] (-767.763) (-766.850) (-765.224) -- 0:00:33
466500 -- (-766.164) (-767.885) (-766.248) [-766.044] * (-767.861) (-766.815) [-767.560] (-766.756) -- 0:00:33
467000 -- (-765.578) [-765.252] (-771.274) (-765.583) * [-766.428] (-768.667) (-769.095) (-767.342) -- 0:00:33
467500 -- (-767.931) (-767.131) (-769.366) [-765.292] * (-766.755) (-772.153) [-769.931] (-764.821) -- 0:00:33
468000 -- [-766.703] (-766.378) (-766.435) (-765.289) * [-766.568] (-768.426) (-764.959) (-765.665) -- 0:00:32
468500 -- (-767.679) (-766.258) (-776.021) [-764.779] * [-766.071] (-766.440) (-767.111) (-765.880) -- 0:00:32
469000 -- (-764.669) (-768.865) [-767.582] (-765.710) * (-767.070) [-765.180] (-764.780) (-766.295) -- 0:00:32
469500 -- (-767.391) [-766.386] (-769.917) (-766.385) * (-766.911) (-768.403) [-766.299] (-767.693) -- 0:00:32
470000 -- [-768.381] (-766.728) (-766.242) (-766.774) * (-767.628) (-766.384) (-765.895) [-768.222] -- 0:00:32
Average standard deviation of split frequencies: 0.011129
470500 -- (-766.869) [-766.343] (-774.209) (-766.071) * (-767.712) (-767.663) (-766.854) [-767.500] -- 0:00:32
471000 -- [-765.510] (-765.939) (-769.374) (-766.467) * (-767.666) (-764.812) (-767.440) [-772.171] -- 0:00:32
471500 -- (-765.364) (-769.165) (-767.568) [-765.928] * (-765.738) (-765.246) (-767.774) [-766.236] -- 0:00:32
472000 -- (-765.397) (-767.545) [-767.244] (-767.658) * (-766.749) (-771.586) [-765.922] (-767.212) -- 0:00:32
472500 -- [-767.615] (-767.240) (-765.855) (-770.337) * (-767.463) [-767.137] (-768.468) (-766.558) -- 0:00:32
473000 -- (-768.283) (-767.042) (-765.912) [-767.798] * (-765.849) (-768.268) [-766.527] (-767.847) -- 0:00:32
473500 -- (-768.643) (-767.551) (-765.380) [-768.674] * [-767.755] (-766.264) (-766.604) (-767.059) -- 0:00:32
474000 -- (-767.311) (-769.313) [-765.471] (-767.772) * (-765.022) (-767.759) (-773.718) [-767.760] -- 0:00:32
474500 -- (-767.067) (-767.341) [-765.740] (-770.523) * (-766.537) (-766.261) (-768.038) [-765.834] -- 0:00:32
475000 -- (-767.703) (-765.194) (-765.824) [-766.586] * (-765.002) [-766.619] (-770.289) (-765.678) -- 0:00:32
Average standard deviation of split frequencies: 0.010344
475500 -- (-768.394) (-766.062) [-766.925] (-769.118) * [-770.833] (-767.729) (-765.797) (-765.559) -- 0:00:33
476000 -- [-766.538] (-768.635) (-769.108) (-766.702) * [-766.647] (-766.084) (-766.291) (-767.287) -- 0:00:33
476500 -- (-764.936) (-765.822) (-765.497) [-767.654] * [-766.009] (-771.456) (-764.966) (-767.589) -- 0:00:32
477000 -- [-765.593] (-771.858) (-769.669) (-767.720) * [-765.945] (-767.530) (-766.145) (-769.166) -- 0:00:32
477500 -- (-766.093) (-767.430) [-767.663] (-769.412) * (-769.351) [-767.613] (-768.908) (-766.962) -- 0:00:32
478000 -- (-765.703) (-769.450) (-765.488) [-764.952] * [-768.467] (-765.182) (-766.192) (-766.790) -- 0:00:32
478500 -- (-767.158) [-766.580] (-766.346) (-770.322) * (-766.034) (-766.835) (-766.170) [-765.832] -- 0:00:32
479000 -- [-765.644] (-767.940) (-772.299) (-766.264) * (-766.327) (-767.939) (-768.154) [-766.124] -- 0:00:32
479500 -- [-765.667] (-773.846) (-771.765) (-765.129) * (-766.650) (-765.926) [-766.096] (-766.162) -- 0:00:32
480000 -- (-765.051) (-765.840) [-766.932] (-767.806) * [-767.493] (-770.552) (-771.560) (-766.108) -- 0:00:32
Average standard deviation of split frequencies: 0.009698
480500 -- (-765.172) (-768.057) [-766.377] (-767.293) * (-766.769) [-766.362] (-768.006) (-765.403) -- 0:00:32
481000 -- (-766.581) (-768.085) [-765.889] (-765.775) * (-766.164) (-765.583) (-766.596) [-765.910] -- 0:00:32
481500 -- (-767.613) (-766.217) (-769.104) [-765.549] * (-770.158) [-766.810] (-767.597) (-767.841) -- 0:00:32
482000 -- (-769.095) (-766.012) (-764.926) [-766.774] * (-766.252) (-765.848) (-768.873) [-764.692] -- 0:00:32
482500 -- (-768.762) (-769.531) [-768.090] (-767.805) * (-765.089) (-772.418) (-766.895) [-766.808] -- 0:00:32
483000 -- (-768.161) [-766.557] (-766.069) (-766.866) * [-764.977] (-772.101) (-768.886) (-765.606) -- 0:00:32
483500 -- [-767.365] (-766.733) (-765.035) (-765.226) * (-770.400) [-768.317] (-767.469) (-768.011) -- 0:00:32
484000 -- (-771.789) (-767.006) [-769.808] (-768.466) * [-768.719] (-767.871) (-767.725) (-766.983) -- 0:00:31
484500 -- (-770.949) (-766.032) (-768.967) [-765.951] * [-764.920] (-768.123) (-766.404) (-766.649) -- 0:00:31
485000 -- (-771.342) (-765.779) (-765.954) [-769.012] * (-767.059) (-769.085) [-764.854] (-766.194) -- 0:00:31
Average standard deviation of split frequencies: 0.008787
485500 -- (-768.808) [-765.177] (-765.971) (-770.513) * [-765.628] (-765.599) (-770.464) (-768.258) -- 0:00:31
486000 -- (-768.418) (-766.044) [-767.490] (-768.314) * [-765.903] (-770.025) (-765.955) (-766.403) -- 0:00:31
486500 -- (-766.264) (-765.936) (-765.406) [-767.136] * (-765.305) (-769.115) (-765.221) [-769.054] -- 0:00:31
487000 -- [-766.964] (-765.619) (-764.770) (-766.338) * [-764.798] (-772.095) (-766.013) (-765.700) -- 0:00:31
487500 -- [-768.248] (-766.312) (-768.109) (-766.070) * (-765.189) [-765.022] (-770.163) (-767.904) -- 0:00:31
488000 -- (-766.899) (-766.424) (-765.549) [-771.318] * [-768.148] (-767.067) (-766.976) (-765.658) -- 0:00:31
488500 -- (-767.364) (-764.684) (-764.551) [-767.126] * (-770.704) (-772.275) [-768.658] (-768.630) -- 0:00:31
489000 -- [-765.071] (-769.358) (-765.913) (-770.857) * [-765.656] (-765.632) (-766.912) (-768.660) -- 0:00:31
489500 -- [-765.916] (-766.342) (-768.468) (-766.287) * (-767.400) (-767.696) (-767.389) [-768.721] -- 0:00:31
490000 -- (-767.382) (-766.475) [-766.546] (-766.854) * (-767.035) (-767.053) (-767.782) [-768.024] -- 0:00:31
Average standard deviation of split frequencies: 0.008873
490500 -- (-766.563) (-765.871) [-770.505] (-767.492) * [-768.254] (-777.248) (-766.242) (-771.385) -- 0:00:31
491000 -- (-765.813) (-765.691) [-766.038] (-771.814) * (-768.534) [-768.143] (-766.328) (-766.031) -- 0:00:31
491500 -- (-765.394) [-766.643] (-768.797) (-772.025) * [-766.601] (-766.835) (-766.504) (-765.058) -- 0:00:31
492000 -- (-766.201) [-765.101] (-767.479) (-766.468) * [-768.158] (-766.599) (-766.853) (-769.713) -- 0:00:30
492500 -- [-766.571] (-766.772) (-766.314) (-766.435) * [-767.683] (-765.732) (-766.371) (-772.287) -- 0:00:31
493000 -- (-766.537) [-766.536] (-767.731) (-765.688) * (-768.153) (-764.816) [-766.298] (-765.320) -- 0:00:31
493500 -- (-766.884) (-765.101) (-767.785) [-764.555] * (-765.529) (-765.912) [-766.966] (-768.285) -- 0:00:31
494000 -- (-767.059) (-765.325) [-765.569] (-765.885) * (-766.355) [-766.552] (-769.878) (-768.924) -- 0:00:31
494500 -- (-764.434) [-767.584] (-764.580) (-766.657) * (-765.192) (-766.185) (-768.644) [-766.763] -- 0:00:31
495000 -- (-765.207) [-767.465] (-765.655) (-764.875) * (-767.113) [-767.031] (-767.754) (-768.382) -- 0:00:31
Average standard deviation of split frequencies: 0.009169
495500 -- [-767.309] (-764.927) (-765.156) (-767.085) * (-766.109) (-768.506) [-767.455] (-767.337) -- 0:00:31
496000 -- (-768.666) [-764.906] (-767.244) (-767.990) * (-766.516) (-769.119) [-766.129] (-766.909) -- 0:00:31
496500 -- [-772.322] (-768.225) (-765.204) (-768.585) * [-767.527] (-766.092) (-768.311) (-766.079) -- 0:00:31
497000 -- [-770.436] (-766.985) (-768.060) (-766.891) * (-767.046) (-767.514) [-766.195] (-765.126) -- 0:00:31
497500 -- [-765.368] (-768.034) (-766.898) (-768.126) * (-767.140) [-767.032] (-765.714) (-767.176) -- 0:00:31
498000 -- (-765.253) [-766.062] (-765.822) (-772.456) * [-767.631] (-765.952) (-767.194) (-766.097) -- 0:00:31
498500 -- (-766.560) (-764.996) [-765.182] (-767.394) * [-765.399] (-767.035) (-768.958) (-766.563) -- 0:00:31
499000 -- (-766.461) [-766.040] (-765.269) (-768.207) * (-768.762) (-767.035) [-766.400] (-766.828) -- 0:00:31
499500 -- [-766.432] (-766.937) (-765.229) (-767.125) * (-768.017) (-768.077) [-765.538] (-772.096) -- 0:00:31
500000 -- (-767.238) [-766.584] (-765.668) (-765.689) * (-769.823) [-770.146] (-768.830) (-768.111) -- 0:00:31
Average standard deviation of split frequencies: 0.008917
500500 -- (-766.433) [-765.447] (-769.160) (-764.565) * [-764.663] (-765.639) (-770.883) (-767.593) -- 0:00:30
501000 -- (-768.822) (-769.350) [-766.297] (-766.107) * (-766.712) (-768.029) (-770.436) [-764.712] -- 0:00:30
501500 -- [-766.987] (-770.838) (-766.561) (-768.148) * [-766.009] (-766.028) (-770.849) (-765.909) -- 0:00:30
502000 -- (-771.088) (-765.948) [-764.959] (-764.937) * [-770.625] (-765.498) (-768.967) (-765.238) -- 0:00:30
502500 -- (-768.944) (-764.703) [-765.426] (-766.472) * (-766.546) [-765.919] (-769.244) (-765.912) -- 0:00:30
503000 -- (-769.036) [-764.514] (-768.196) (-764.788) * [-764.768] (-766.971) (-766.276) (-766.477) -- 0:00:30
503500 -- (-765.891) [-765.027] (-768.993) (-766.179) * (-766.616) (-767.446) [-766.725] (-767.529) -- 0:00:30
504000 -- (-767.363) [-765.738] (-767.082) (-765.968) * (-771.498) (-766.462) [-766.163] (-766.284) -- 0:00:30
504500 -- (-765.228) [-767.430] (-769.594) (-769.758) * (-766.534) (-766.305) (-768.938) [-766.680] -- 0:00:30
505000 -- (-766.428) (-767.625) [-770.164] (-767.127) * [-766.095] (-768.947) (-766.819) (-765.656) -- 0:00:30
Average standard deviation of split frequencies: 0.009261
505500 -- (-766.421) (-766.877) (-769.206) [-766.930] * (-767.565) [-766.779] (-765.177) (-765.841) -- 0:00:30
506000 -- [-768.657] (-767.707) (-766.193) (-768.290) * (-764.990) [-769.623] (-767.919) (-770.724) -- 0:00:30
506500 -- (-770.549) (-765.805) [-766.676] (-764.852) * (-767.137) [-770.571] (-767.927) (-773.351) -- 0:00:30
507000 -- [-767.529] (-767.890) (-766.844) (-766.744) * (-765.082) (-767.034) [-766.349] (-774.961) -- 0:00:30
507500 -- (-765.684) [-768.123] (-766.153) (-766.366) * (-767.181) (-767.974) [-765.288] (-771.909) -- 0:00:30
508000 -- (-772.716) (-765.278) (-767.044) [-766.949] * [-768.137] (-765.869) (-765.831) (-770.026) -- 0:00:30
508500 -- (-768.753) (-766.355) (-769.031) [-765.190] * (-766.741) (-772.957) [-765.841] (-765.996) -- 0:00:29
509000 -- (-766.276) (-765.949) (-767.393) [-765.575] * (-767.315) [-769.375] (-769.349) (-774.222) -- 0:00:29
509500 -- (-767.268) (-765.415) (-766.739) [-764.727] * (-769.055) [-768.154] (-772.355) (-766.477) -- 0:00:30
510000 -- (-769.169) (-768.630) (-769.336) [-765.596] * (-771.405) (-764.859) [-766.298] (-767.171) -- 0:00:30
Average standard deviation of split frequencies: 0.009828
510500 -- (-765.264) (-768.947) [-767.900] (-768.454) * (-766.195) (-770.453) [-769.807] (-767.602) -- 0:00:30
511000 -- [-765.006] (-766.532) (-767.656) (-765.850) * (-771.869) (-768.508) (-766.063) [-765.497] -- 0:00:30
511500 -- (-771.435) (-771.042) (-769.525) [-766.162] * (-772.394) (-765.770) (-768.134) [-768.594] -- 0:00:30
512000 -- (-768.487) [-768.430] (-767.901) (-765.952) * [-766.320] (-767.318) (-767.741) (-774.288) -- 0:00:30
512500 -- (-766.794) (-764.753) (-765.745) [-766.812] * (-767.593) [-767.813] (-766.098) (-767.692) -- 0:00:30
513000 -- [-767.065] (-766.286) (-765.743) (-766.645) * (-765.028) (-767.809) (-765.486) [-764.883] -- 0:00:30
513500 -- (-770.784) [-766.339] (-764.822) (-766.023) * (-769.703) (-767.132) (-767.338) [-767.420] -- 0:00:30
514000 -- (-764.769) [-768.461] (-765.049) (-765.176) * [-766.231] (-767.639) (-767.192) (-765.805) -- 0:00:30
514500 -- [-764.894] (-767.088) (-764.621) (-769.490) * (-764.485) (-765.225) [-766.667] (-768.593) -- 0:00:30
515000 -- (-765.117) [-766.876] (-766.159) (-765.296) * (-765.183) [-766.658] (-766.273) (-767.274) -- 0:00:30
Average standard deviation of split frequencies: 0.009404
515500 -- (-765.376) [-767.062] (-766.544) (-770.102) * (-767.934) [-765.856] (-769.936) (-768.957) -- 0:00:30
516000 -- (-770.823) (-765.479) [-768.400] (-765.886) * (-765.599) (-766.605) [-766.493] (-767.957) -- 0:00:30
516500 -- (-765.906) [-766.917] (-771.575) (-767.991) * (-765.859) (-766.945) [-766.715] (-767.513) -- 0:00:29
517000 -- (-765.918) [-767.084] (-767.234) (-769.307) * (-766.536) (-765.899) (-767.381) [-766.354] -- 0:00:29
517500 -- (-766.953) (-766.429) [-768.335] (-767.696) * (-768.276) (-767.089) [-768.308] (-766.715) -- 0:00:29
518000 -- (-767.670) [-765.853] (-766.343) (-768.741) * [-765.636] (-768.512) (-767.987) (-766.291) -- 0:00:29
518500 -- (-765.596) (-768.392) [-767.656] (-766.767) * (-766.062) (-768.068) [-764.598] (-769.198) -- 0:00:29
519000 -- (-765.898) (-768.124) [-768.868] (-766.813) * (-765.744) (-766.131) [-767.300] (-767.493) -- 0:00:29
519500 -- [-767.999] (-765.857) (-768.716) (-765.621) * (-765.681) (-770.356) (-767.502) [-765.915] -- 0:00:29
520000 -- (-765.576) [-767.458] (-768.936) (-764.868) * [-765.417] (-770.116) (-767.733) (-770.078) -- 0:00:29
Average standard deviation of split frequencies: 0.008658
520500 -- (-765.119) (-765.769) [-772.199] (-765.284) * (-766.591) (-765.662) [-765.693] (-773.692) -- 0:00:29
521000 -- [-776.528] (-764.604) (-769.275) (-769.773) * (-766.167) [-769.091] (-771.069) (-766.649) -- 0:00:29
521500 -- (-774.084) (-766.924) (-768.387) [-766.603] * (-765.449) [-766.134] (-771.412) (-765.359) -- 0:00:29
522000 -- (-767.718) [-766.932] (-769.794) (-767.221) * [-766.548] (-766.486) (-770.920) (-765.914) -- 0:00:29
522500 -- [-771.306] (-768.724) (-766.945) (-769.124) * (-766.183) (-768.547) (-771.720) [-766.722] -- 0:00:29
523000 -- (-768.800) (-768.346) (-767.720) [-765.986] * (-767.548) (-765.552) (-769.101) [-766.696] -- 0:00:29
523500 -- [-765.740] (-765.032) (-768.081) (-767.071) * (-768.720) [-765.879] (-768.817) (-766.334) -- 0:00:29
524000 -- (-769.112) [-765.440] (-770.673) (-767.804) * (-768.494) (-764.836) [-766.983] (-765.759) -- 0:00:29
524500 -- (-766.915) (-765.579) [-769.203] (-765.671) * [-766.353] (-766.402) (-768.922) (-767.296) -- 0:00:29
525000 -- (-768.204) [-768.104] (-766.628) (-765.241) * (-770.130) (-771.227) (-766.688) [-765.504] -- 0:00:28
Average standard deviation of split frequencies: 0.008564
525500 -- (-768.231) [-769.988] (-768.519) (-770.323) * (-767.355) (-766.183) [-767.212] (-766.776) -- 0:00:28
526000 -- [-767.279] (-767.286) (-765.427) (-766.078) * (-769.298) (-765.563) [-766.685] (-765.748) -- 0:00:29
526500 -- [-767.810] (-765.710) (-769.447) (-768.078) * (-767.813) (-772.409) (-769.158) [-767.499] -- 0:00:29
527000 -- (-767.543) [-765.915] (-769.292) (-767.779) * (-766.021) [-767.412] (-766.553) (-767.088) -- 0:00:29
527500 -- [-765.478] (-769.940) (-766.258) (-764.764) * (-769.727) (-766.065) (-766.051) [-766.194] -- 0:00:29
528000 -- (-766.061) [-766.937] (-766.451) (-765.005) * (-766.587) (-766.415) (-767.523) [-770.851] -- 0:00:29
528500 -- (-767.910) [-768.220] (-765.495) (-769.340) * (-774.864) [-769.372] (-769.040) (-765.290) -- 0:00:29
529000 -- (-767.681) [-765.070] (-768.116) (-768.780) * (-768.859) (-768.895) (-767.942) [-767.456] -- 0:00:29
529500 -- (-766.710) [-766.324] (-767.003) (-768.294) * (-765.746) (-766.275) [-771.812] (-769.228) -- 0:00:29
530000 -- (-766.756) (-764.864) [-767.590] (-766.229) * (-764.980) [-766.274] (-770.744) (-768.916) -- 0:00:29
Average standard deviation of split frequencies: 0.008674
530500 -- (-766.169) (-766.155) (-767.895) [-766.051] * (-767.724) (-766.651) [-765.721] (-766.981) -- 0:00:29
531000 -- [-767.709] (-769.470) (-766.866) (-769.264) * (-768.175) (-766.453) (-768.634) [-764.970] -- 0:00:29
531500 -- [-766.241] (-766.953) (-766.596) (-765.732) * (-768.619) (-766.603) (-766.111) [-772.151] -- 0:00:29
532000 -- (-766.817) (-766.343) (-765.680) [-767.554] * (-768.043) (-765.278) [-765.227] (-765.400) -- 0:00:29
532500 -- [-768.989] (-768.066) (-768.586) (-766.544) * (-769.628) [-765.190] (-766.503) (-767.936) -- 0:00:28
533000 -- (-768.344) (-768.815) (-766.161) [-766.423] * (-766.809) (-771.706) [-765.939] (-766.585) -- 0:00:28
533500 -- (-766.251) [-765.640] (-766.469) (-767.643) * [-766.177] (-769.199) (-768.085) (-767.283) -- 0:00:28
534000 -- (-770.353) (-767.865) [-766.729] (-767.341) * (-767.343) [-766.213] (-767.001) (-770.844) -- 0:00:28
534500 -- (-765.951) (-766.138) [-766.607] (-768.624) * [-766.483] (-765.984) (-766.002) (-765.902) -- 0:00:28
535000 -- (-768.003) [-766.300] (-766.883) (-768.737) * (-767.336) [-765.620] (-768.237) (-775.229) -- 0:00:28
Average standard deviation of split frequencies: 0.008941
535500 -- (-770.654) [-765.611] (-767.340) (-768.356) * [-766.844] (-766.741) (-769.764) (-767.347) -- 0:00:28
536000 -- [-771.756] (-765.469) (-769.962) (-764.750) * (-765.425) [-769.612] (-766.465) (-766.133) -- 0:00:28
536500 -- [-770.232] (-768.447) (-766.470) (-766.556) * [-765.298] (-766.052) (-765.637) (-766.286) -- 0:00:28
537000 -- (-771.806) (-765.957) (-766.774) [-766.100] * (-765.690) (-769.131) (-766.593) [-767.075] -- 0:00:28
537500 -- (-767.701) (-766.830) [-775.234] (-766.178) * [-764.588] (-768.511) (-765.577) (-766.903) -- 0:00:28
538000 -- (-766.517) (-767.360) (-769.361) [-767.790] * (-764.973) (-767.553) [-765.055] (-768.140) -- 0:00:28
538500 -- (-768.625) (-767.871) (-766.761) [-766.354] * (-766.494) (-765.318) (-768.820) [-767.590] -- 0:00:28
539000 -- [-765.663] (-765.948) (-765.412) (-766.834) * (-766.780) [-764.827] (-770.854) (-766.096) -- 0:00:28
539500 -- (-765.798) (-765.441) (-766.796) [-765.929] * (-767.691) (-765.025) (-768.278) [-766.533] -- 0:00:28
540000 -- (-765.728) [-767.086] (-765.951) (-764.714) * [-765.352] (-765.147) (-767.628) (-766.602) -- 0:00:28
Average standard deviation of split frequencies: 0.009129
540500 -- (-768.824) (-765.386) (-765.110) [-765.033] * [-765.611] (-765.586) (-769.750) (-765.395) -- 0:00:28
541000 -- (-766.562) [-765.325] (-769.621) (-765.676) * (-772.805) [-765.671] (-766.818) (-765.447) -- 0:00:27
541500 -- (-766.974) [-766.859] (-773.862) (-766.402) * (-768.255) (-768.281) [-766.749] (-767.515) -- 0:00:27
542000 -- (-766.267) [-769.295] (-769.616) (-766.203) * [-765.477] (-765.996) (-772.757) (-765.853) -- 0:00:27
542500 -- (-765.127) (-766.418) (-766.019) [-765.654] * (-768.283) [-767.850] (-766.076) (-767.815) -- 0:00:27
543000 -- [-768.227] (-766.293) (-766.270) (-770.026) * (-766.161) (-766.799) [-765.903] (-770.454) -- 0:00:28
543500 -- (-766.294) (-766.065) [-767.443] (-766.300) * [-767.338] (-766.004) (-767.207) (-766.126) -- 0:00:28
544000 -- (-768.170) [-765.540] (-768.530) (-769.867) * (-766.717) (-766.487) [-766.843] (-766.913) -- 0:00:28
544500 -- (-768.150) (-773.525) (-769.979) [-766.871] * (-767.461) [-765.907] (-769.297) (-765.326) -- 0:00:28
545000 -- (-769.406) (-767.508) [-767.863] (-766.772) * (-766.366) [-767.060] (-766.677) (-767.658) -- 0:00:28
Average standard deviation of split frequencies: 0.009396
545500 -- [-767.728] (-769.309) (-769.084) (-769.933) * (-766.510) (-765.680) (-767.854) [-765.747] -- 0:00:28
546000 -- (-770.048) (-767.448) [-769.246] (-770.314) * (-765.185) (-769.059) (-767.180) [-765.624] -- 0:00:28
546500 -- (-766.167) (-772.251) (-772.462) [-766.960] * (-766.050) (-768.593) (-764.807) [-765.525] -- 0:00:28
547000 -- (-768.611) [-767.537] (-766.985) (-766.306) * (-768.735) (-766.453) [-764.920] (-765.503) -- 0:00:28
547500 -- (-767.128) [-767.923] (-773.151) (-767.929) * (-767.586) (-768.356) [-764.968] (-765.924) -- 0:00:28
548000 -- [-765.406] (-770.262) (-768.822) (-764.642) * [-766.799] (-766.140) (-771.202) (-765.298) -- 0:00:28
548500 -- (-766.925) (-769.242) [-766.227] (-765.979) * [-766.076] (-765.931) (-772.695) (-766.577) -- 0:00:27
549000 -- [-766.958] (-772.659) (-766.897) (-768.373) * [-764.741] (-765.736) (-767.920) (-769.729) -- 0:00:27
549500 -- (-767.044) (-766.785) (-766.390) [-765.381] * (-766.480) (-768.362) [-765.428] (-766.507) -- 0:00:27
550000 -- (-767.716) (-768.594) [-768.071] (-766.822) * (-767.087) (-765.252) [-765.538] (-768.731) -- 0:00:27
Average standard deviation of split frequencies: 0.008913
550500 -- (-766.970) [-765.113] (-766.832) (-768.546) * [-771.592] (-768.016) (-767.380) (-767.536) -- 0:00:27
551000 -- (-766.326) [-765.048] (-765.610) (-767.908) * (-768.146) (-767.917) (-766.942) [-767.873] -- 0:00:27
551500 -- (-768.082) (-765.750) [-765.355] (-766.917) * (-765.023) [-765.638] (-767.332) (-765.446) -- 0:00:27
552000 -- (-766.284) [-771.931] (-765.249) (-765.783) * (-766.746) (-766.503) (-766.225) [-766.930] -- 0:00:27
552500 -- [-766.611] (-771.405) (-767.475) (-767.497) * (-768.454) [-766.248] (-764.833) (-766.692) -- 0:00:27
553000 -- [-766.721] (-770.033) (-767.106) (-766.456) * (-766.532) [-765.677] (-767.753) (-768.194) -- 0:00:27
553500 -- (-768.468) (-765.633) (-767.090) [-766.432] * (-767.637) (-766.753) [-766.491] (-766.046) -- 0:00:27
554000 -- (-772.164) (-766.645) (-767.117) [-766.165] * (-768.371) [-767.330] (-767.203) (-770.524) -- 0:00:27
554500 -- (-767.127) (-766.208) [-766.120] (-766.930) * (-768.533) (-766.502) [-766.895] (-767.431) -- 0:00:27
555000 -- [-765.083] (-767.190) (-765.141) (-766.295) * (-767.888) [-768.556] (-764.990) (-766.547) -- 0:00:27
Average standard deviation of split frequencies: 0.009526
555500 -- (-766.938) [-765.577] (-766.418) (-767.502) * (-765.882) [-766.632] (-766.833) (-767.794) -- 0:00:27
556000 -- [-767.079] (-766.318) (-766.560) (-766.991) * (-767.570) (-765.669) [-765.784] (-771.213) -- 0:00:27
556500 -- (-766.232) (-765.577) (-765.789) [-767.884] * (-765.607) (-770.500) [-767.403] (-767.577) -- 0:00:27
557000 -- [-768.667] (-765.387) (-767.585) (-767.511) * (-766.291) [-766.509] (-766.013) (-765.841) -- 0:00:27
557500 -- (-769.360) (-765.577) (-765.900) [-766.188] * (-765.922) (-769.155) (-769.574) [-765.351] -- 0:00:26
558000 -- (-767.048) (-770.640) (-765.948) [-765.604] * (-766.192) [-765.900] (-769.405) (-766.365) -- 0:00:26
558500 -- [-766.852] (-768.984) (-769.236) (-772.112) * (-765.596) [-764.845] (-764.480) (-766.318) -- 0:00:26
559000 -- [-765.631] (-765.803) (-767.013) (-767.854) * (-766.091) (-765.668) [-765.479] (-768.554) -- 0:00:26
559500 -- [-766.929] (-767.657) (-765.992) (-765.463) * (-766.230) [-765.988] (-765.887) (-766.251) -- 0:00:27
560000 -- (-767.599) (-766.405) (-767.822) [-771.071] * [-765.957] (-770.218) (-764.701) (-769.004) -- 0:00:27
Average standard deviation of split frequencies: 0.009545
560500 -- (-769.665) [-766.133] (-767.852) (-771.059) * (-766.121) (-771.926) [-765.390] (-770.334) -- 0:00:27
561000 -- (-769.226) [-766.131] (-768.913) (-769.606) * (-766.274) [-765.090] (-771.231) (-767.140) -- 0:00:27
561500 -- (-765.698) (-765.509) (-769.442) [-767.545] * (-768.812) (-766.340) (-765.411) [-768.527] -- 0:00:27
562000 -- (-765.678) [-766.004] (-767.079) (-769.920) * [-768.058] (-767.029) (-765.034) (-766.884) -- 0:00:27
562500 -- (-767.722) (-764.828) (-765.971) [-767.177] * (-767.076) (-767.691) (-765.098) [-768.287] -- 0:00:27
563000 -- [-768.290] (-771.847) (-767.687) (-767.896) * (-768.011) (-770.339) [-769.300] (-766.401) -- 0:00:27
563500 -- (-765.648) (-767.389) [-765.640] (-765.473) * (-767.299) (-765.229) [-766.308] (-768.095) -- 0:00:27
564000 -- (-767.046) (-768.017) [-766.282] (-768.328) * [-767.695] (-765.277) (-767.128) (-768.435) -- 0:00:27
564500 -- [-771.448] (-765.922) (-767.510) (-766.598) * (-766.934) (-772.791) (-765.184) [-769.584] -- 0:00:27
565000 -- (-766.142) (-766.427) (-766.342) [-765.684] * (-767.735) [-766.867] (-766.746) (-767.326) -- 0:00:26
Average standard deviation of split frequencies: 0.010087
565500 -- [-767.537] (-766.709) (-767.465) (-769.726) * (-766.783) [-769.477] (-769.102) (-773.032) -- 0:00:26
566000 -- (-767.252) [-765.054] (-765.142) (-769.294) * (-768.231) [-767.787] (-764.764) (-769.729) -- 0:00:26
566500 -- (-766.183) [-765.059] (-764.618) (-768.735) * (-765.794) (-770.738) [-769.246] (-768.489) -- 0:00:26
567000 -- (-767.859) (-767.778) (-766.866) [-766.783] * (-767.133) (-767.232) (-768.116) [-766.558] -- 0:00:26
567500 -- (-768.090) (-767.575) (-768.315) [-765.642] * (-766.602) (-769.263) [-767.589] (-769.278) -- 0:00:26
568000 -- (-766.078) (-768.192) (-766.078) [-765.537] * (-766.573) (-767.161) [-769.975] (-766.761) -- 0:00:26
568500 -- (-766.610) (-765.932) [-766.495] (-768.924) * (-765.940) [-765.328] (-768.241) (-769.672) -- 0:00:26
569000 -- (-767.294) [-765.915] (-770.761) (-772.236) * (-764.911) (-764.701) [-770.487] (-768.152) -- 0:00:26
569500 -- (-767.712) (-767.080) [-766.793] (-766.289) * [-765.348] (-765.660) (-767.767) (-765.636) -- 0:00:26
570000 -- (-768.493) (-764.749) [-765.920] (-767.338) * (-766.353) [-767.625] (-766.813) (-768.390) -- 0:00:26
Average standard deviation of split frequencies: 0.010253
570500 -- (-770.404) (-766.268) (-766.510) [-767.728] * [-767.341] (-770.714) (-766.094) (-765.760) -- 0:00:26
571000 -- (-769.192) (-767.735) (-766.579) [-766.663] * (-768.347) [-764.904] (-768.306) (-765.888) -- 0:00:26
571500 -- (-767.561) (-766.473) [-766.122] (-771.343) * (-768.484) (-767.099) [-767.312] (-769.991) -- 0:00:26
572000 -- [-767.279] (-767.287) (-767.374) (-767.136) * (-764.943) [-766.796] (-765.576) (-764.811) -- 0:00:26
572500 -- (-767.776) (-765.443) [-766.675] (-765.416) * (-765.064) (-765.593) (-765.823) [-764.713] -- 0:00:26
573000 -- (-766.463) [-767.718] (-768.049) (-768.130) * (-765.918) [-766.923] (-767.333) (-766.621) -- 0:00:26
573500 -- (-773.414) [-767.007] (-767.606) (-770.406) * (-765.267) (-765.696) [-766.819] (-765.047) -- 0:00:26
574000 -- (-768.843) [-767.151] (-767.536) (-767.087) * (-765.941) (-767.548) [-766.243] (-771.085) -- 0:00:25
574500 -- (-772.127) (-769.667) (-769.153) [-766.513] * (-765.518) (-766.438) [-766.158] (-767.287) -- 0:00:25
575000 -- [-764.923] (-764.728) (-766.922) (-768.116) * (-765.518) (-766.891) (-769.663) [-766.597] -- 0:00:25
Average standard deviation of split frequencies: 0.010412
575500 -- (-766.400) (-769.651) (-770.079) [-766.540] * (-766.315) [-765.653] (-769.849) (-766.433) -- 0:00:25
576000 -- (-766.252) (-767.302) [-767.490] (-765.498) * [-767.585] (-766.369) (-766.480) (-765.665) -- 0:00:25
576500 -- (-765.984) (-769.027) (-766.945) [-766.475] * (-767.028) (-768.951) [-770.603] (-764.896) -- 0:00:26
577000 -- (-766.423) (-766.053) [-765.287] (-770.094) * (-765.231) (-767.089) (-765.579) [-767.547] -- 0:00:26
577500 -- [-767.168] (-765.297) (-768.788) (-766.103) * (-765.472) [-766.106] (-765.669) (-766.881) -- 0:00:26
578000 -- (-765.904) (-765.808) (-769.380) [-767.886] * (-768.769) (-767.216) [-767.687] (-769.543) -- 0:00:26
578500 -- (-766.403) [-765.893] (-766.505) (-766.292) * (-769.142) (-767.154) (-766.932) [-765.995] -- 0:00:26
579000 -- (-768.596) (-766.758) (-774.070) [-767.165] * (-769.232) [-767.023] (-766.915) (-769.545) -- 0:00:26
579500 -- (-768.047) (-766.720) (-774.249) [-765.697] * (-770.604) (-765.856) [-766.587] (-775.102) -- 0:00:26
580000 -- (-771.168) (-767.951) (-769.383) [-766.595] * [-767.308] (-766.510) (-769.326) (-773.186) -- 0:00:26
Average standard deviation of split frequencies: 0.010328
580500 -- (-769.676) [-767.445] (-765.698) (-766.919) * [-765.172] (-767.456) (-766.538) (-767.370) -- 0:00:26
581000 -- (-766.459) [-767.824] (-766.768) (-766.427) * (-765.337) (-766.550) [-767.754] (-767.273) -- 0:00:25
581500 -- [-766.278] (-770.076) (-767.231) (-767.846) * (-765.744) (-766.897) [-766.237] (-766.206) -- 0:00:25
582000 -- (-769.063) (-766.118) [-765.519] (-769.619) * (-768.967) [-766.616] (-768.928) (-766.424) -- 0:00:25
582500 -- (-768.016) (-764.970) (-766.524) [-769.305] * (-767.906) [-768.581] (-767.170) (-764.662) -- 0:00:25
583000 -- (-768.938) (-765.228) [-766.984] (-766.404) * (-773.554) [-764.806] (-764.967) (-764.652) -- 0:00:25
583500 -- (-770.058) (-766.471) (-766.707) [-770.727] * (-768.300) (-766.607) [-767.505] (-765.912) -- 0:00:25
584000 -- (-773.076) (-764.961) (-768.224) [-767.054] * [-766.098] (-766.966) (-768.676) (-766.046) -- 0:00:25
584500 -- (-772.050) (-765.376) [-771.755] (-766.772) * [-765.804] (-768.070) (-765.782) (-765.853) -- 0:00:25
585000 -- (-767.653) (-768.600) [-766.463] (-768.085) * (-765.522) (-766.576) [-766.271] (-766.630) -- 0:00:25
Average standard deviation of split frequencies: 0.009564
585500 -- [-765.240] (-766.372) (-766.173) (-768.864) * (-767.419) (-766.439) (-766.900) [-765.482] -- 0:00:25
586000 -- (-767.517) [-765.136] (-769.799) (-770.271) * (-769.426) (-766.453) [-765.171] (-767.756) -- 0:00:25
586500 -- (-766.115) [-765.211] (-767.246) (-767.733) * (-766.439) [-766.578] (-766.781) (-768.226) -- 0:00:25
587000 -- [-765.903] (-766.138) (-768.299) (-768.644) * (-767.961) [-766.180] (-766.344) (-768.650) -- 0:00:25
587500 -- [-767.431] (-765.607) (-765.055) (-766.450) * [-766.914] (-767.970) (-765.439) (-770.163) -- 0:00:25
588000 -- (-765.695) (-767.295) [-765.017] (-767.337) * (-773.458) (-768.116) [-765.367] (-766.814) -- 0:00:25
588500 -- (-766.303) [-768.510] (-766.991) (-767.298) * (-766.971) (-766.558) [-767.798] (-767.534) -- 0:00:25
589000 -- (-765.538) [-768.321] (-774.191) (-766.260) * (-767.667) (-768.909) (-765.645) [-767.702] -- 0:00:25
589500 -- [-765.572] (-768.967) (-769.066) (-766.315) * (-772.033) [-766.975] (-768.633) (-768.163) -- 0:00:25
590000 -- (-764.644) (-767.106) [-767.041] (-767.348) * (-768.565) [-766.502] (-767.541) (-764.796) -- 0:00:25
Average standard deviation of split frequencies: 0.009765
590500 -- (-766.297) (-769.955) [-764.831] (-768.548) * (-769.343) (-767.670) (-769.276) [-768.072] -- 0:00:24
591000 -- [-766.589] (-767.731) (-768.281) (-769.127) * (-767.269) [-766.662] (-766.651) (-766.994) -- 0:00:24
591500 -- [-767.621] (-767.294) (-766.047) (-766.575) * (-767.515) [-766.473] (-767.767) (-766.342) -- 0:00:24
592000 -- (-767.879) [-767.472] (-768.006) (-766.353) * (-772.756) [-764.562] (-766.708) (-766.378) -- 0:00:24
592500 -- (-766.719) [-768.983] (-766.284) (-767.970) * [-767.866] (-765.338) (-767.006) (-768.922) -- 0:00:24
593000 -- (-766.028) (-765.909) [-765.384] (-771.584) * (-767.268) [-766.817] (-766.601) (-769.549) -- 0:00:25
593500 -- (-766.549) [-766.122] (-765.176) (-771.752) * (-767.292) (-771.613) (-765.486) [-769.058] -- 0:00:25
594000 -- [-767.991] (-770.109) (-765.282) (-766.224) * (-764.990) (-768.328) (-766.837) [-765.576] -- 0:00:25
594500 -- (-765.350) [-767.372] (-767.256) (-768.541) * (-764.998) [-765.531] (-764.968) (-765.045) -- 0:00:25
595000 -- (-765.033) [-770.137] (-766.619) (-773.922) * (-766.004) (-765.851) (-766.850) [-767.159] -- 0:00:25
Average standard deviation of split frequencies: 0.009398
595500 -- (-770.844) (-767.805) (-765.552) [-765.417] * (-766.358) (-772.063) [-767.607] (-766.902) -- 0:00:25
596000 -- [-766.495] (-770.364) (-767.413) (-765.884) * [-767.093] (-767.044) (-766.819) (-765.177) -- 0:00:25
596500 -- [-765.762] (-765.693) (-766.921) (-767.022) * (-766.990) [-766.486] (-767.050) (-765.453) -- 0:00:25
597000 -- (-769.542) [-765.845] (-767.320) (-768.050) * (-771.721) (-765.090) (-768.990) [-765.542] -- 0:00:24
597500 -- (-766.245) (-769.441) (-765.935) [-766.391] * [-765.398] (-767.390) (-768.141) (-766.627) -- 0:00:24
598000 -- [-765.499] (-768.536) (-766.754) (-766.834) * (-765.072) (-766.998) (-766.387) [-765.595] -- 0:00:24
598500 -- (-768.365) (-770.521) [-770.046] (-765.667) * [-767.772] (-765.973) (-766.328) (-766.247) -- 0:00:24
599000 -- [-765.842] (-767.582) (-767.234) (-766.856) * (-765.169) (-767.716) (-765.420) [-767.294] -- 0:00:24
599500 -- (-766.362) (-765.777) (-769.158) [-765.346] * (-768.714) [-765.250] (-769.421) (-766.117) -- 0:00:24
600000 -- [-771.299] (-767.118) (-768.490) (-768.379) * (-765.400) [-768.241] (-769.449) (-767.096) -- 0:00:24
Average standard deviation of split frequencies: 0.009741
600500 -- (-774.289) [-765.076] (-768.057) (-766.021) * [-767.595] (-769.022) (-769.063) (-764.845) -- 0:00:24
601000 -- (-766.354) (-765.774) [-767.311] (-767.425) * (-766.946) [-766.896] (-766.370) (-767.025) -- 0:00:24
601500 -- (-766.185) [-765.077] (-765.852) (-768.168) * [-764.657] (-765.633) (-765.228) (-766.069) -- 0:00:24
602000 -- (-765.849) (-767.927) [-765.345] (-767.527) * [-766.547] (-769.277) (-767.475) (-773.169) -- 0:00:24
602500 -- (-765.754) (-771.248) [-765.821] (-765.146) * [-767.805] (-769.094) (-767.643) (-765.676) -- 0:00:24
603000 -- [-764.808] (-768.260) (-766.550) (-765.095) * (-770.590) [-767.559] (-769.815) (-767.027) -- 0:00:24
603500 -- (-767.014) [-765.078] (-766.502) (-765.388) * (-765.333) (-767.200) [-764.985] (-767.300) -- 0:00:24
604000 -- (-765.024) [-765.145] (-766.454) (-765.625) * (-766.692) (-767.156) [-764.857] (-766.987) -- 0:00:24
604500 -- (-765.745) (-765.832) [-766.889] (-765.270) * (-766.568) (-767.156) [-767.632] (-767.683) -- 0:00:24
605000 -- (-766.737) [-765.430] (-766.838) (-765.294) * (-764.690) [-766.608] (-764.764) (-765.988) -- 0:00:24
Average standard deviation of split frequencies: 0.009747
605500 -- (-770.398) [-764.659] (-766.917) (-765.724) * [-764.682] (-765.937) (-767.391) (-767.499) -- 0:00:24
606000 -- (-769.523) [-766.832] (-766.655) (-766.706) * [-765.217] (-765.470) (-767.843) (-770.069) -- 0:00:24
606500 -- (-771.622) [-766.009] (-767.461) (-767.708) * (-765.300) (-770.309) [-766.442] (-767.069) -- 0:00:24
607000 -- (-769.471) [-764.871] (-768.014) (-767.363) * [-764.745] (-769.613) (-765.073) (-766.399) -- 0:00:23
607500 -- (-766.800) (-765.285) (-767.252) [-765.537] * (-765.141) [-765.644] (-766.558) (-769.320) -- 0:00:23
608000 -- [-765.843] (-769.098) (-766.362) (-765.193) * (-765.356) (-768.168) (-768.424) [-768.104] -- 0:00:23
608500 -- (-766.195) (-765.739) (-767.286) [-765.661] * (-766.665) (-766.669) (-767.889) [-766.717] -- 0:00:23
609000 -- (-766.486) [-766.434] (-767.562) (-765.307) * (-766.253) (-767.531) (-765.495) [-768.497] -- 0:00:23
609500 -- (-769.671) (-769.783) [-766.674] (-765.145) * [-767.921] (-767.277) (-772.550) (-767.161) -- 0:00:23
610000 -- (-766.040) [-766.896] (-765.873) (-766.046) * (-766.484) (-766.763) [-765.561] (-767.967) -- 0:00:24
Average standard deviation of split frequencies: 0.009263
610500 -- [-764.624] (-767.493) (-766.400) (-765.769) * [-766.471] (-766.610) (-767.489) (-766.132) -- 0:00:24
611000 -- (-770.703) [-768.691] (-767.227) (-768.253) * (-765.000) (-765.169) (-764.583) [-766.608] -- 0:00:24
611500 -- [-768.090] (-767.680) (-767.223) (-767.292) * [-765.243] (-765.238) (-765.898) (-771.028) -- 0:00:24
612000 -- (-768.192) (-767.081) (-768.748) [-768.975] * (-769.484) (-769.066) (-766.580) [-769.037] -- 0:00:24
612500 -- [-766.794] (-767.334) (-772.250) (-767.185) * [-767.614] (-768.116) (-767.563) (-767.296) -- 0:00:24
613000 -- (-766.600) [-766.186] (-769.890) (-767.360) * (-766.602) [-765.946] (-768.569) (-769.987) -- 0:00:23
613500 -- [-765.620] (-766.317) (-767.082) (-767.462) * (-767.215) (-768.507) [-767.426] (-767.359) -- 0:00:23
614000 -- (-765.389) [-767.158] (-767.355) (-769.765) * (-766.418) (-766.772) [-768.588] (-768.792) -- 0:00:23
614500 -- (-765.415) (-770.246) (-766.719) [-768.761] * [-767.576] (-767.085) (-769.408) (-766.844) -- 0:00:23
615000 -- (-767.846) (-772.734) [-766.615] (-766.602) * (-771.231) [-766.906] (-769.336) (-768.267) -- 0:00:23
Average standard deviation of split frequencies: 0.009543
615500 -- (-766.179) (-769.685) [-765.673] (-768.719) * (-767.149) [-765.666] (-768.639) (-765.966) -- 0:00:23
616000 -- (-767.017) (-766.396) (-766.255) [-768.056] * (-768.098) [-767.609] (-766.850) (-765.104) -- 0:00:23
616500 -- (-768.552) (-765.758) [-765.638] (-768.456) * (-765.373) [-765.408] (-765.475) (-764.619) -- 0:00:23
617000 -- [-764.618] (-767.806) (-768.120) (-764.886) * (-770.051) [-765.164] (-768.209) (-765.918) -- 0:00:23
617500 -- [-767.951] (-769.900) (-770.023) (-767.012) * [-768.224] (-767.295) (-766.155) (-769.334) -- 0:00:23
618000 -- (-767.348) [-767.502] (-766.258) (-766.247) * [-765.092] (-767.413) (-765.972) (-769.343) -- 0:00:23
618500 -- (-766.800) (-766.120) (-765.602) [-766.468] * (-765.891) (-765.997) (-768.632) [-766.339] -- 0:00:23
619000 -- (-766.835) (-768.606) [-766.543] (-766.998) * (-768.169) (-766.203) (-767.250) [-766.898] -- 0:00:23
619500 -- (-766.344) (-766.455) (-765.211) [-766.992] * (-768.115) [-765.773] (-769.664) (-766.213) -- 0:00:23
620000 -- (-765.337) [-767.098] (-764.654) (-767.416) * (-766.290) [-767.898] (-769.580) (-765.866) -- 0:00:23
Average standard deviation of split frequencies: 0.009695
620500 -- (-766.014) [-767.252] (-764.666) (-765.442) * (-767.472) (-767.013) (-771.710) [-765.836] -- 0:00:23
621000 -- [-768.426] (-765.123) (-767.065) (-769.402) * (-767.152) [-766.091] (-766.124) (-766.203) -- 0:00:23
621500 -- (-765.596) (-764.943) (-767.421) [-767.040] * (-765.936) (-767.523) (-766.389) [-768.231] -- 0:00:23
622000 -- [-765.700] (-771.117) (-770.005) (-767.547) * [-770.595] (-768.770) (-767.236) (-769.316) -- 0:00:23
622500 -- (-765.066) (-767.448) [-770.866] (-768.500) * (-770.096) [-767.930] (-764.804) (-768.545) -- 0:00:23
623000 -- [-765.942] (-768.347) (-774.522) (-767.711) * (-770.289) (-769.894) (-764.629) [-765.616] -- 0:00:22
623500 -- (-765.948) (-770.035) [-766.506] (-767.699) * (-768.784) [-766.718] (-765.416) (-765.462) -- 0:00:22
624000 -- (-765.406) (-767.033) [-765.789] (-765.485) * (-773.310) (-766.920) (-766.344) [-765.227] -- 0:00:22
624500 -- (-766.072) (-768.267) [-765.837] (-767.343) * [-767.360] (-769.060) (-767.811) (-766.600) -- 0:00:22
625000 -- (-768.104) [-766.540] (-769.907) (-768.004) * (-771.272) (-766.695) (-768.982) [-765.262] -- 0:00:22
Average standard deviation of split frequencies: 0.009391
625500 -- (-768.264) (-768.294) [-765.416] (-766.595) * (-765.293) (-766.493) (-767.458) [-766.464] -- 0:00:22
626000 -- (-770.211) (-766.568) [-765.201] (-769.236) * (-770.363) (-768.060) (-769.837) [-768.483] -- 0:00:22
626500 -- (-767.671) [-765.007] (-766.406) (-766.571) * (-767.936) (-769.387) (-766.557) [-767.608] -- 0:00:23
627000 -- [-769.155] (-767.016) (-766.219) (-769.754) * (-767.644) (-770.283) [-768.082] (-768.881) -- 0:00:23
627500 -- (-766.629) [-767.447] (-768.002) (-766.996) * (-769.016) (-768.606) [-765.016] (-768.908) -- 0:00:23
628000 -- [-768.904] (-769.238) (-765.650) (-765.350) * (-766.912) (-769.496) [-765.607] (-765.855) -- 0:00:23
628500 -- (-772.374) (-766.172) [-765.364] (-765.712) * (-768.621) (-765.654) (-766.223) [-767.571] -- 0:00:23
629000 -- (-777.064) (-766.216) (-770.910) [-768.914] * [-768.053] (-766.555) (-765.144) (-766.825) -- 0:00:23
629500 -- (-765.350) (-766.354) (-766.673) [-765.680] * (-766.126) (-765.840) (-766.539) [-764.698] -- 0:00:22
630000 -- (-768.681) [-766.510] (-769.613) (-766.932) * [-767.492] (-770.702) (-765.994) (-765.857) -- 0:00:22
Average standard deviation of split frequencies: 0.009102
630500 -- [-765.845] (-765.677) (-765.522) (-766.965) * [-766.114] (-772.138) (-765.849) (-766.283) -- 0:00:22
631000 -- (-770.746) (-768.021) [-766.496] (-765.605) * (-768.180) [-766.553] (-767.121) (-765.239) -- 0:00:22
631500 -- [-769.566] (-764.984) (-770.487) (-767.326) * (-765.319) (-765.893) (-766.595) [-765.447] -- 0:00:22
632000 -- (-767.463) (-764.759) [-767.511] (-765.982) * [-769.916] (-768.665) (-768.483) (-765.189) -- 0:00:22
632500 -- [-765.582] (-765.092) (-767.555) (-766.855) * (-769.383) (-769.569) (-766.856) [-765.329] -- 0:00:22
633000 -- (-768.130) (-767.036) [-766.754] (-769.351) * [-765.229] (-768.764) (-766.784) (-767.497) -- 0:00:22
633500 -- (-765.722) (-766.403) (-765.267) [-767.117] * [-767.414] (-767.267) (-767.949) (-769.187) -- 0:00:22
634000 -- (-770.147) [-765.937] (-766.630) (-764.993) * [-765.085] (-769.226) (-768.822) (-765.327) -- 0:00:22
634500 -- [-765.334] (-766.592) (-765.710) (-765.911) * (-769.559) [-767.353] (-766.931) (-766.138) -- 0:00:22
635000 -- [-765.683] (-770.188) (-764.999) (-765.238) * (-766.829) (-767.431) (-766.989) [-766.768] -- 0:00:22
Average standard deviation of split frequencies: 0.009287
635500 -- [-764.908] (-768.586) (-766.583) (-766.554) * [-767.398] (-766.476) (-765.160) (-769.036) -- 0:00:22
636000 -- (-766.716) (-765.075) [-765.496] (-765.582) * (-768.043) [-767.087] (-766.954) (-765.275) -- 0:00:22
636500 -- (-768.308) (-765.737) [-766.253] (-767.728) * (-767.653) (-768.160) [-766.633] (-766.455) -- 0:00:22
637000 -- (-774.878) (-767.437) [-769.344] (-767.650) * (-766.470) [-765.853] (-764.741) (-767.172) -- 0:00:22
637500 -- (-767.775) (-766.791) [-769.534] (-766.777) * (-769.333) (-766.321) [-765.567] (-770.575) -- 0:00:22
638000 -- (-767.853) [-765.732] (-767.119) (-766.841) * (-768.258) [-765.886] (-767.382) (-770.512) -- 0:00:22
638500 -- [-766.235] (-765.234) (-768.545) (-766.961) * [-765.772] (-770.901) (-765.646) (-771.152) -- 0:00:22
639000 -- (-765.194) [-769.237] (-768.164) (-768.709) * (-764.831) [-764.970] (-770.376) (-767.723) -- 0:00:22
639500 -- (-765.111) (-772.364) [-767.281] (-766.245) * (-764.894) (-766.640) (-765.256) [-767.241] -- 0:00:21
640000 -- [-771.612] (-770.895) (-768.479) (-766.587) * (-766.231) (-765.435) [-765.210] (-770.251) -- 0:00:21
Average standard deviation of split frequencies: 0.008613
640500 -- (-767.270) [-766.910] (-764.984) (-771.046) * (-767.682) (-766.877) (-769.096) [-768.267] -- 0:00:21
641000 -- [-769.859] (-765.485) (-765.374) (-769.591) * (-764.897) (-766.321) [-770.639] (-769.299) -- 0:00:21
641500 -- (-766.388) (-766.376) [-766.195] (-766.347) * [-770.766] (-768.912) (-768.076) (-769.698) -- 0:00:21
642000 -- [-768.148] (-767.846) (-767.749) (-765.849) * (-768.366) (-767.488) (-768.636) [-769.172] -- 0:00:21
642500 -- (-766.789) (-767.872) [-765.100] (-766.337) * (-773.054) (-766.804) (-770.200) [-767.835] -- 0:00:21
643000 -- (-765.360) (-769.389) [-766.476] (-766.293) * (-767.470) (-766.649) (-767.180) [-766.060] -- 0:00:22
643500 -- (-767.174) (-766.484) [-768.079] (-766.680) * (-767.491) (-766.437) [-765.216] (-770.501) -- 0:00:22
644000 -- (-771.969) (-766.418) (-765.445) [-768.452] * (-765.443) (-768.048) (-769.262) [-765.012] -- 0:00:22
644500 -- (-768.584) (-766.285) [-766.188] (-768.304) * [-766.623] (-768.725) (-766.307) (-774.986) -- 0:00:22
645000 -- [-768.149] (-772.610) (-767.561) (-765.532) * (-766.918) (-766.852) (-765.313) [-766.398] -- 0:00:22
Average standard deviation of split frequencies: 0.008800
645500 -- (-772.460) [-767.605] (-774.892) (-765.410) * (-772.960) [-765.445] (-765.065) (-767.052) -- 0:00:21
646000 -- (-766.362) (-766.974) (-768.252) [-765.014] * (-766.850) (-766.236) (-764.645) [-770.430] -- 0:00:21
646500 -- (-770.134) [-766.579] (-770.193) (-768.876) * (-766.345) (-766.853) (-766.153) [-767.146] -- 0:00:21
647000 -- (-766.911) (-766.953) (-768.414) [-765.906] * [-766.277] (-766.245) (-767.429) (-766.298) -- 0:00:21
647500 -- (-764.733) [-765.288] (-768.079) (-767.127) * [-766.739] (-766.777) (-765.067) (-770.951) -- 0:00:21
648000 -- (-767.386) [-766.298] (-766.315) (-766.209) * (-767.944) (-766.136) [-766.429] (-766.349) -- 0:00:21
648500 -- (-765.107) (-767.955) [-766.122] (-764.960) * (-765.312) [-766.128] (-768.079) (-765.950) -- 0:00:21
649000 -- [-767.762] (-768.081) (-768.127) (-764.658) * (-769.212) (-767.707) (-768.071) [-768.507] -- 0:00:21
649500 -- (-769.159) [-767.541] (-768.936) (-765.810) * (-765.820) (-765.144) (-767.374) [-765.935] -- 0:00:21
650000 -- [-768.834] (-766.361) (-765.634) (-765.729) * [-766.764] (-765.289) (-765.714) (-766.924) -- 0:00:21
Average standard deviation of split frequencies: 0.008992
650500 -- (-767.597) (-768.545) (-767.028) [-766.337] * (-768.221) [-765.448] (-765.474) (-770.227) -- 0:00:21
651000 -- [-765.386] (-766.442) (-774.671) (-766.360) * [-768.986] (-768.433) (-769.301) (-766.656) -- 0:00:21
651500 -- (-765.345) (-768.488) (-766.956) [-765.799] * [-766.302] (-770.474) (-766.262) (-765.418) -- 0:00:21
652000 -- [-764.575] (-766.424) (-768.960) (-766.216) * (-766.302) (-766.987) (-765.759) [-766.116] -- 0:00:21
652500 -- [-765.661] (-766.026) (-767.491) (-767.622) * (-766.109) (-764.859) [-765.638] (-767.269) -- 0:00:21
653000 -- (-765.149) [-766.068] (-765.567) (-767.398) * (-766.421) [-764.662] (-765.698) (-768.190) -- 0:00:21
653500 -- (-767.367) (-776.420) (-764.875) [-767.262] * (-765.732) [-764.898] (-767.910) (-767.445) -- 0:00:21
654000 -- (-767.235) [-771.744] (-767.012) (-770.882) * (-766.684) [-768.428] (-766.700) (-767.483) -- 0:00:21
654500 -- (-766.253) (-771.440) (-765.288) [-765.484] * (-768.568) (-768.664) [-766.406] (-768.137) -- 0:00:21
655000 -- (-765.945) (-765.177) (-767.179) [-766.170] * [-766.050] (-768.798) (-767.359) (-768.635) -- 0:00:21
Average standard deviation of split frequencies: 0.008750
655500 -- [-766.400] (-765.980) (-767.976) (-766.832) * [-765.968] (-768.246) (-769.079) (-766.949) -- 0:00:21
656000 -- (-766.636) [-767.342] (-767.532) (-767.063) * (-765.511) [-769.118] (-766.678) (-767.462) -- 0:00:20
656500 -- (-768.758) (-766.413) (-766.526) [-767.400] * [-768.201] (-768.676) (-765.696) (-766.941) -- 0:00:20
657000 -- (-768.762) (-767.439) [-765.810] (-765.400) * (-766.258) (-769.164) [-765.795] (-766.153) -- 0:00:20
657500 -- (-765.790) [-768.208] (-767.338) (-768.857) * [-766.334] (-767.083) (-769.313) (-764.886) -- 0:00:20
658000 -- (-766.300) (-768.644) [-766.749] (-769.080) * (-765.456) [-768.288] (-766.380) (-764.813) -- 0:00:20
658500 -- [-766.942] (-767.747) (-767.007) (-771.060) * [-767.740] (-775.165) (-766.084) (-766.090) -- 0:00:20
659000 -- (-766.572) [-770.205] (-766.148) (-765.935) * [-765.188] (-771.329) (-767.181) (-770.350) -- 0:00:20
659500 -- (-767.184) (-769.234) [-766.945] (-765.800) * (-766.372) (-764.744) (-768.477) [-764.809] -- 0:00:20
660000 -- [-764.972] (-765.704) (-766.247) (-765.399) * (-767.827) [-764.768] (-767.859) (-765.790) -- 0:00:21
Average standard deviation of split frequencies: 0.009066
660500 -- (-767.189) [-770.742] (-772.536) (-767.708) * (-770.155) [-768.522] (-766.290) (-765.198) -- 0:00:21
661000 -- (-767.805) [-772.215] (-767.647) (-768.327) * [-765.016] (-765.746) (-765.779) (-765.958) -- 0:00:21
661500 -- (-768.645) [-767.363] (-770.990) (-768.418) * [-765.250] (-765.047) (-764.770) (-765.961) -- 0:00:20
662000 -- (-765.760) (-765.276) (-768.387) [-766.384] * (-765.987) (-766.238) [-765.060] (-766.832) -- 0:00:20
662500 -- (-765.933) [-765.274] (-766.095) (-765.535) * (-767.821) (-766.961) (-765.488) [-766.721] -- 0:00:20
663000 -- [-766.560] (-765.807) (-765.040) (-768.917) * [-765.204] (-767.213) (-774.637) (-764.814) -- 0:00:20
663500 -- [-765.840] (-765.080) (-766.344) (-765.334) * (-765.407) (-766.948) [-766.156] (-765.162) -- 0:00:20
664000 -- (-765.919) [-765.410] (-768.763) (-766.887) * (-768.112) (-766.298) [-765.946] (-768.332) -- 0:00:20
664500 -- [-765.564] (-766.933) (-767.489) (-765.805) * (-767.067) [-766.945] (-765.561) (-765.952) -- 0:00:20
665000 -- (-769.666) (-766.762) [-766.258] (-766.173) * (-768.154) (-766.088) [-769.990] (-765.949) -- 0:00:20
Average standard deviation of split frequencies: 0.009493
665500 -- [-768.038] (-768.472) (-766.083) (-765.806) * (-769.553) (-767.029) [-769.528] (-768.409) -- 0:00:20
666000 -- (-772.216) [-767.682] (-764.916) (-765.774) * (-767.339) [-768.659] (-770.942) (-770.622) -- 0:00:20
666500 -- (-769.291) (-765.664) (-765.389) [-767.133] * (-767.516) (-768.840) (-769.349) [-774.104] -- 0:00:20
667000 -- (-770.187) (-766.889) [-767.789] (-767.768) * [-767.975] (-772.112) (-765.478) (-770.604) -- 0:00:20
667500 -- (-767.669) [-769.014] (-769.640) (-765.320) * (-771.972) (-768.767) [-766.277] (-771.177) -- 0:00:20
668000 -- [-764.871] (-767.346) (-767.326) (-775.969) * (-767.630) (-765.979) (-766.879) [-767.522] -- 0:00:20
668500 -- (-766.903) [-769.506] (-775.315) (-769.781) * (-768.530) (-765.340) (-766.344) [-765.949] -- 0:00:20
669000 -- (-767.153) (-770.881) [-770.721] (-768.144) * (-770.297) [-765.496] (-765.086) (-767.824) -- 0:00:20
669500 -- (-770.130) (-766.808) [-768.766] (-767.625) * [-767.849] (-766.970) (-766.864) (-767.052) -- 0:00:20
670000 -- (-767.027) (-768.106) (-768.919) [-768.148] * [-765.444] (-766.068) (-769.291) (-764.735) -- 0:00:20
Average standard deviation of split frequencies: 0.009551
670500 -- (-769.553) [-765.360] (-768.434) (-765.726) * [-765.268] (-769.191) (-767.685) (-768.869) -- 0:00:20
671000 -- (-769.600) [-766.390] (-765.998) (-766.012) * (-771.382) (-768.396) [-768.350] (-767.673) -- 0:00:20
671500 -- (-767.000) [-766.510] (-768.778) (-770.094) * (-771.102) (-771.177) [-766.163] (-774.439) -- 0:00:20
672000 -- [-769.359] (-765.656) (-768.129) (-765.768) * [-764.936] (-767.487) (-767.887) (-767.076) -- 0:00:20
672500 -- [-766.261] (-765.450) (-765.929) (-765.759) * (-767.284) (-767.027) [-766.410] (-770.511) -- 0:00:19
673000 -- (-765.776) (-765.494) [-769.067] (-765.631) * (-767.908) (-767.536) [-768.986] (-768.304) -- 0:00:19
673500 -- (-767.489) (-765.145) [-765.527] (-769.623) * (-765.871) (-767.279) (-768.186) [-765.995] -- 0:00:19
674000 -- (-766.388) [-766.916] (-765.558) (-768.752) * [-764.654] (-766.510) (-766.223) (-774.235) -- 0:00:19
674500 -- (-765.534) [-765.880] (-765.544) (-765.503) * [-766.851] (-770.136) (-765.987) (-766.296) -- 0:00:19
675000 -- [-765.921] (-770.054) (-766.886) (-765.928) * (-767.449) (-767.738) (-768.615) [-766.136] -- 0:00:19
Average standard deviation of split frequencies: 0.009148
675500 -- (-764.966) (-769.376) (-767.939) [-768.562] * (-766.667) (-765.747) [-766.558] (-768.178) -- 0:00:19
676000 -- (-767.748) (-768.525) (-767.775) [-764.708] * (-765.610) (-768.324) [-766.704] (-766.481) -- 0:00:19
676500 -- (-770.780) (-769.853) (-768.743) [-764.649] * (-767.667) (-765.916) [-766.727] (-765.162) -- 0:00:19
677000 -- (-768.391) (-764.764) (-766.866) [-769.387] * (-768.334) (-765.264) [-768.401] (-765.780) -- 0:00:20
677500 -- (-766.801) (-765.220) (-766.207) [-766.485] * (-766.691) [-770.092] (-767.940) (-768.035) -- 0:00:19
678000 -- (-768.623) (-765.412) (-766.666) [-767.944] * (-768.318) (-765.516) [-768.443] (-767.286) -- 0:00:19
678500 -- (-768.738) (-766.036) (-765.579) [-765.301] * (-767.083) (-764.995) (-775.254) [-766.963] -- 0:00:19
679000 -- [-768.935] (-766.760) (-765.110) (-766.209) * (-767.272) (-767.800) (-765.865) [-765.723] -- 0:00:19
679500 -- (-767.382) (-769.831) (-765.333) [-767.311] * (-768.061) [-766.369] (-766.749) (-765.240) -- 0:00:19
680000 -- [-765.680] (-765.860) (-765.118) (-767.753) * [-767.700] (-769.421) (-769.354) (-766.878) -- 0:00:19
Average standard deviation of split frequencies: 0.008787
680500 -- [-768.817] (-769.162) (-764.727) (-766.483) * (-765.689) (-766.860) [-765.737] (-765.997) -- 0:00:19
681000 -- (-767.643) [-766.556] (-765.704) (-770.038) * (-764.925) [-766.822] (-767.609) (-766.026) -- 0:00:19
681500 -- [-765.523] (-768.085) (-769.204) (-765.485) * (-764.868) [-766.297] (-769.206) (-765.652) -- 0:00:19
682000 -- (-770.283) (-765.659) (-765.930) [-766.583] * (-767.731) (-769.473) [-768.836] (-766.460) -- 0:00:19
682500 -- (-771.774) [-767.086] (-768.068) (-766.472) * (-766.891) (-766.455) (-769.500) [-766.566] -- 0:00:19
683000 -- (-766.500) (-768.209) [-768.171] (-771.363) * (-765.659) (-770.938) [-769.687] (-766.569) -- 0:00:19
683500 -- (-767.628) (-767.889) (-765.868) [-764.987] * (-766.437) (-767.577) [-765.036] (-768.437) -- 0:00:19
684000 -- (-769.445) (-770.114) (-768.675) [-768.572] * [-766.283] (-764.852) (-768.322) (-770.228) -- 0:00:19
684500 -- (-766.973) [-764.680] (-765.363) (-768.424) * (-767.753) [-766.508] (-766.450) (-766.774) -- 0:00:19
685000 -- [-765.618] (-767.492) (-766.424) (-765.312) * (-765.892) (-766.069) (-765.012) [-767.922] -- 0:00:19
Average standard deviation of split frequencies: 0.009320
685500 -- (-765.601) [-768.610] (-768.446) (-769.963) * (-765.381) [-768.502] (-765.817) (-767.032) -- 0:00:19
686000 -- [-767.287] (-768.782) (-767.006) (-768.649) * (-764.895) (-771.026) (-766.356) [-765.206] -- 0:00:19
686500 -- [-768.402] (-764.750) (-766.462) (-764.956) * [-767.410] (-768.406) (-767.137) (-767.197) -- 0:00:19
687000 -- (-766.974) (-765.634) (-771.397) [-766.024] * (-766.398) (-767.016) (-766.375) [-767.119] -- 0:00:19
687500 -- (-764.715) [-766.125] (-767.490) (-768.047) * (-767.645) (-770.467) (-768.078) [-765.970] -- 0:00:19
688000 -- (-765.560) [-767.282] (-767.839) (-766.804) * (-766.908) (-765.836) (-771.383) [-768.298] -- 0:00:19
688500 -- [-771.438] (-765.807) (-768.035) (-766.195) * (-767.205) [-765.948] (-767.469) (-765.607) -- 0:00:19
689000 -- (-769.611) (-766.154) (-765.751) [-765.013] * [-767.359] (-766.608) (-765.994) (-768.713) -- 0:00:18
689500 -- (-770.374) (-768.352) [-766.419] (-764.957) * (-769.423) [-767.446] (-766.519) (-767.209) -- 0:00:18
690000 -- (-764.869) (-767.053) (-765.150) [-767.521] * (-766.099) (-769.294) [-766.931] (-768.753) -- 0:00:18
Average standard deviation of split frequencies: 0.009756
690500 -- (-765.119) (-766.646) [-765.801] (-769.014) * (-767.118) (-766.517) (-767.422) [-766.597] -- 0:00:18
691000 -- (-766.679) [-765.486] (-766.660) (-769.974) * (-767.083) [-768.070] (-768.836) (-768.506) -- 0:00:18
691500 -- (-766.679) (-765.123) (-769.320) [-766.239] * (-770.558) [-767.813] (-765.996) (-767.292) -- 0:00:18
692000 -- [-767.152] (-765.970) (-774.125) (-765.899) * (-771.317) (-768.296) [-768.168] (-766.532) -- 0:00:18
692500 -- (-766.890) (-772.018) (-771.535) [-764.706] * (-771.354) [-766.682] (-768.857) (-766.478) -- 0:00:18
693000 -- (-769.398) [-767.831] (-771.895) (-765.426) * (-764.495) [-766.234] (-766.640) (-766.377) -- 0:00:18
693500 -- (-767.738) (-765.855) (-768.770) [-765.544] * (-767.682) (-765.511) (-766.348) [-771.783] -- 0:00:19
694000 -- (-765.733) (-765.027) (-765.776) [-766.172] * (-773.950) (-769.920) (-766.106) [-765.131] -- 0:00:18
694500 -- (-765.631) (-768.731) [-771.431] (-765.047) * (-767.878) (-770.935) (-767.961) [-766.919] -- 0:00:18
695000 -- (-765.868) (-773.131) [-766.283] (-766.349) * (-770.325) (-768.054) (-773.827) [-766.983] -- 0:00:18
Average standard deviation of split frequencies: 0.009921
695500 -- (-766.612) (-771.988) (-767.823) [-767.942] * (-767.118) (-766.854) [-765.554] (-767.142) -- 0:00:18
696000 -- [-765.218] (-769.012) (-766.513) (-767.431) * [-764.815] (-768.392) (-766.934) (-766.759) -- 0:00:18
696500 -- (-767.677) (-766.531) [-766.126] (-765.993) * (-765.302) [-767.920] (-766.490) (-766.484) -- 0:00:18
697000 -- (-769.100) (-767.765) (-769.194) [-767.973] * (-765.095) (-768.090) [-766.715] (-765.656) -- 0:00:18
697500 -- (-766.196) [-768.358] (-765.892) (-767.699) * (-764.841) (-766.154) [-770.840] (-766.133) -- 0:00:18
698000 -- (-770.032) (-765.648) [-767.293] (-769.129) * [-766.295] (-766.544) (-767.558) (-766.950) -- 0:00:18
698500 -- (-766.573) [-765.112] (-767.014) (-766.220) * [-766.318] (-766.950) (-767.774) (-769.789) -- 0:00:18
699000 -- (-769.421) (-766.350) [-768.106] (-771.689) * [-764.787] (-767.823) (-765.983) (-766.613) -- 0:00:18
699500 -- [-774.119] (-769.129) (-766.709) (-768.793) * [-764.778] (-766.878) (-765.749) (-764.669) -- 0:00:18
700000 -- (-770.113) (-767.220) (-767.631) [-765.661] * (-766.505) [-765.699] (-766.363) (-766.393) -- 0:00:18
Average standard deviation of split frequencies: 0.009815
700500 -- (-769.094) (-766.498) (-765.869) [-768.906] * (-767.817) (-768.332) [-768.177] (-768.377) -- 0:00:18
701000 -- [-766.918] (-767.389) (-767.895) (-768.277) * (-767.116) (-768.274) [-767.557] (-765.938) -- 0:00:18
701500 -- (-767.240) (-767.700) [-768.525] (-767.337) * (-771.168) [-764.490] (-766.725) (-765.726) -- 0:00:18
702000 -- (-769.070) (-767.164) [-768.831] (-768.800) * [-767.399] (-766.646) (-765.606) (-767.269) -- 0:00:18
702500 -- (-769.893) (-767.331) [-768.015] (-766.556) * [-768.453] (-765.335) (-767.827) (-773.300) -- 0:00:18
703000 -- (-765.904) (-767.238) (-766.446) [-765.871] * [-770.591] (-769.592) (-766.173) (-767.150) -- 0:00:18
703500 -- (-767.460) (-767.864) (-766.075) [-764.736] * (-770.937) (-768.942) (-765.607) [-764.697] -- 0:00:18
704000 -- (-768.289) (-769.465) (-768.398) [-767.639] * (-768.288) (-767.151) [-765.928] (-765.262) -- 0:00:18
704500 -- (-770.552) (-768.126) (-765.838) [-767.110] * (-770.549) (-764.598) [-765.656] (-766.093) -- 0:00:18
705000 -- [-769.061] (-767.469) (-765.548) (-768.385) * [-769.089] (-764.650) (-764.769) (-766.340) -- 0:00:17
Average standard deviation of split frequencies: 0.009623
705500 -- [-769.183] (-767.097) (-766.401) (-767.955) * [-769.996] (-768.077) (-767.130) (-765.930) -- 0:00:17
706000 -- [-766.697] (-764.960) (-765.842) (-767.148) * (-770.131) [-770.646] (-769.903) (-764.916) -- 0:00:17
706500 -- [-765.576] (-766.311) (-768.284) (-765.377) * [-767.291] (-770.103) (-770.662) (-766.101) -- 0:00:17
707000 -- (-765.665) (-767.521) [-765.535] (-766.881) * (-765.678) (-767.937) (-766.649) [-765.618] -- 0:00:17
707500 -- (-768.578) [-765.437] (-765.741) (-768.191) * [-768.346] (-768.952) (-766.652) (-768.925) -- 0:00:17
708000 -- (-766.015) [-767.171] (-764.499) (-771.292) * (-766.032) (-768.859) (-770.142) [-765.546] -- 0:00:17
708500 -- [-766.024] (-765.822) (-766.175) (-767.616) * [-766.146] (-768.456) (-766.068) (-766.707) -- 0:00:17
709000 -- (-766.941) [-767.021] (-765.296) (-764.859) * (-770.976) [-767.769] (-767.728) (-769.011) -- 0:00:17
709500 -- (-767.474) [-766.868] (-765.350) (-767.014) * (-770.983) [-771.003] (-770.778) (-768.107) -- 0:00:17
710000 -- (-770.713) (-766.210) [-766.986] (-769.454) * (-770.319) (-767.056) [-764.994] (-768.503) -- 0:00:17
Average standard deviation of split frequencies: 0.009535
710500 -- (-767.697) (-769.880) (-766.782) [-765.045] * (-769.311) (-769.246) [-766.099] (-765.259) -- 0:00:17
711000 -- [-765.208] (-767.352) (-767.147) (-767.590) * [-770.198] (-768.158) (-770.652) (-765.116) -- 0:00:17
711500 -- (-768.908) (-767.747) [-770.134] (-767.323) * (-776.043) (-766.439) (-767.596) [-766.722] -- 0:00:17
712000 -- (-765.784) [-770.255] (-767.764) (-768.712) * (-768.929) [-765.947] (-767.549) (-768.764) -- 0:00:17
712500 -- [-765.018] (-769.198) (-766.483) (-768.626) * (-766.036) (-768.838) [-765.155] (-768.288) -- 0:00:17
713000 -- [-764.954] (-769.014) (-765.751) (-769.345) * [-766.482] (-767.920) (-765.388) (-770.953) -- 0:00:17
713500 -- (-764.954) [-768.255] (-764.796) (-767.864) * [-770.005] (-767.413) (-770.288) (-768.078) -- 0:00:17
714000 -- (-770.870) (-770.780) (-766.298) [-770.417] * [-765.301] (-769.747) (-768.692) (-769.020) -- 0:00:17
714500 -- (-767.621) (-765.976) (-765.790) [-768.939] * (-765.749) (-766.656) [-766.979] (-771.019) -- 0:00:17
715000 -- [-766.625] (-766.676) (-766.608) (-766.595) * (-766.504) (-765.740) (-772.869) [-764.757] -- 0:00:17
Average standard deviation of split frequencies: 0.009505
715500 -- (-766.899) (-768.807) (-767.761) [-766.576] * (-766.864) [-769.190] (-768.480) (-769.343) -- 0:00:17
716000 -- (-766.766) (-769.574) [-765.356] (-767.901) * (-767.157) (-768.059) [-765.437] (-766.285) -- 0:00:17
716500 -- (-766.426) (-767.907) [-769.698] (-768.907) * (-767.689) (-767.191) [-766.242] (-768.559) -- 0:00:17
717000 -- (-767.805) (-770.455) (-766.431) [-767.602] * (-767.886) (-767.394) [-765.575] (-765.618) -- 0:00:17
717500 -- [-766.714] (-767.203) (-765.851) (-767.690) * (-766.732) (-766.857) (-766.421) [-766.156] -- 0:00:17
718000 -- (-768.895) [-766.416] (-769.907) (-765.211) * (-765.831) (-768.077) (-767.420) [-768.664] -- 0:00:17
718500 -- (-767.461) (-770.303) [-770.304] (-765.191) * (-766.236) (-767.778) [-765.476] (-765.684) -- 0:00:17
719000 -- (-768.567) [-768.205] (-766.048) (-766.319) * (-768.144) (-767.100) [-766.502] (-765.517) -- 0:00:17
719500 -- (-767.863) (-766.537) [-771.658] (-767.241) * (-767.895) [-765.171] (-767.283) (-768.708) -- 0:00:17
720000 -- (-766.977) [-769.467] (-766.239) (-768.283) * (-769.415) (-767.690) [-766.333] (-765.033) -- 0:00:17
Average standard deviation of split frequencies: 0.009730
720500 -- [-767.097] (-771.197) (-766.227) (-765.488) * (-771.098) [-769.449] (-766.449) (-765.336) -- 0:00:17
721000 -- (-765.419) [-765.972] (-766.972) (-767.596) * (-768.069) (-773.847) [-766.837] (-766.438) -- 0:00:17
721500 -- (-766.038) [-766.083] (-771.583) (-765.373) * (-769.101) (-766.766) [-765.951] (-766.588) -- 0:00:16
722000 -- (-765.130) (-771.698) (-766.133) [-764.933] * (-767.291) (-766.315) [-766.833] (-765.629) -- 0:00:16
722500 -- (-767.134) [-766.795] (-766.756) (-767.209) * (-767.955) [-765.661] (-765.522) (-766.539) -- 0:00:16
723000 -- (-769.250) [-764.839] (-766.424) (-766.973) * [-765.197] (-766.482) (-769.210) (-767.429) -- 0:00:16
723500 -- (-766.529) (-766.017) (-768.285) [-768.181] * (-765.395) (-767.766) (-767.378) [-766.297] -- 0:00:16
724000 -- (-770.711) (-767.292) (-767.288) [-768.426] * (-768.951) (-765.781) (-766.740) [-773.384] -- 0:00:16
724500 -- (-767.793) (-766.596) [-766.865] (-766.235) * (-766.890) [-764.652] (-768.717) (-767.919) -- 0:00:16
725000 -- (-767.519) [-768.633] (-766.598) (-766.193) * (-765.350) (-764.600) (-767.255) [-765.901] -- 0:00:16
Average standard deviation of split frequencies: 0.009172
725500 -- (-765.869) [-766.303] (-766.125) (-767.332) * [-765.184] (-765.095) (-767.203) (-765.183) -- 0:00:16
726000 -- (-765.638) (-767.553) [-765.757] (-765.686) * (-765.124) (-765.459) (-772.077) [-765.207] -- 0:00:16
726500 -- [-766.964] (-765.400) (-770.323) (-767.009) * (-767.243) (-767.404) (-766.328) [-764.807] -- 0:00:16
727000 -- (-766.779) (-771.575) (-768.081) [-766.768] * (-770.001) [-768.180] (-764.658) (-766.565) -- 0:00:16
727500 -- (-765.710) (-766.155) [-768.996] (-767.399) * (-765.251) (-765.843) [-764.814] (-769.746) -- 0:00:16
728000 -- (-765.966) (-766.711) [-766.591] (-765.692) * (-766.109) (-765.998) [-768.103] (-767.864) -- 0:00:16
728500 -- (-765.335) (-767.540) [-766.259] (-764.906) * (-765.618) (-765.816) (-768.422) [-766.030] -- 0:00:16
729000 -- (-767.915) (-765.078) [-765.453] (-766.247) * (-768.264) (-766.889) (-767.862) [-766.063] -- 0:00:16
729500 -- (-766.702) [-766.225] (-766.778) (-765.120) * (-765.030) (-766.497) [-765.699] (-765.502) -- 0:00:16
730000 -- (-770.400) (-765.381) [-768.019] (-767.242) * [-767.204] (-774.789) (-765.429) (-764.700) -- 0:00:16
Average standard deviation of split frequencies: 0.009153
730500 -- [-767.124] (-770.345) (-767.176) (-765.659) * (-768.704) (-766.141) (-765.990) [-768.957] -- 0:00:16
731000 -- [-766.773] (-765.740) (-766.128) (-767.392) * (-767.177) (-765.803) (-767.492) [-766.061] -- 0:00:16
731500 -- (-772.537) (-765.934) (-767.859) [-766.365] * (-772.252) (-765.733) (-771.110) [-765.879] -- 0:00:16
732000 -- (-766.100) (-765.928) [-766.905] (-770.645) * (-769.646) (-767.246) (-767.774) [-766.506] -- 0:00:16
732500 -- (-765.294) (-768.328) [-766.710] (-770.123) * (-765.795) [-765.492] (-769.410) (-768.029) -- 0:00:16
733000 -- (-767.464) (-766.827) (-766.481) [-767.656] * (-764.820) [-765.338] (-767.365) (-769.399) -- 0:00:16
733500 -- (-765.249) (-766.935) [-765.579] (-771.107) * (-769.400) [-765.070] (-768.857) (-766.693) -- 0:00:16
734000 -- (-765.700) (-767.658) (-767.456) [-766.453] * (-766.325) (-768.011) [-767.927] (-768.983) -- 0:00:16
734500 -- [-768.270] (-766.629) (-770.452) (-767.364) * (-768.500) (-767.200) (-766.196) [-768.101] -- 0:00:16
735000 -- (-767.410) (-765.669) [-766.973] (-768.747) * (-766.320) (-766.189) [-766.715] (-766.473) -- 0:00:16
Average standard deviation of split frequencies: 0.009231
735500 -- (-767.034) (-767.393) (-766.850) [-768.061] * (-766.587) (-768.854) [-769.482] (-765.291) -- 0:00:16
736000 -- [-772.638] (-766.137) (-765.192) (-766.384) * [-764.853] (-765.723) (-766.321) (-767.741) -- 0:00:16
736500 -- [-773.343] (-766.697) (-764.637) (-768.365) * [-765.255] (-766.377) (-768.047) (-766.438) -- 0:00:16
737000 -- (-766.981) (-765.622) (-765.029) [-764.851] * [-766.513] (-766.704) (-769.913) (-766.465) -- 0:00:16
737500 -- (-768.286) [-765.840] (-770.289) (-767.077) * (-765.585) (-767.835) [-765.344] (-767.958) -- 0:00:16
738000 -- (-767.727) (-764.795) [-768.715] (-768.064) * (-764.841) [-765.720] (-765.599) (-764.889) -- 0:00:15
738500 -- (-766.537) [-766.264] (-766.910) (-765.109) * [-766.133] (-765.915) (-766.333) (-765.445) -- 0:00:15
739000 -- [-767.429] (-766.017) (-770.522) (-766.235) * (-767.120) [-767.322] (-765.372) (-766.083) -- 0:00:15
739500 -- (-766.217) [-767.453] (-766.581) (-766.241) * (-765.634) (-765.909) [-768.046] (-765.722) -- 0:00:15
740000 -- (-766.913) [-765.129] (-767.777) (-767.897) * (-765.884) (-768.611) [-765.878] (-766.357) -- 0:00:15
Average standard deviation of split frequencies: 0.008873
740500 -- [-765.735] (-765.118) (-766.895) (-767.161) * [-765.256] (-769.929) (-766.159) (-770.398) -- 0:00:15
741000 -- [-765.871] (-769.539) (-765.922) (-769.320) * [-765.161] (-771.262) (-766.974) (-768.025) -- 0:00:15
741500 -- (-766.210) (-766.786) [-765.121] (-765.086) * (-766.006) [-766.481] (-768.938) (-769.473) -- 0:00:15
742000 -- (-767.853) [-766.955] (-765.269) (-766.100) * (-767.259) [-767.790] (-766.947) (-769.776) -- 0:00:15
742500 -- [-767.336] (-767.564) (-764.991) (-767.671) * (-768.954) (-765.541) (-766.229) [-768.120] -- 0:00:15
743000 -- (-766.572) (-773.093) [-765.323] (-767.853) * [-768.576] (-765.419) (-764.426) (-766.949) -- 0:00:15
743500 -- (-767.050) (-771.243) (-766.303) [-766.173] * [-767.470] (-768.236) (-764.702) (-766.818) -- 0:00:15
744000 -- (-766.961) (-767.888) [-767.766] (-769.165) * (-768.371) (-766.734) (-764.866) [-770.064] -- 0:00:15
744500 -- [-770.057] (-769.231) (-765.379) (-766.135) * [-767.989] (-767.068) (-769.864) (-769.591) -- 0:00:15
745000 -- (-771.981) (-765.841) [-766.972] (-765.391) * (-766.665) [-768.784] (-767.474) (-769.488) -- 0:00:15
Average standard deviation of split frequencies: 0.009293
745500 -- (-768.198) (-765.156) [-767.907] (-766.980) * [-766.168] (-767.421) (-771.380) (-766.382) -- 0:00:15
746000 -- (-765.237) (-766.966) [-767.146] (-766.793) * (-769.175) [-766.520] (-769.835) (-768.235) -- 0:00:15
746500 -- (-766.009) (-767.102) (-765.219) [-766.680] * (-767.919) (-765.492) [-765.891] (-766.153) -- 0:00:15
747000 -- (-766.135) (-767.793) [-767.574] (-766.385) * (-768.961) [-765.365] (-766.423) (-766.279) -- 0:00:15
747500 -- [-766.168] (-765.830) (-769.673) (-765.846) * (-767.075) [-767.226] (-769.432) (-771.453) -- 0:00:15
748000 -- [-766.690] (-769.878) (-768.242) (-768.269) * (-769.646) (-768.320) [-765.977] (-766.737) -- 0:00:15
748500 -- (-767.834) [-766.809] (-765.786) (-768.791) * (-768.730) (-766.751) [-766.414] (-769.262) -- 0:00:15
749000 -- [-766.702] (-765.412) (-767.020) (-769.157) * [-767.094] (-764.704) (-768.701) (-771.229) -- 0:00:15
749500 -- (-767.901) (-765.326) [-767.759] (-766.681) * (-765.862) (-768.544) [-765.464] (-765.379) -- 0:00:15
750000 -- (-767.343) (-765.415) (-769.216) [-764.697] * [-766.628] (-766.795) (-766.801) (-769.705) -- 0:00:15
Average standard deviation of split frequencies: 0.009013
750500 -- (-766.147) [-770.017] (-768.877) (-764.816) * (-766.004) (-768.447) [-766.237] (-767.900) -- 0:00:15
751000 -- (-765.128) (-765.886) (-768.859) [-769.550] * (-766.004) (-769.549) [-766.367] (-764.881) -- 0:00:15
751500 -- (-768.188) (-766.245) [-768.981] (-768.812) * (-769.870) (-769.062) [-765.590] (-767.605) -- 0:00:15
752000 -- (-767.698) (-768.098) [-765.542] (-767.454) * (-766.577) [-766.742] (-764.859) (-765.806) -- 0:00:15
752500 -- (-766.281) (-767.924) [-765.463] (-769.490) * (-765.813) (-766.060) (-767.831) [-767.554] -- 0:00:15
753000 -- (-765.731) (-767.094) (-765.547) [-765.836] * (-765.172) (-768.437) [-765.376] (-765.560) -- 0:00:15
753500 -- [-765.584] (-766.097) (-769.872) (-765.221) * [-765.040] (-766.115) (-767.105) (-767.510) -- 0:00:15
754000 -- [-767.238] (-768.391) (-767.683) (-765.094) * (-768.812) (-765.557) (-765.453) [-768.765] -- 0:00:15
754500 -- (-766.248) (-766.695) [-768.044] (-768.564) * [-768.943] (-770.357) (-765.981) (-768.636) -- 0:00:14
755000 -- (-765.083) [-768.960] (-766.657) (-767.658) * (-770.398) (-767.683) (-767.191) [-767.089] -- 0:00:14
Average standard deviation of split frequencies: 0.009023
755500 -- (-767.870) (-766.696) [-767.146] (-767.653) * (-768.428) (-766.530) [-767.683] (-771.162) -- 0:00:14
756000 -- (-766.296) (-767.603) [-765.866] (-767.959) * [-767.899] (-767.931) (-768.129) (-771.441) -- 0:00:14
756500 -- (-767.609) (-765.322) [-769.849] (-769.998) * (-769.940) (-769.122) [-768.540] (-768.172) -- 0:00:14
757000 -- (-767.327) [-765.426] (-769.331) (-767.280) * (-772.568) [-767.357] (-766.966) (-767.786) -- 0:00:14
757500 -- (-770.539) [-767.569] (-768.246) (-767.500) * [-767.226] (-766.446) (-767.348) (-770.129) -- 0:00:14
758000 -- (-766.134) [-767.120] (-765.337) (-766.551) * (-766.643) [-765.844] (-766.511) (-767.057) -- 0:00:14
758500 -- (-768.744) (-772.837) (-766.184) [-766.005] * (-764.979) (-766.070) [-765.144] (-767.156) -- 0:00:14
759000 -- (-767.641) (-766.784) (-767.616) [-767.547] * (-765.825) [-765.251] (-765.806) (-765.492) -- 0:00:14
759500 -- (-765.434) [-765.135] (-770.636) (-765.948) * (-767.948) [-765.837] (-766.460) (-766.674) -- 0:00:14
760000 -- (-764.988) (-765.642) (-766.007) [-765.942] * (-766.626) (-765.790) [-767.831] (-767.379) -- 0:00:14
Average standard deviation of split frequencies: 0.008895
760500 -- [-764.671] (-767.280) (-768.600) (-766.282) * [-765.690] (-765.645) (-765.768) (-766.946) -- 0:00:14
761000 -- [-767.781] (-768.617) (-768.637) (-765.897) * (-767.424) [-766.528] (-765.095) (-766.798) -- 0:00:14
761500 -- [-768.981] (-767.749) (-768.323) (-764.896) * (-768.773) [-767.219] (-766.565) (-770.124) -- 0:00:14
762000 -- (-768.232) [-767.309] (-765.902) (-764.896) * (-767.174) (-768.128) (-768.821) [-766.282] -- 0:00:14
762500 -- [-769.273] (-766.390) (-766.194) (-768.210) * (-770.461) (-767.673) (-769.053) [-768.343] -- 0:00:14
763000 -- (-766.524) [-766.784] (-766.654) (-765.074) * (-769.742) (-768.228) [-767.934] (-766.833) -- 0:00:14
763500 -- (-765.482) (-765.158) (-765.976) [-766.000] * (-767.031) (-768.200) [-766.912] (-768.145) -- 0:00:14
764000 -- (-769.804) [-766.866] (-764.924) (-765.074) * [-769.794] (-768.458) (-767.085) (-771.347) -- 0:00:14
764500 -- (-770.623) (-766.185) [-768.605] (-765.371) * (-765.378) [-767.925] (-772.118) (-766.033) -- 0:00:14
765000 -- (-765.872) (-766.649) (-768.368) [-768.993] * [-765.744] (-765.308) (-769.595) (-767.739) -- 0:00:14
Average standard deviation of split frequencies: 0.008905
765500 -- (-766.693) [-769.758] (-765.708) (-765.477) * (-765.499) (-764.532) [-771.268] (-767.214) -- 0:00:14
766000 -- (-768.214) (-769.725) [-769.324] (-766.199) * (-765.229) [-766.334] (-765.888) (-769.318) -- 0:00:14
766500 -- (-765.664) (-772.785) [-764.983] (-764.878) * (-766.531) (-767.087) [-765.995] (-765.545) -- 0:00:14
767000 -- (-765.087) [-766.439] (-767.748) (-768.864) * [-765.635] (-767.246) (-766.938) (-766.984) -- 0:00:14
767500 -- (-768.736) (-768.200) (-766.299) [-768.757] * (-765.239) [-767.726] (-766.837) (-765.568) -- 0:00:14
768000 -- [-764.758] (-769.308) (-766.852) (-766.984) * (-766.617) (-766.989) (-770.969) [-764.975] -- 0:00:14
768500 -- (-768.838) (-770.788) [-764.875] (-766.646) * (-767.234) (-765.844) (-766.865) [-765.691] -- 0:00:14
769000 -- (-768.963) (-773.220) [-764.563] (-770.024) * (-766.761) (-769.510) (-765.683) [-767.061] -- 0:00:14
769500 -- (-765.195) [-768.019] (-767.294) (-766.797) * (-769.378) (-766.393) [-768.605] (-766.432) -- 0:00:14
770000 -- (-765.180) [-765.773] (-771.097) (-769.730) * (-770.321) (-766.413) [-765.695] (-766.641) -- 0:00:14
Average standard deviation of split frequencies: 0.008887
770500 -- [-765.664] (-765.910) (-765.722) (-769.311) * [-767.266] (-772.203) (-768.324) (-766.618) -- 0:00:13
771000 -- [-768.314] (-767.222) (-769.166) (-766.757) * (-768.511) (-766.170) (-770.600) [-765.162] -- 0:00:13
771500 -- [-764.795] (-766.638) (-768.069) (-768.493) * (-767.979) (-769.980) (-770.256) [-765.459] -- 0:00:13
772000 -- (-766.881) (-764.435) [-771.066] (-767.401) * [-767.092] (-770.605) (-768.356) (-765.300) -- 0:00:13
772500 -- [-769.479] (-768.519) (-766.484) (-767.616) * (-765.709) (-772.874) (-770.045) [-766.288] -- 0:00:13
773000 -- (-766.619) [-765.435] (-767.277) (-766.688) * (-767.476) (-768.167) (-767.978) [-768.246] -- 0:00:13
773500 -- [-767.522] (-764.762) (-765.660) (-766.389) * (-766.851) (-766.579) (-766.756) [-765.712] -- 0:00:13
774000 -- (-768.922) [-769.604] (-766.964) (-769.593) * [-766.944] (-767.447) (-766.935) (-767.435) -- 0:00:13
774500 -- [-767.512] (-772.730) (-765.684) (-767.459) * (-766.743) (-770.899) [-768.429] (-768.150) -- 0:00:13
775000 -- (-766.832) [-767.578] (-766.963) (-766.454) * (-769.009) [-770.105] (-764.680) (-771.057) -- 0:00:13
Average standard deviation of split frequencies: 0.008898
775500 -- (-765.818) [-768.837] (-768.363) (-769.685) * (-768.526) (-768.019) [-767.898] (-766.310) -- 0:00:13
776000 -- [-765.422] (-766.303) (-767.630) (-765.969) * (-768.902) [-765.133] (-765.875) (-764.857) -- 0:00:13
776500 -- [-765.683] (-770.132) (-766.583) (-768.894) * (-768.372) (-770.128) (-765.092) [-765.406] -- 0:00:13
777000 -- [-766.198] (-765.455) (-769.042) (-768.061) * (-768.391) [-765.881] (-765.507) (-766.399) -- 0:00:13
777500 -- [-767.672] (-767.271) (-768.152) (-768.428) * (-774.110) [-764.613] (-765.394) (-768.888) -- 0:00:13
778000 -- (-766.701) (-768.237) (-767.822) [-768.455] * (-766.380) [-767.404] (-767.488) (-767.379) -- 0:00:13
778500 -- [-767.873] (-766.100) (-767.583) (-769.302) * (-767.510) (-768.652) (-769.911) [-771.540] -- 0:00:13
779000 -- (-768.479) [-771.506] (-770.309) (-767.419) * [-767.315] (-765.960) (-764.911) (-768.213) -- 0:00:13
779500 -- (-765.211) (-770.186) (-768.270) [-768.871] * [-765.725] (-767.351) (-765.597) (-767.161) -- 0:00:13
780000 -- (-765.659) (-771.742) [-765.853] (-768.468) * (-772.546) (-767.764) (-766.067) [-764.911] -- 0:00:13
Average standard deviation of split frequencies: 0.008738
780500 -- (-771.449) (-769.553) (-765.888) [-767.946] * [-766.334] (-772.654) (-768.183) (-765.427) -- 0:00:13
781000 -- (-770.683) (-767.401) (-765.558) [-767.338] * (-768.415) (-769.292) (-767.368) [-767.592] -- 0:00:13
781500 -- (-766.526) [-767.797] (-767.097) (-767.221) * (-770.912) [-767.109] (-771.814) (-766.539) -- 0:00:13
782000 -- (-766.783) (-765.919) [-768.784] (-766.417) * (-766.255) (-765.695) [-765.516] (-765.534) -- 0:00:13
782500 -- [-766.684] (-766.281) (-765.035) (-766.497) * [-767.539] (-765.113) (-765.725) (-770.846) -- 0:00:13
783000 -- (-769.678) (-765.292) (-765.024) [-765.678] * (-765.952) [-767.954] (-766.966) (-765.424) -- 0:00:13
783500 -- (-767.240) (-765.810) [-765.893] (-765.539) * (-766.702) [-767.948] (-765.915) (-766.921) -- 0:00:13
784000 -- (-769.127) (-766.186) (-766.885) [-766.904] * (-770.630) (-769.918) [-765.960] (-766.007) -- 0:00:13
784500 -- [-767.144] (-767.066) (-770.076) (-766.154) * (-767.160) [-764.791] (-765.112) (-765.561) -- 0:00:13
785000 -- [-770.428] (-765.230) (-765.874) (-767.746) * (-765.206) (-765.379) (-769.559) [-766.575] -- 0:00:13
Average standard deviation of split frequencies: 0.008322
785500 -- (-768.381) [-765.166] (-766.468) (-766.280) * [-766.048] (-765.677) (-769.575) (-766.499) -- 0:00:13
786000 -- (-765.839) [-765.688] (-768.342) (-765.914) * (-765.763) (-764.727) (-769.079) [-765.489] -- 0:00:13
786500 -- (-771.219) [-764.818] (-767.847) (-767.887) * (-766.036) [-769.055] (-768.108) (-768.604) -- 0:00:13
787000 -- (-766.472) (-767.669) [-765.657] (-771.391) * (-769.004) [-764.849] (-769.626) (-767.308) -- 0:00:12
787500 -- (-765.788) (-765.508) [-765.012] (-767.713) * (-770.912) (-765.535) (-768.371) [-765.770] -- 0:00:12
788000 -- (-765.576) [-765.548] (-769.462) (-769.353) * (-768.904) [-766.215] (-766.900) (-769.881) -- 0:00:12
788500 -- [-768.970] (-765.315) (-767.715) (-765.576) * (-769.479) [-768.851] (-768.221) (-769.732) -- 0:00:12
789000 -- (-765.462) (-766.109) [-765.672] (-765.929) * (-769.488) (-765.483) (-770.025) [-771.636] -- 0:00:12
789500 -- (-766.699) [-765.043] (-767.357) (-769.375) * (-766.203) [-767.241] (-766.947) (-767.070) -- 0:00:12
790000 -- [-765.343] (-766.870) (-764.922) (-766.290) * (-767.209) [-766.614] (-765.528) (-768.610) -- 0:00:12
Average standard deviation of split frequencies: 0.008487
790500 -- [-766.089] (-766.376) (-766.567) (-766.936) * (-766.772) (-768.379) (-767.415) [-766.438] -- 0:00:12
791000 -- (-766.660) (-765.550) [-769.329] (-765.683) * (-766.629) [-765.592] (-766.312) (-764.994) -- 0:00:12
791500 -- (-766.288) (-766.278) [-767.341] (-770.910) * (-766.220) (-765.989) [-764.952] (-765.426) -- 0:00:12
792000 -- [-771.661] (-766.072) (-767.603) (-766.309) * (-765.419) [-767.784] (-765.965) (-769.153) -- 0:00:12
792500 -- (-765.433) (-766.479) [-767.757] (-768.576) * (-765.071) (-768.727) [-765.414] (-767.472) -- 0:00:12
793000 -- (-764.944) (-765.825) [-766.422] (-771.017) * (-768.880) (-766.551) [-767.195] (-767.820) -- 0:00:12
793500 -- [-766.121] (-764.912) (-766.347) (-770.159) * (-768.879) (-765.989) [-765.866] (-769.047) -- 0:00:12
794000 -- [-765.496] (-767.501) (-766.422) (-769.602) * (-767.084) [-765.622] (-768.308) (-766.117) -- 0:00:12
794500 -- (-767.540) (-766.092) (-764.827) [-766.900] * (-767.489) [-766.889] (-768.564) (-767.441) -- 0:00:12
795000 -- (-764.492) (-765.244) [-766.209] (-768.349) * (-768.488) [-766.316] (-767.981) (-767.861) -- 0:00:12
Average standard deviation of split frequencies: 0.007958
795500 -- (-765.834) [-765.564] (-764.958) (-766.366) * (-768.663) [-769.363] (-764.891) (-767.175) -- 0:00:12
796000 -- [-766.494] (-765.598) (-765.460) (-766.261) * (-766.100) (-768.067) [-766.208] (-766.645) -- 0:00:12
796500 -- (-769.841) (-771.297) [-766.524] (-765.605) * [-772.066] (-767.224) (-766.376) (-765.665) -- 0:00:12
797000 -- [-768.638] (-767.742) (-766.194) (-765.947) * (-765.202) (-765.080) (-768.735) [-764.963] -- 0:00:12
797500 -- (-769.801) (-769.464) (-766.538) [-775.189] * (-765.021) (-767.544) [-770.636] (-765.785) -- 0:00:12
798000 -- [-767.719] (-765.731) (-768.573) (-769.162) * [-764.846] (-764.982) (-767.058) (-765.366) -- 0:00:12
798500 -- (-770.148) (-767.476) (-770.788) [-769.941] * (-769.387) (-765.420) (-768.195) [-765.435] -- 0:00:12
799000 -- (-765.699) [-764.973] (-769.758) (-768.078) * (-767.626) [-766.379] (-765.456) (-765.012) -- 0:00:12
799500 -- [-765.960] (-768.273) (-766.365) (-770.754) * (-766.188) (-768.857) (-767.321) [-765.277] -- 0:00:12
800000 -- (-770.595) [-767.184] (-767.305) (-768.985) * (-770.836) [-769.254] (-768.870) (-766.119) -- 0:00:12
Average standard deviation of split frequencies: 0.007811
800500 -- (-767.724) (-767.069) [-765.781] (-767.906) * [-767.561] (-767.691) (-769.632) (-767.356) -- 0:00:12
801000 -- [-765.925] (-766.865) (-766.232) (-767.009) * (-766.275) [-765.723] (-767.470) (-765.707) -- 0:00:12
801500 -- (-766.944) [-769.254] (-770.964) (-768.351) * (-767.632) [-766.494] (-765.425) (-767.019) -- 0:00:12
802000 -- (-769.623) (-769.602) [-766.944] (-767.896) * (-770.154) (-768.197) (-765.746) [-765.504] -- 0:00:12
802500 -- (-771.764) [-767.114] (-765.560) (-768.916) * [-772.859] (-765.032) (-765.328) (-766.600) -- 0:00:12
803000 -- (-768.848) (-766.329) (-767.083) [-765.014] * (-766.340) (-765.193) [-765.605] (-765.178) -- 0:00:12
803500 -- (-765.348) [-768.964] (-769.609) (-765.810) * [-766.841] (-765.436) (-766.795) (-766.905) -- 0:00:11
804000 -- [-765.821] (-768.072) (-768.714) (-766.493) * [-765.392] (-765.290) (-766.088) (-765.585) -- 0:00:11
804500 -- (-767.786) (-768.078) [-772.741] (-767.125) * (-765.161) (-765.131) [-766.780] (-767.664) -- 0:00:11
805000 -- [-765.154] (-766.917) (-767.611) (-769.190) * (-765.511) [-766.010] (-766.762) (-769.615) -- 0:00:11
Average standard deviation of split frequencies: 0.007681
805500 -- [-765.155] (-764.851) (-767.021) (-765.766) * (-768.447) (-768.455) (-769.507) [-764.690] -- 0:00:11
806000 -- (-768.502) (-765.402) [-765.791] (-766.490) * [-767.157] (-766.932) (-771.984) (-768.290) -- 0:00:11
806500 -- (-769.363) (-772.823) (-768.431) [-765.829] * (-765.675) (-765.811) [-767.640] (-769.993) -- 0:00:11
807000 -- [-767.303] (-769.436) (-766.477) (-766.218) * (-767.671) (-765.686) [-769.384] (-766.629) -- 0:00:11
807500 -- (-769.714) (-770.966) [-765.014] (-772.137) * [-765.725] (-767.007) (-770.571) (-767.327) -- 0:00:11
808000 -- [-769.704] (-768.598) (-765.170) (-769.450) * (-766.147) [-765.639] (-769.439) (-765.503) -- 0:00:11
808500 -- (-768.061) (-767.318) [-764.903] (-765.111) * (-765.972) [-764.636] (-767.100) (-768.092) -- 0:00:11
809000 -- (-765.755) (-766.311) (-764.966) [-766.756] * (-765.477) (-766.564) [-765.213] (-767.132) -- 0:00:11
809500 -- (-768.299) (-767.569) [-766.601] (-767.543) * (-766.713) (-768.448) (-766.627) [-765.548] -- 0:00:11
810000 -- (-771.330) (-767.111) [-769.553] (-769.363) * (-766.947) [-765.841] (-767.753) (-765.431) -- 0:00:11
Average standard deviation of split frequencies: 0.007715
810500 -- [-768.358] (-771.989) (-767.019) (-766.004) * (-768.534) (-767.278) (-765.817) [-769.097] -- 0:00:11
811000 -- (-766.533) [-766.972] (-766.053) (-766.171) * (-766.711) [-765.740] (-768.009) (-765.388) -- 0:00:11
811500 -- (-770.306) [-766.333] (-765.321) (-765.603) * (-769.930) (-767.797) [-766.218] (-765.868) -- 0:00:11
812000 -- (-767.853) (-768.361) [-766.374] (-767.045) * (-766.655) (-767.925) [-765.259] (-765.828) -- 0:00:11
812500 -- (-771.164) (-766.601) [-765.850] (-768.822) * (-765.274) [-767.261] (-764.965) (-765.115) -- 0:00:11
813000 -- (-771.906) (-767.416) [-767.442] (-767.593) * (-766.898) (-767.455) (-767.963) [-766.403] -- 0:00:11
813500 -- (-771.015) (-767.535) (-768.601) [-767.414] * (-767.678) (-769.601) [-765.557] (-765.553) -- 0:00:11
814000 -- [-766.400] (-765.700) (-765.753) (-765.639) * [-766.147] (-766.930) (-765.229) (-769.036) -- 0:00:11
814500 -- (-766.206) [-764.998] (-766.183) (-765.389) * [-765.171] (-767.729) (-764.512) (-766.810) -- 0:00:11
815000 -- (-764.564) (-767.586) (-766.158) [-765.334] * (-765.600) (-765.465) [-770.726] (-767.268) -- 0:00:11
Average standard deviation of split frequencies: 0.007626
815500 -- (-765.866) (-765.080) (-765.222) [-766.647] * [-767.210] (-766.211) (-766.275) (-768.706) -- 0:00:11
816000 -- (-766.367) (-765.622) (-770.495) [-765.103] * (-766.749) [-771.559] (-766.775) (-769.826) -- 0:00:11
816500 -- (-769.539) (-766.717) (-766.037) [-765.243] * (-767.706) (-769.315) (-766.966) [-765.562] -- 0:00:11
817000 -- [-767.085] (-769.569) (-765.819) (-770.075) * [-765.744] (-766.555) (-766.906) (-765.719) -- 0:00:11
817500 -- [-767.031] (-769.030) (-765.168) (-768.319) * (-765.146) [-768.648] (-766.322) (-767.003) -- 0:00:11
818000 -- (-765.319) [-767.996] (-766.611) (-767.107) * (-766.116) [-767.489] (-767.855) (-769.235) -- 0:00:11
818500 -- (-768.301) (-767.860) [-765.644] (-765.908) * (-766.321) (-770.092) (-766.759) [-768.782] -- 0:00:11
819000 -- (-767.760) (-764.900) (-767.231) [-766.999] * [-771.219] (-765.699) (-768.208) (-765.102) -- 0:00:11
819500 -- [-766.488] (-768.840) (-766.441) (-765.929) * (-766.624) [-765.188] (-766.371) (-767.302) -- 0:00:11
820000 -- (-767.365) [-767.461] (-766.218) (-766.503) * (-769.829) (-769.333) [-765.022] (-770.231) -- 0:00:10
Average standard deviation of split frequencies: 0.007353
820500 -- [-767.100] (-768.581) (-767.816) (-766.102) * (-768.868) (-766.542) (-765.274) [-767.576] -- 0:00:10
821000 -- (-767.484) (-767.963) [-768.607] (-764.480) * (-770.202) (-769.572) (-765.995) [-768.578] -- 0:00:10
821500 -- (-767.355) (-765.443) (-770.832) [-770.723] * [-765.295] (-769.116) (-765.207) (-765.812) -- 0:00:10
822000 -- (-768.012) [-765.835] (-767.559) (-765.080) * [-765.108] (-765.770) (-768.740) (-767.318) -- 0:00:10
822500 -- (-765.704) (-768.359) (-767.819) [-766.942] * (-765.783) (-768.771) [-766.236] (-766.836) -- 0:00:10
823000 -- [-765.698] (-768.531) (-767.759) (-767.760) * (-767.470) (-768.289) (-768.029) [-765.567] -- 0:00:10
823500 -- (-765.910) (-767.905) [-764.902] (-766.738) * (-766.975) (-766.265) [-767.091] (-765.470) -- 0:00:10
824000 -- [-766.990] (-768.674) (-770.944) (-765.752) * [-768.952] (-766.322) (-766.368) (-767.342) -- 0:00:10
824500 -- (-769.342) (-769.193) (-766.573) [-767.552] * (-768.426) (-768.224) (-767.134) [-767.184] -- 0:00:10
825000 -- [-766.496] (-772.107) (-765.473) (-770.278) * (-767.398) [-766.249] (-769.003) (-767.221) -- 0:00:10
Average standard deviation of split frequencies: 0.007305
825500 -- (-775.459) (-767.223) [-767.289] (-769.255) * (-766.686) (-764.695) [-766.150] (-769.350) -- 0:00:10
826000 -- (-767.394) (-767.216) (-766.397) [-766.758] * (-766.421) [-767.310] (-766.199) (-768.719) -- 0:00:10
826500 -- (-767.676) [-767.353] (-767.239) (-766.925) * [-765.272] (-766.410) (-767.013) (-768.930) -- 0:00:10
827000 -- (-765.734) (-766.171) (-765.247) [-766.037] * (-764.802) (-767.466) [-766.971] (-767.041) -- 0:00:10
827500 -- (-766.557) (-768.380) (-765.289) [-766.297] * (-770.080) (-769.554) (-767.556) [-765.697] -- 0:00:10
828000 -- [-766.488] (-768.611) (-768.076) (-768.029) * [-767.397] (-768.675) (-769.336) (-765.576) -- 0:00:10
828500 -- [-765.992] (-765.840) (-768.087) (-772.134) * (-767.523) [-767.615] (-766.509) (-765.032) -- 0:00:10
829000 -- (-765.247) [-764.831] (-767.566) (-766.909) * (-766.097) (-770.822) [-767.123] (-769.114) -- 0:00:10
829500 -- [-772.736] (-765.205) (-770.813) (-771.346) * (-764.996) (-766.989) (-769.102) [-769.875] -- 0:00:10
830000 -- [-766.883] (-765.072) (-768.245) (-766.379) * [-765.716] (-765.853) (-769.403) (-772.874) -- 0:00:10
Average standard deviation of split frequencies: 0.007264
830500 -- (-767.130) (-769.805) (-768.242) [-766.338] * (-766.778) [-765.774] (-769.937) (-765.111) -- 0:00:10
831000 -- (-777.102) (-767.935) [-765.605] (-765.980) * (-764.780) (-767.940) [-766.438] (-766.221) -- 0:00:10
831500 -- (-771.241) [-766.821] (-766.082) (-765.243) * (-766.377) (-766.385) (-766.606) [-766.677] -- 0:00:10
832000 -- [-767.906] (-768.665) (-766.713) (-765.743) * (-765.704) (-767.452) [-767.884] (-767.086) -- 0:00:10
832500 -- [-767.431] (-766.130) (-768.920) (-765.157) * (-765.397) (-767.429) (-765.994) [-765.403] -- 0:00:10
833000 -- (-771.682) (-765.256) (-766.716) [-765.227] * (-764.820) (-767.317) (-764.986) [-766.860] -- 0:00:10
833500 -- [-769.687] (-765.624) (-767.796) (-768.017) * (-767.410) (-767.014) [-765.720] (-766.850) -- 0:00:10
834000 -- (-765.559) (-767.746) [-766.059] (-766.973) * (-766.181) (-768.338) (-765.267) [-765.001] -- 0:00:10
834500 -- [-767.441] (-767.550) (-769.148) (-766.571) * [-767.892] (-766.480) (-765.162) (-764.834) -- 0:00:10
835000 -- (-768.941) [-767.157] (-768.598) (-767.956) * (-766.006) [-766.707] (-766.083) (-766.277) -- 0:00:10
Average standard deviation of split frequencies: 0.006804
835500 -- (-766.643) (-766.481) (-764.743) [-765.189] * (-766.420) (-765.126) [-765.172] (-765.482) -- 0:00:10
836000 -- (-764.688) [-766.325] (-765.207) (-766.387) * (-768.550) (-768.567) [-765.652] (-766.918) -- 0:00:10
836500 -- [-764.642] (-767.411) (-766.793) (-765.041) * [-768.717] (-765.254) (-764.664) (-768.605) -- 0:00:09
837000 -- [-771.165] (-765.614) (-767.965) (-765.364) * [-765.762] (-767.620) (-764.662) (-772.585) -- 0:00:09
837500 -- (-765.865) [-768.340] (-765.767) (-765.043) * (-766.350) (-767.695) (-766.878) [-768.011] -- 0:00:09
838000 -- (-765.695) (-766.564) [-764.995] (-765.531) * (-767.062) [-770.030] (-766.193) (-767.800) -- 0:00:09
838500 -- [-766.448] (-765.371) (-765.151) (-765.691) * (-767.962) (-765.511) (-765.289) [-768.624] -- 0:00:09
839000 -- (-766.020) (-766.548) (-777.881) [-764.683] * [-766.118] (-764.800) (-765.413) (-769.525) -- 0:00:09
839500 -- [-766.439] (-766.927) (-765.700) (-765.973) * (-770.106) [-768.275] (-764.644) (-768.290) -- 0:00:09
840000 -- (-767.400) [-767.502] (-766.765) (-768.127) * (-768.489) [-764.970] (-766.254) (-768.108) -- 0:00:09
Average standard deviation of split frequencies: 0.006505
840500 -- [-767.564] (-766.756) (-766.575) (-766.366) * [-767.483] (-767.320) (-770.471) (-767.540) -- 0:00:09
841000 -- (-770.783) (-766.181) [-767.253] (-765.276) * [-765.516] (-765.417) (-767.943) (-766.915) -- 0:00:09
841500 -- (-765.493) (-765.749) (-766.949) [-768.742] * [-767.471] (-767.001) (-767.915) (-765.433) -- 0:00:09
842000 -- (-765.917) (-769.695) (-767.441) [-766.771] * (-768.533) [-768.073] (-766.590) (-768.274) -- 0:00:09
842500 -- (-767.005) [-765.809] (-772.220) (-768.274) * (-767.434) (-767.149) (-767.144) [-766.877] -- 0:00:09
843000 -- (-770.202) [-767.537] (-765.468) (-771.820) * (-765.908) (-765.881) (-772.082) [-766.606] -- 0:00:09
843500 -- (-765.388) [-766.068] (-766.750) (-765.355) * [-765.740] (-767.704) (-770.051) (-766.337) -- 0:00:09
844000 -- [-765.618] (-766.306) (-764.707) (-765.079) * (-767.858) [-767.914] (-766.015) (-765.845) -- 0:00:09
844500 -- (-769.062) (-767.669) [-765.125] (-764.842) * (-766.077) [-765.766] (-769.869) (-767.260) -- 0:00:09
845000 -- [-766.951] (-767.449) (-768.271) (-770.663) * (-767.472) [-766.721] (-770.687) (-765.662) -- 0:00:09
Average standard deviation of split frequencies: 0.006464
845500 -- (-765.444) (-771.383) [-770.610] (-766.335) * (-766.553) [-768.821] (-766.365) (-767.646) -- 0:00:09
846000 -- [-766.778] (-766.730) (-767.031) (-765.241) * [-765.658] (-766.088) (-766.132) (-765.107) -- 0:00:09
846500 -- (-768.135) (-766.810) [-770.154] (-767.722) * (-769.305) (-766.115) [-767.854] (-767.452) -- 0:00:09
847000 -- (-768.508) [-766.629] (-770.861) (-769.841) * (-767.800) (-767.226) [-768.290] (-768.311) -- 0:00:09
847500 -- (-769.653) (-769.482) [-768.070] (-765.661) * (-767.793) (-765.906) [-765.350] (-768.704) -- 0:00:09
848000 -- (-767.897) (-770.508) (-765.931) [-765.795] * (-768.575) (-766.175) (-770.790) [-766.377] -- 0:00:09
848500 -- (-768.170) [-765.242] (-770.297) (-765.181) * (-768.999) [-766.369] (-766.007) (-770.303) -- 0:00:09
849000 -- (-765.577) (-767.571) [-769.139] (-768.522) * (-769.083) [-765.903] (-767.585) (-769.621) -- 0:00:09
849500 -- [-765.170] (-766.700) (-767.854) (-766.918) * (-766.440) (-765.738) (-764.833) [-767.372] -- 0:00:09
850000 -- [-765.073] (-769.568) (-767.766) (-772.852) * (-766.434) (-766.397) (-765.370) [-773.796] -- 0:00:09
Average standard deviation of split frequencies: 0.006581
850500 -- [-766.550] (-765.871) (-770.260) (-767.336) * [-765.779] (-766.449) (-770.213) (-766.889) -- 0:00:09
851000 -- (-764.667) [-765.076] (-765.871) (-769.288) * (-767.539) [-768.687] (-765.913) (-769.188) -- 0:00:09
851500 -- (-764.664) [-766.254] (-768.442) (-765.932) * (-765.120) (-770.228) (-766.473) [-765.766] -- 0:00:09
852000 -- [-768.053] (-768.446) (-768.671) (-767.000) * [-765.380] (-765.513) (-767.062) (-769.888) -- 0:00:09
852500 -- (-764.846) (-769.057) [-766.161] (-765.773) * (-767.426) [-767.180] (-768.585) (-765.202) -- 0:00:08
853000 -- (-767.140) (-766.853) [-765.532] (-767.105) * (-765.811) (-770.577) (-766.459) [-766.845] -- 0:00:08
853500 -- (-765.693) [-765.175] (-765.912) (-766.247) * (-771.010) (-765.438) (-771.582) [-768.348] -- 0:00:08
854000 -- (-766.787) [-766.678] (-766.535) (-768.216) * [-766.481] (-769.210) (-770.048) (-765.816) -- 0:00:08
854500 -- (-765.916) [-766.315] (-767.400) (-767.517) * (-771.004) (-766.785) [-767.394] (-765.131) -- 0:00:08
855000 -- (-765.728) (-767.424) [-765.789] (-778.039) * (-764.987) [-764.992] (-766.305) (-766.758) -- 0:00:08
Average standard deviation of split frequencies: 0.007056
855500 -- (-766.712) (-768.348) [-766.884] (-769.424) * (-772.606) (-767.157) (-765.152) [-765.727] -- 0:00:08
856000 -- [-765.131] (-766.051) (-771.593) (-766.289) * (-771.412) (-766.803) [-765.782] (-765.076) -- 0:00:08
856500 -- (-765.601) (-768.642) [-768.572] (-765.617) * (-772.732) (-765.737) [-767.246] (-764.983) -- 0:00:08
857000 -- [-766.390] (-767.198) (-770.682) (-766.149) * (-769.755) [-767.050] (-768.495) (-766.898) -- 0:00:08
857500 -- [-766.781] (-774.241) (-767.911) (-766.214) * [-771.810] (-765.552) (-768.644) (-768.080) -- 0:00:08
858000 -- (-768.770) (-766.059) (-767.605) [-767.214] * (-767.752) (-765.187) [-767.735] (-768.318) -- 0:00:08
858500 -- (-767.669) (-768.247) (-767.177) [-765.337] * (-767.638) (-766.557) (-765.535) [-766.995] -- 0:00:08
859000 -- [-767.761] (-768.507) (-765.963) (-766.179) * [-765.885] (-766.408) (-766.133) (-768.783) -- 0:00:08
859500 -- (-765.654) [-767.440] (-765.531) (-764.670) * (-766.686) [-770.445] (-766.186) (-769.697) -- 0:00:08
860000 -- (-765.540) (-766.247) [-766.643] (-766.105) * [-768.532] (-765.724) (-766.168) (-765.888) -- 0:00:08
Average standard deviation of split frequencies: 0.007086
860500 -- (-766.056) (-765.943) [-765.502] (-768.092) * (-765.515) (-765.273) [-769.281] (-766.982) -- 0:00:08
861000 -- (-768.206) (-767.150) [-765.785] (-768.586) * [-764.921] (-774.015) (-770.194) (-768.082) -- 0:00:08
861500 -- [-766.347] (-768.235) (-766.484) (-765.161) * (-764.916) (-774.127) [-769.579] (-766.537) -- 0:00:08
862000 -- [-766.444] (-768.572) (-766.113) (-769.818) * (-765.526) [-768.251] (-766.462) (-766.467) -- 0:00:08
862500 -- [-770.137] (-768.480) (-771.879) (-766.277) * [-766.438] (-768.203) (-764.780) (-767.933) -- 0:00:08
863000 -- (-766.160) (-775.730) [-766.266] (-768.282) * (-766.571) [-766.812] (-764.799) (-764.612) -- 0:00:08
863500 -- (-766.856) [-765.635] (-767.295) (-765.702) * (-765.820) (-767.884) [-764.888] (-764.777) -- 0:00:08
864000 -- [-770.632] (-765.287) (-766.642) (-767.317) * (-767.764) (-766.771) (-764.943) [-765.234] -- 0:00:08
864500 -- (-766.474) (-766.427) (-765.445) [-766.981] * [-765.235] (-768.115) (-768.132) (-768.798) -- 0:00:08
865000 -- (-767.038) [-767.330] (-772.283) (-770.871) * [-766.057] (-771.879) (-768.064) (-766.347) -- 0:00:08
Average standard deviation of split frequencies: 0.007247
865500 -- [-765.020] (-771.107) (-768.083) (-769.134) * [-767.666] (-768.148) (-764.992) (-766.952) -- 0:00:08
866000 -- (-767.374) (-766.365) [-767.039] (-768.957) * (-765.862) [-765.170] (-766.570) (-765.704) -- 0:00:08
866500 -- (-767.698) (-767.279) (-766.870) [-766.495] * (-766.736) (-764.995) (-766.199) [-764.892] -- 0:00:08
867000 -- (-767.619) [-769.361] (-767.430) (-765.223) * (-767.203) (-766.556) [-767.080] (-765.326) -- 0:00:08
867500 -- (-768.497) (-768.627) (-765.557) [-765.545] * (-767.748) (-766.622) (-767.619) [-765.001] -- 0:00:08
868000 -- [-766.473] (-765.539) (-768.539) (-765.750) * [-766.974] (-767.248) (-768.148) (-766.230) -- 0:00:08
868500 -- (-766.792) (-769.067) (-765.378) [-765.299] * (-764.963) (-766.208) [-767.710] (-768.357) -- 0:00:08
869000 -- (-772.040) [-768.270] (-765.537) (-765.853) * [-765.385] (-767.443) (-766.871) (-764.562) -- 0:00:07
869500 -- [-765.824] (-775.452) (-764.676) (-768.322) * [-767.866] (-771.663) (-768.402) (-765.306) -- 0:00:07
870000 -- (-765.365) (-769.848) (-765.443) [-770.947] * (-766.686) [-769.105] (-769.032) (-766.787) -- 0:00:07
Average standard deviation of split frequencies: 0.007174
870500 -- [-765.708] (-768.968) (-765.985) (-774.963) * [-764.583] (-766.597) (-769.415) (-767.127) -- 0:00:07
871000 -- [-767.534] (-768.050) (-765.829) (-764.828) * [-765.437] (-765.326) (-765.467) (-767.588) -- 0:00:07
871500 -- (-775.126) (-765.847) (-767.811) [-766.023] * (-765.836) [-766.781] (-766.842) (-766.818) -- 0:00:07
872000 -- (-768.214) [-765.116] (-765.202) (-765.053) * (-765.111) (-767.294) (-768.541) [-766.123] -- 0:00:07
872500 -- (-767.722) [-765.484] (-764.824) (-765.690) * (-764.792) (-768.091) (-766.954) [-769.058] -- 0:00:07
873000 -- (-765.658) (-766.808) (-768.459) [-765.980] * (-765.483) (-765.103) [-767.373] (-769.617) -- 0:00:07
873500 -- [-765.314] (-770.338) (-773.554) (-767.422) * (-765.591) (-765.547) (-766.253) [-766.336] -- 0:00:07
874000 -- (-766.584) (-767.922) [-769.851] (-774.948) * [-766.469] (-765.609) (-765.340) (-770.647) -- 0:00:07
874500 -- (-769.229) (-765.518) (-767.524) [-770.205] * (-770.677) (-766.799) (-766.637) [-769.632] -- 0:00:07
875000 -- (-766.655) (-768.871) [-765.505] (-768.200) * (-769.506) (-767.593) [-766.920] (-768.555) -- 0:00:07
Average standard deviation of split frequencies: 0.007130
875500 -- (-765.109) (-767.610) [-766.178] (-767.616) * (-765.832) (-765.728) [-765.751] (-764.974) -- 0:00:07
876000 -- [-765.941] (-771.732) (-770.661) (-767.549) * (-766.526) (-767.845) (-766.425) [-764.825] -- 0:00:07
876500 -- (-765.858) (-769.452) [-768.847] (-768.562) * (-766.659) (-765.141) (-766.059) [-766.254] -- 0:00:07
877000 -- (-765.595) (-765.655) [-766.184] (-770.422) * (-770.385) [-765.481] (-766.760) (-766.601) -- 0:00:07
877500 -- [-765.191] (-766.164) (-766.069) (-768.900) * (-770.976) (-768.335) (-766.452) [-766.253] -- 0:00:07
878000 -- [-771.057] (-766.514) (-768.158) (-769.386) * (-766.658) (-769.232) [-767.266] (-768.255) -- 0:00:07
878500 -- (-766.460) (-766.175) (-766.975) [-764.919] * (-769.999) [-765.959] (-767.466) (-767.407) -- 0:00:07
879000 -- (-769.834) [-768.917] (-768.704) (-769.036) * [-765.748] (-765.417) (-767.770) (-766.443) -- 0:00:07
879500 -- [-766.679] (-769.128) (-765.148) (-766.114) * (-766.186) [-766.276] (-766.134) (-768.791) -- 0:00:07
880000 -- (-769.142) [-765.502] (-764.612) (-767.297) * (-765.974) [-770.639] (-767.720) (-768.965) -- 0:00:07
Average standard deviation of split frequencies: 0.007244
880500 -- (-766.728) (-765.517) [-770.212] (-764.559) * (-765.767) (-767.074) (-769.756) [-767.052] -- 0:00:07
881000 -- (-765.425) (-765.384) (-768.214) [-767.859] * (-765.405) [-770.018] (-767.598) (-768.622) -- 0:00:07
881500 -- (-765.588) [-766.516] (-770.970) (-766.097) * (-769.682) [-772.264] (-768.342) (-766.298) -- 0:00:07
882000 -- (-765.668) [-767.075] (-768.241) (-767.240) * [-766.273] (-770.962) (-766.110) (-765.404) -- 0:00:07
882500 -- (-765.123) (-768.547) [-765.841] (-772.981) * (-766.803) (-767.784) [-766.674] (-765.885) -- 0:00:07
883000 -- (-765.216) [-767.406] (-766.123) (-768.711) * (-765.880) (-766.732) (-767.136) [-766.046] -- 0:00:07
883500 -- (-769.848) [-765.886] (-765.214) (-765.988) * (-768.490) [-766.777] (-767.870) (-769.258) -- 0:00:07
884000 -- (-767.463) (-768.824) [-768.029] (-766.404) * [-765.094] (-765.673) (-765.090) (-765.398) -- 0:00:07
884500 -- (-769.903) [-767.025] (-765.887) (-767.148) * (-767.706) [-766.550] (-768.013) (-767.136) -- 0:00:07
885000 -- (-768.248) (-767.027) (-766.543) [-765.728] * (-770.102) (-771.895) [-768.962] (-769.168) -- 0:00:07
Average standard deviation of split frequencies: 0.007413
885500 -- [-767.475] (-771.023) (-769.077) (-766.905) * [-765.353] (-766.929) (-765.857) (-766.222) -- 0:00:06
886000 -- [-765.182] (-769.119) (-766.123) (-764.801) * (-765.909) [-767.894] (-771.237) (-765.043) -- 0:00:06
886500 -- (-765.852) (-767.337) (-767.854) [-765.027] * (-766.382) (-766.447) [-768.556] (-764.918) -- 0:00:06
887000 -- (-770.879) [-765.386] (-769.861) (-767.572) * [-766.156] (-768.952) (-771.440) (-765.636) -- 0:00:06
887500 -- (-765.898) (-766.237) [-765.683] (-768.162) * [-767.900] (-766.617) (-772.752) (-769.614) -- 0:00:06
888000 -- (-767.248) (-768.330) (-765.673) [-768.027] * (-768.434) [-767.364] (-769.547) (-768.165) -- 0:00:06
888500 -- [-766.912] (-766.797) (-764.773) (-769.608) * (-766.275) (-768.837) (-766.024) [-767.765] -- 0:00:06
889000 -- [-765.514] (-769.064) (-766.150) (-768.610) * (-767.402) (-769.918) [-766.125] (-771.104) -- 0:00:06
889500 -- [-765.286] (-766.209) (-768.085) (-768.969) * (-766.260) (-768.030) [-767.330] (-767.639) -- 0:00:06
890000 -- [-765.817] (-768.402) (-769.304) (-770.831) * [-766.650] (-771.098) (-766.673) (-767.719) -- 0:00:06
Average standard deviation of split frequencies: 0.007128
890500 -- (-766.660) [-767.479] (-767.969) (-770.179) * (-765.938) (-772.317) (-766.262) [-767.892] -- 0:00:06
891000 -- [-765.862] (-770.074) (-767.485) (-772.771) * (-767.318) (-766.843) (-764.992) [-765.328] -- 0:00:06
891500 -- (-768.227) (-768.580) (-765.809) [-767.130] * (-770.680) (-766.207) (-764.915) [-765.535] -- 0:00:06
892000 -- (-767.718) (-764.789) (-766.606) [-768.835] * (-766.033) (-772.555) [-766.819] (-767.061) -- 0:00:06
892500 -- (-766.301) (-764.911) [-766.463] (-767.728) * (-766.890) (-765.509) (-767.117) [-765.421] -- 0:00:06
893000 -- (-771.358) [-766.593] (-766.219) (-765.632) * [-766.756] (-765.814) (-766.256) (-767.288) -- 0:00:06
893500 -- (-767.856) [-767.596] (-765.915) (-764.788) * (-767.390) [-768.543] (-765.758) (-766.758) -- 0:00:06
894000 -- [-765.731] (-767.498) (-767.742) (-765.619) * (-768.267) (-766.029) (-766.416) [-767.174] -- 0:00:06
894500 -- (-765.204) (-766.179) (-768.723) [-766.110] * (-767.767) (-768.243) (-767.526) [-768.684] -- 0:00:06
895000 -- (-764.973) (-766.942) [-767.278] (-767.922) * (-767.570) (-768.495) (-766.021) [-767.260] -- 0:00:06
Average standard deviation of split frequencies: 0.007015
895500 -- [-768.570] (-766.560) (-768.112) (-767.696) * (-766.582) (-765.739) [-766.216] (-767.402) -- 0:00:06
896000 -- (-767.563) (-766.825) (-764.950) [-767.535] * (-766.492) (-767.901) (-766.665) [-766.772] -- 0:00:06
896500 -- (-765.776) (-768.564) (-766.710) [-772.665] * (-769.585) (-768.386) (-767.707) [-764.636] -- 0:00:06
897000 -- (-767.046) [-770.742] (-765.976) (-767.429) * (-767.690) [-766.699] (-768.647) (-770.741) -- 0:00:06
897500 -- [-766.887] (-766.633) (-765.173) (-767.948) * (-767.542) [-767.091] (-768.030) (-769.427) -- 0:00:06
898000 -- (-766.350) (-764.608) [-768.570] (-766.314) * [-766.287] (-766.239) (-766.295) (-767.011) -- 0:00:06
898500 -- [-766.574] (-766.542) (-765.362) (-766.136) * (-765.539) [-765.858] (-765.842) (-769.274) -- 0:00:06
899000 -- (-767.630) (-765.810) [-766.942] (-766.798) * (-766.315) (-765.312) [-767.078] (-764.779) -- 0:00:06
899500 -- (-766.013) (-765.833) [-765.537] (-764.657) * (-765.392) (-765.743) (-767.227) [-766.266] -- 0:00:06
900000 -- (-766.647) (-771.614) (-765.887) [-767.801] * (-764.750) (-766.662) [-765.042] (-768.601) -- 0:00:06
Average standard deviation of split frequencies: 0.006734
900500 -- [-768.607] (-766.887) (-773.505) (-769.291) * (-764.683) (-765.984) [-767.948] (-765.411) -- 0:00:06
901000 -- (-766.245) (-766.993) (-771.703) [-767.799] * (-765.450) [-766.487] (-765.530) (-766.664) -- 0:00:06
901500 -- [-771.635] (-768.506) (-765.599) (-767.453) * [-765.863] (-767.359) (-767.521) (-765.207) -- 0:00:06
902000 -- [-766.845] (-766.056) (-767.550) (-765.517) * (-765.229) (-767.150) [-766.877] (-767.898) -- 0:00:05
902500 -- [-764.651] (-768.971) (-765.386) (-765.515) * (-768.700) (-767.228) (-767.025) [-766.485] -- 0:00:05
903000 -- [-765.591] (-768.826) (-766.314) (-769.183) * (-773.771) [-768.049] (-766.942) (-767.994) -- 0:00:05
903500 -- (-765.507) (-767.570) (-768.424) [-765.188] * (-771.725) (-766.973) (-770.515) [-765.612] -- 0:00:05
904000 -- [-765.534] (-765.932) (-768.967) (-766.015) * [-765.196] (-765.442) (-766.538) (-765.233) -- 0:00:05
904500 -- (-764.857) [-766.102] (-766.697) (-767.064) * [-766.149] (-767.907) (-766.525) (-765.570) -- 0:00:05
905000 -- [-766.428] (-767.004) (-768.063) (-768.380) * (-766.465) (-766.754) [-768.363] (-768.703) -- 0:00:05
Average standard deviation of split frequencies: 0.006833
905500 -- (-767.488) (-765.995) (-766.609) [-768.150] * (-769.386) (-767.929) [-766.216] (-766.347) -- 0:00:05
906000 -- (-765.157) [-765.869] (-768.026) (-765.787) * (-768.012) (-767.212) [-766.583] (-767.290) -- 0:00:05
906500 -- (-764.801) [-766.518] (-768.130) (-766.747) * (-767.155) [-767.238] (-768.510) (-769.582) -- 0:00:05
907000 -- (-766.235) (-765.607) [-765.231] (-764.977) * (-766.067) [-767.937] (-765.541) (-766.120) -- 0:00:05
907500 -- [-764.995] (-770.545) (-765.498) (-769.062) * (-765.964) (-768.447) [-767.137] (-771.849) -- 0:00:05
908000 -- (-766.296) [-770.314] (-765.721) (-766.146) * (-765.695) (-767.006) (-765.846) [-766.823] -- 0:00:05
908500 -- (-767.064) (-770.218) (-765.546) [-765.976] * (-767.720) (-765.884) (-766.964) [-766.423] -- 0:00:05
909000 -- (-767.363) (-768.411) (-766.177) [-765.204] * [-767.908] (-770.898) (-766.899) (-765.715) -- 0:00:05
909500 -- [-767.531] (-764.571) (-766.396) (-765.054) * (-768.670) (-766.584) (-768.987) [-768.347] -- 0:00:05
910000 -- [-767.136] (-765.810) (-769.925) (-765.172) * (-767.346) (-766.791) (-765.655) [-768.747] -- 0:00:05
Average standard deviation of split frequencies: 0.006798
910500 -- (-768.550) (-765.372) [-768.004] (-765.731) * (-768.058) (-768.371) (-767.373) [-765.893] -- 0:00:05
911000 -- [-766.586] (-765.460) (-766.865) (-767.961) * (-767.558) (-765.469) (-767.749) [-765.861] -- 0:00:05
911500 -- [-765.683] (-768.652) (-767.457) (-765.714) * [-766.784] (-765.197) (-768.761) (-765.689) -- 0:00:05
912000 -- (-764.570) [-765.929] (-765.966) (-769.618) * (-768.480) (-766.342) (-769.147) [-765.782] -- 0:00:05
912500 -- (-766.676) (-768.333) [-765.369] (-766.218) * (-765.689) (-766.792) [-766.942] (-766.892) -- 0:00:05
913000 -- (-765.711) (-769.456) [-768.369] (-766.019) * (-765.213) (-767.277) (-766.792) [-766.337] -- 0:00:05
913500 -- [-765.880] (-766.137) (-766.392) (-765.353) * (-765.623) (-767.837) [-770.991] (-765.375) -- 0:00:05
914000 -- (-769.270) [-765.133] (-766.977) (-767.174) * (-767.815) (-766.424) (-768.427) [-764.638] -- 0:00:05
914500 -- (-765.586) (-767.310) (-770.871) [-766.685] * (-766.481) [-765.164] (-768.139) (-768.219) -- 0:00:05
915000 -- [-767.550] (-768.431) (-770.468) (-767.811) * (-765.870) (-765.954) (-766.772) [-768.066] -- 0:00:05
Average standard deviation of split frequencies: 0.006827
915500 -- (-765.101) (-766.545) [-767.565] (-766.946) * (-766.041) [-766.189] (-766.501) (-766.115) -- 0:00:05
916000 -- (-766.437) (-765.341) (-766.237) [-764.714] * (-767.290) (-767.120) (-770.051) [-765.585] -- 0:00:05
916500 -- (-766.561) (-766.012) (-769.650) [-765.278] * [-767.158] (-766.065) (-771.648) (-765.218) -- 0:00:05
917000 -- [-767.678] (-768.630) (-765.940) (-765.404) * (-768.210) (-767.313) [-768.686] (-772.227) -- 0:00:05
917500 -- (-766.872) (-766.652) (-765.206) [-768.129] * [-768.128] (-767.944) (-765.801) (-766.793) -- 0:00:05
918000 -- (-768.452) (-764.839) [-764.899] (-765.607) * (-766.113) (-773.832) [-767.220] (-766.067) -- 0:00:05
918500 -- (-764.803) [-766.033] (-767.593) (-768.307) * (-767.043) (-766.237) [-765.894] (-767.132) -- 0:00:04
919000 -- (-765.589) [-765.175] (-768.736) (-765.159) * (-766.248) (-765.399) [-766.280] (-767.206) -- 0:00:04
919500 -- [-764.928] (-766.307) (-770.423) (-765.878) * (-766.691) [-766.953] (-765.985) (-770.302) -- 0:00:04
920000 -- (-765.986) (-765.577) [-767.961] (-767.908) * (-766.723) (-765.414) [-766.561] (-765.365) -- 0:00:04
Average standard deviation of split frequencies: 0.006656
920500 -- (-767.202) (-768.776) (-766.960) [-768.440] * (-768.789) (-766.706) (-765.035) [-765.132] -- 0:00:04
921000 -- [-766.807] (-765.919) (-764.989) (-772.123) * (-766.826) (-767.256) (-768.430) [-768.793] -- 0:00:04
921500 -- [-765.280] (-764.942) (-769.104) (-769.711) * (-767.486) (-766.649) [-767.708] (-767.341) -- 0:00:04
922000 -- [-767.379] (-765.632) (-771.687) (-764.859) * [-768.830] (-766.969) (-767.496) (-768.518) -- 0:00:04
922500 -- (-769.174) [-768.643] (-764.862) (-768.862) * [-767.713] (-768.068) (-766.122) (-767.448) -- 0:00:04
923000 -- (-766.318) [-768.185] (-767.944) (-767.043) * (-769.261) (-767.272) [-765.767] (-767.957) -- 0:00:04
923500 -- (-767.322) (-767.054) [-766.621] (-765.584) * (-768.215) (-767.961) [-767.338] (-770.118) -- 0:00:04
924000 -- (-766.179) (-766.464) [-766.076] (-764.847) * (-765.445) (-766.396) (-765.253) [-768.913] -- 0:00:04
924500 -- [-765.553] (-765.115) (-766.157) (-766.228) * [-765.540] (-765.541) (-765.898) (-765.989) -- 0:00:04
925000 -- [-768.505] (-767.089) (-768.168) (-766.216) * (-766.680) (-767.253) [-765.903] (-766.561) -- 0:00:04
Average standard deviation of split frequencies: 0.006754
925500 -- (-765.905) (-766.174) (-769.679) [-766.829] * (-769.622) [-765.985] (-765.770) (-772.105) -- 0:00:04
926000 -- (-765.898) [-766.042] (-767.914) (-765.135) * [-768.420] (-766.175) (-765.924) (-767.398) -- 0:00:04
926500 -- (-765.286) [-765.096] (-770.571) (-765.391) * [-765.152] (-767.988) (-765.240) (-769.910) -- 0:00:04
927000 -- (-770.938) (-765.188) (-769.298) [-767.598] * (-765.150) (-766.169) [-765.335] (-768.638) -- 0:00:04
927500 -- (-768.306) (-767.834) (-765.110) [-765.139] * (-766.626) (-769.419) [-768.102] (-768.638) -- 0:00:04
928000 -- (-765.854) (-764.809) (-765.918) [-765.136] * (-767.052) (-766.253) (-770.972) [-765.354] -- 0:00:04
928500 -- (-766.358) (-765.825) (-767.677) [-767.194] * (-764.969) (-765.824) (-769.081) [-767.246] -- 0:00:04
929000 -- (-767.440) [-768.594] (-769.238) (-767.782) * (-767.555) (-769.014) [-768.338] (-767.944) -- 0:00:04
929500 -- [-767.646] (-772.318) (-766.464) (-768.007) * [-766.446] (-767.351) (-772.317) (-766.904) -- 0:00:04
930000 -- (-771.831) [-770.135] (-765.402) (-769.381) * (-765.068) (-767.313) (-768.982) [-766.296] -- 0:00:04
Average standard deviation of split frequencies: 0.006990
930500 -- (-769.553) (-770.480) (-766.133) [-769.202] * [-766.652] (-768.169) (-766.260) (-766.941) -- 0:00:04
931000 -- (-772.463) (-766.354) [-766.110] (-767.122) * (-767.173) (-768.718) (-767.931) [-766.510] -- 0:00:04
931500 -- (-766.508) (-767.590) (-765.776) [-767.041] * [-767.249] (-767.682) (-768.940) (-768.048) -- 0:00:04
932000 -- [-767.295] (-767.488) (-768.537) (-769.623) * [-766.234] (-770.959) (-768.363) (-767.784) -- 0:00:04
932500 -- [-767.656] (-765.650) (-766.890) (-772.637) * (-768.964) [-765.544] (-769.650) (-765.817) -- 0:00:04
933000 -- [-767.162] (-765.289) (-765.516) (-766.207) * (-765.462) (-766.401) (-768.900) [-765.660] -- 0:00:04
933500 -- (-766.733) [-765.134] (-765.914) (-766.442) * (-768.315) (-765.224) (-765.578) [-767.716] -- 0:00:04
934000 -- (-765.289) (-766.509) [-770.316] (-766.090) * (-767.857) (-765.454) [-765.577] (-766.181) -- 0:00:04
934500 -- (-770.445) (-768.140) [-766.182] (-769.897) * (-769.576) (-768.344) [-768.458] (-771.404) -- 0:00:03
935000 -- (-768.420) (-770.908) [-766.941] (-766.202) * [-765.511] (-765.073) (-770.809) (-772.260) -- 0:00:03
Average standard deviation of split frequencies: 0.007219
935500 -- [-766.059] (-767.084) (-766.421) (-769.690) * (-767.746) (-765.850) [-764.917] (-772.323) -- 0:00:03
936000 -- [-771.188] (-765.626) (-766.815) (-766.143) * (-768.796) (-767.334) [-768.485] (-770.623) -- 0:00:03
936500 -- (-766.692) (-765.040) (-768.572) [-769.646] * (-769.057) [-765.241] (-767.885) (-766.807) -- 0:00:03
937000 -- [-766.287] (-766.121) (-767.245) (-765.022) * (-767.226) [-764.430] (-766.848) (-767.112) -- 0:00:03
937500 -- (-767.857) [-764.975] (-768.668) (-767.921) * (-768.347) (-767.961) [-765.851] (-765.464) -- 0:00:03
938000 -- (-767.262) [-765.860] (-767.855) (-766.634) * (-770.110) (-766.665) (-769.685) [-765.680] -- 0:00:03
938500 -- (-764.953) [-766.190] (-765.094) (-767.613) * (-766.811) (-765.635) [-766.867] (-767.497) -- 0:00:03
939000 -- [-767.230] (-766.973) (-764.996) (-767.427) * (-766.807) [-765.034] (-765.451) (-766.794) -- 0:00:03
939500 -- (-772.775) (-769.999) [-764.766] (-766.639) * (-767.002) (-767.334) (-765.311) [-770.062] -- 0:00:03
940000 -- (-766.095) [-772.418] (-766.449) (-764.413) * (-770.451) (-765.496) [-766.639] (-767.383) -- 0:00:03
Average standard deviation of split frequencies: 0.007150
940500 -- (-767.106) (-771.637) (-766.755) [-764.489] * (-767.545) (-766.838) [-767.030] (-766.857) -- 0:00:03
941000 -- [-768.766] (-771.284) (-767.050) (-769.107) * (-767.347) (-768.727) (-765.674) [-765.684] -- 0:00:03
941500 -- [-767.540] (-765.092) (-768.385) (-774.398) * (-766.355) [-765.295] (-767.976) (-768.960) -- 0:00:03
942000 -- (-768.480) (-765.914) (-769.081) [-767.467] * (-765.937) (-766.209) (-767.755) [-765.872] -- 0:00:03
942500 -- (-766.298) [-768.457] (-768.044) (-767.890) * (-772.997) (-768.323) (-767.387) [-766.535] -- 0:00:03
943000 -- (-768.621) (-765.476) (-766.471) [-769.146] * (-765.823) [-765.282] (-765.988) (-765.504) -- 0:00:03
943500 -- [-766.219] (-766.774) (-767.225) (-768.863) * (-765.870) (-765.267) (-767.251) [-766.464] -- 0:00:03
944000 -- [-765.939] (-769.322) (-769.441) (-767.418) * (-766.595) [-764.802] (-767.633) (-765.647) -- 0:00:03
944500 -- (-766.757) (-767.536) (-768.551) [-766.569] * (-766.333) (-768.043) [-764.907] (-765.729) -- 0:00:03
945000 -- (-769.812) (-769.691) (-769.739) [-770.148] * (-764.875) (-771.953) (-764.739) [-765.197] -- 0:00:03
Average standard deviation of split frequencies: 0.007506
945500 -- [-771.197] (-771.730) (-768.916) (-766.946) * (-769.474) (-770.488) [-766.459] (-765.475) -- 0:00:03
946000 -- [-774.125] (-769.266) (-764.960) (-765.729) * (-766.661) (-767.049) (-767.673) [-767.173] -- 0:00:03
946500 -- (-770.145) (-765.230) (-768.083) [-766.663] * (-767.201) (-766.463) [-767.823] (-768.927) -- 0:00:03
947000 -- (-765.044) [-766.833] (-765.409) (-766.058) * [-766.379] (-765.176) (-766.200) (-765.887) -- 0:00:03
947500 -- [-767.164] (-765.591) (-764.763) (-768.677) * [-766.047] (-764.832) (-765.995) (-767.939) -- 0:00:03
948000 -- (-766.536) [-765.668] (-765.310) (-769.100) * (-766.915) (-767.823) [-765.384] (-765.912) -- 0:00:03
948500 -- (-764.977) (-765.520) (-766.003) [-765.482] * (-767.570) [-765.195] (-765.144) (-766.617) -- 0:00:03
949000 -- [-764.801] (-769.372) (-767.453) (-765.624) * (-769.964) [-765.908] (-766.343) (-767.729) -- 0:00:03
949500 -- (-766.211) (-765.056) [-766.482] (-768.246) * [-767.569] (-766.934) (-766.843) (-769.413) -- 0:00:03
950000 -- (-768.050) (-768.972) [-766.394] (-765.079) * (-766.627) (-765.261) (-768.308) [-765.687] -- 0:00:03
Average standard deviation of split frequencies: 0.007074
950500 -- (-765.210) [-768.031] (-765.027) (-769.579) * (-766.527) [-765.673] (-766.457) (-768.305) -- 0:00:03
951000 -- [-768.546] (-765.610) (-766.712) (-767.415) * (-766.284) [-765.923] (-767.198) (-767.854) -- 0:00:02
951500 -- (-770.270) [-765.485] (-767.908) (-767.108) * (-770.422) (-767.262) [-767.851] (-767.976) -- 0:00:02
952000 -- [-768.412] (-766.378) (-765.255) (-767.149) * (-766.194) [-772.908] (-768.842) (-766.046) -- 0:00:02
952500 -- (-765.402) [-766.369] (-768.548) (-765.214) * (-765.680) (-766.783) (-771.263) [-765.285] -- 0:00:02
953000 -- (-766.993) [-766.146] (-768.077) (-768.757) * (-772.291) [-767.722] (-765.542) (-765.313) -- 0:00:02
953500 -- [-765.195] (-766.938) (-769.289) (-770.959) * (-765.999) [-765.218] (-767.269) (-765.311) -- 0:00:02
954000 -- (-765.542) (-770.036) [-765.655] (-765.023) * (-766.762) (-764.690) (-765.627) [-765.517] -- 0:00:02
954500 -- (-764.754) (-767.696) [-766.654] (-765.543) * [-765.800] (-766.703) (-765.844) (-765.424) -- 0:00:02
955000 -- (-770.569) (-772.656) [-766.766] (-765.263) * [-765.351] (-764.989) (-765.666) (-765.424) -- 0:00:02
Average standard deviation of split frequencies: 0.006903
955500 -- (-770.921) (-769.754) (-765.850) [-765.690] * (-765.854) (-765.650) [-767.520] (-767.492) -- 0:00:02
956000 -- (-769.379) (-771.731) (-767.460) [-768.962] * (-769.869) [-767.328] (-766.897) (-767.965) -- 0:00:02
956500 -- (-768.180) [-766.669] (-765.905) (-769.869) * (-770.246) [-767.403] (-766.912) (-764.893) -- 0:00:02
957000 -- [-768.256] (-767.560) (-767.619) (-768.524) * (-766.873) (-767.837) [-765.056] (-764.870) -- 0:00:02
957500 -- (-768.841) (-773.089) (-766.463) [-768.036] * [-767.995] (-765.750) (-765.175) (-766.208) -- 0:00:02
958000 -- [-768.219] (-767.057) (-768.946) (-766.946) * (-766.167) (-767.002) [-765.390] (-766.341) -- 0:00:02
958500 -- [-766.553] (-765.199) (-769.157) (-769.783) * (-768.325) [-765.048] (-765.864) (-766.233) -- 0:00:02
959000 -- (-765.365) [-767.043] (-767.901) (-767.010) * (-767.471) [-765.342] (-764.475) (-764.812) -- 0:00:02
959500 -- [-764.879] (-767.514) (-767.130) (-766.516) * (-767.271) [-769.189] (-770.075) (-767.112) -- 0:00:02
960000 -- (-766.384) (-767.670) [-767.170] (-769.297) * (-766.134) [-767.430] (-766.191) (-766.057) -- 0:00:02
Average standard deviation of split frequencies: 0.006903
960500 -- (-767.184) (-767.375) [-765.932] (-767.396) * (-765.700) (-768.136) [-765.754] (-767.003) -- 0:00:02
961000 -- (-771.508) (-767.829) (-769.770) [-767.660] * (-767.221) [-767.072] (-767.851) (-766.527) -- 0:00:02
961500 -- (-767.142) (-768.142) [-768.364] (-766.466) * (-766.078) [-767.564] (-766.704) (-766.261) -- 0:00:02
962000 -- [-768.081] (-766.077) (-765.556) (-767.682) * [-766.117] (-768.869) (-772.118) (-768.706) -- 0:00:02
962500 -- (-764.838) [-765.876] (-768.199) (-766.266) * [-768.910] (-766.878) (-767.983) (-774.433) -- 0:00:02
963000 -- (-765.020) (-765.471) [-765.951] (-766.315) * (-768.416) [-765.481] (-767.928) (-767.176) -- 0:00:02
963500 -- (-766.356) [-765.115] (-767.091) (-765.964) * [-768.056] (-767.192) (-765.886) (-764.826) -- 0:00:02
964000 -- (-766.606) [-766.236] (-765.882) (-765.444) * (-765.142) (-767.091) [-766.568] (-772.912) -- 0:00:02
964500 -- (-768.289) [-765.509] (-764.845) (-767.652) * (-767.045) (-766.527) [-764.917] (-766.382) -- 0:00:02
965000 -- [-767.363] (-765.780) (-767.511) (-766.682) * (-766.037) (-764.943) [-766.036] (-766.255) -- 0:00:02
Average standard deviation of split frequencies: 0.006669
965500 -- (-770.105) (-771.703) (-766.512) [-767.744] * (-767.038) (-765.973) [-765.516] (-764.873) -- 0:00:02
966000 -- (-767.781) (-773.884) [-774.647] (-766.326) * (-766.432) (-766.791) (-766.296) [-764.683] -- 0:00:02
966500 -- (-768.881) (-767.636) [-768.999] (-766.464) * (-767.055) [-764.688] (-766.916) (-767.703) -- 0:00:02
967000 -- (-769.439) [-766.349] (-771.030) (-766.810) * [-764.737] (-765.033) (-766.373) (-764.756) -- 0:00:02
967500 -- (-771.057) (-765.225) [-770.506] (-768.642) * (-765.039) (-766.119) [-766.501] (-766.765) -- 0:00:01
968000 -- [-767.689] (-766.353) (-765.668) (-769.082) * [-766.757] (-764.999) (-768.710) (-764.853) -- 0:00:01
968500 -- (-765.647) (-766.606) [-765.928] (-768.812) * (-765.430) (-765.337) [-768.916] (-767.337) -- 0:00:01
969000 -- [-768.187] (-767.936) (-767.171) (-773.461) * [-765.093] (-765.274) (-770.914) (-765.459) -- 0:00:01
969500 -- [-765.487] (-765.199) (-766.888) (-770.338) * (-766.975) (-769.138) (-767.562) [-764.958] -- 0:00:01
970000 -- (-769.024) (-771.193) [-765.266] (-766.033) * [-767.564] (-771.268) (-766.906) (-766.512) -- 0:00:01
Average standard deviation of split frequencies: 0.007090
970500 -- (-766.924) (-766.838) (-765.421) [-765.893] * (-770.632) (-769.663) (-770.470) [-766.949] -- 0:00:01
971000 -- (-766.209) [-766.551] (-765.842) (-769.612) * (-769.243) (-774.543) [-767.101] (-768.024) -- 0:00:01
971500 -- (-766.958) [-768.619] (-766.671) (-766.301) * (-769.112) (-765.641) [-766.228] (-766.889) -- 0:00:01
972000 -- (-770.792) (-767.013) [-765.168] (-768.240) * (-767.116) [-765.049] (-769.583) (-766.019) -- 0:00:01
972500 -- [-770.702] (-770.680) (-766.442) (-770.768) * [-764.529] (-771.915) (-768.415) (-769.315) -- 0:00:01
973000 -- (-767.968) [-768.031] (-766.666) (-765.299) * (-768.527) (-767.345) (-765.547) [-767.016] -- 0:00:01
973500 -- (-767.115) (-766.606) [-765.112] (-768.585) * (-766.104) (-766.820) [-768.839] (-765.468) -- 0:00:01
974000 -- (-768.303) (-767.123) [-766.348] (-771.037) * (-769.275) (-765.827) (-768.153) [-767.437] -- 0:00:01
974500 -- [-765.476] (-764.986) (-767.113) (-769.268) * [-766.000] (-768.683) (-768.363) (-765.999) -- 0:00:01
975000 -- [-768.637] (-766.119) (-765.390) (-766.068) * (-770.715) (-766.527) [-765.660] (-765.792) -- 0:00:01
Average standard deviation of split frequencies: 0.007245
975500 -- (-767.517) (-768.097) [-766.612] (-770.198) * (-767.624) (-769.236) [-766.069] (-766.708) -- 0:00:01
976000 -- (-766.140) [-766.268] (-765.206) (-766.697) * (-767.812) (-772.223) [-766.642] (-767.437) -- 0:00:01
976500 -- [-768.212] (-766.124) (-769.612) (-767.010) * (-768.864) [-766.297] (-767.340) (-767.285) -- 0:00:01
977000 -- (-767.455) [-768.688] (-769.626) (-765.201) * (-767.913) [-768.704] (-765.315) (-768.057) -- 0:00:01
977500 -- (-767.520) [-770.407] (-767.673) (-767.431) * (-766.901) (-767.164) (-766.416) [-765.285] -- 0:00:01
978000 -- (-766.696) (-768.440) (-766.997) [-768.665] * (-764.763) (-765.206) (-766.845) [-766.635] -- 0:00:01
978500 -- (-765.527) [-769.987] (-765.314) (-768.859) * (-765.897) (-764.940) (-766.561) [-769.382] -- 0:00:01
979000 -- (-767.253) [-766.466] (-769.034) (-766.217) * (-768.216) (-767.454) [-766.675] (-766.009) -- 0:00:01
979500 -- (-768.252) (-766.120) (-773.279) [-768.382] * (-766.997) (-765.569) [-766.115] (-767.409) -- 0:00:01
980000 -- (-766.034) (-769.585) (-769.950) [-771.258] * (-764.905) [-764.878] (-765.827) (-766.257) -- 0:00:01
Average standard deviation of split frequencies: 0.007435
980500 -- (-766.228) [-768.425] (-766.851) (-769.074) * (-769.932) (-768.172) (-766.642) [-766.231] -- 0:00:01
981000 -- [-766.358] (-765.185) (-767.687) (-766.312) * (-766.775) (-768.914) [-764.966] (-765.886) -- 0:00:01
981500 -- (-765.916) (-765.365) [-773.540] (-769.862) * (-767.070) (-766.896) [-764.853] (-768.510) -- 0:00:01
982000 -- (-765.122) (-766.592) (-772.147) [-769.520] * [-767.750] (-766.933) (-766.045) (-766.742) -- 0:00:01
982500 -- (-765.048) [-767.769] (-772.700) (-769.598) * [-765.175] (-765.312) (-766.977) (-766.535) -- 0:00:01
983000 -- (-767.014) (-765.301) (-766.766) [-770.183] * (-766.051) (-765.263) [-765.556] (-768.665) -- 0:00:01
983500 -- (-766.008) [-766.246] (-769.618) (-767.835) * (-766.040) (-767.684) (-767.446) [-770.720] -- 0:00:01
984000 -- (-766.773) (-766.965) (-769.147) [-768.033] * (-767.239) (-767.987) (-764.770) [-767.599] -- 0:00:00
984500 -- (-767.990) [-765.230] (-768.218) (-765.410) * [-764.758] (-766.312) (-767.718) (-765.710) -- 0:00:00
985000 -- [-766.601] (-767.616) (-765.080) (-767.128) * (-765.072) (-766.443) [-768.282] (-765.840) -- 0:00:00
Average standard deviation of split frequencies: 0.007426
985500 -- (-767.494) (-770.332) [-767.095] (-769.835) * (-765.702) (-765.071) [-765.124] (-768.114) -- 0:00:00
986000 -- (-769.103) (-767.639) (-771.824) [-767.043] * (-766.291) [-765.052] (-766.020) (-773.964) -- 0:00:00
986500 -- (-772.282) (-767.218) (-765.670) [-769.646] * (-766.277) [-765.329] (-766.972) (-766.114) -- 0:00:00
987000 -- [-766.141] (-766.659) (-768.850) (-766.456) * [-765.723] (-767.711) (-766.103) (-768.149) -- 0:00:00
987500 -- [-766.776] (-765.737) (-764.729) (-766.473) * (-768.056) (-770.153) (-765.112) [-768.720] -- 0:00:00
988000 -- (-766.773) (-766.023) [-765.260] (-765.599) * [-767.236] (-767.850) (-765.985) (-772.540) -- 0:00:00
988500 -- (-768.519) (-766.434) [-765.276] (-765.760) * (-766.329) (-766.247) (-767.720) [-766.457] -- 0:00:00
989000 -- (-767.026) (-766.765) [-766.091] (-769.352) * (-765.256) [-767.113] (-768.327) (-766.949) -- 0:00:00
989500 -- [-770.189] (-767.915) (-766.650) (-771.634) * (-766.240) (-768.346) (-766.907) [-767.296] -- 0:00:00
990000 -- (-768.441) (-771.753) [-767.579] (-769.130) * [-765.636] (-765.690) (-767.279) (-766.839) -- 0:00:00
Average standard deviation of split frequencies: 0.007554
990500 -- (-766.131) (-769.604) [-766.110] (-766.904) * (-766.026) (-765.183) (-767.643) [-766.035] -- 0:00:00
991000 -- [-767.450] (-770.342) (-767.207) (-767.494) * (-766.058) (-767.590) (-767.536) [-765.961] -- 0:00:00
991500 -- [-766.225] (-767.978) (-768.024) (-770.761) * [-766.313] (-766.978) (-765.990) (-765.926) -- 0:00:00
992000 -- [-767.405] (-767.901) (-767.141) (-766.619) * (-765.592) (-767.633) [-765.338] (-765.933) -- 0:00:00
992500 -- (-767.510) [-766.978] (-765.282) (-766.846) * [-767.088] (-770.480) (-765.271) (-768.085) -- 0:00:00
993000 -- (-767.567) [-768.158] (-766.877) (-772.287) * (-766.022) [-769.807] (-767.827) (-766.936) -- 0:00:00
993500 -- (-768.880) (-766.436) (-765.525) [-766.010] * (-766.612) [-766.507] (-768.364) (-767.387) -- 0:00:00
994000 -- [-766.362] (-766.349) (-764.961) (-765.518) * (-768.577) (-767.175) (-767.647) [-768.407] -- 0:00:00
994500 -- [-765.843] (-766.333) (-768.970) (-764.867) * (-766.693) (-766.217) [-769.961] (-771.685) -- 0:00:00
995000 -- (-765.503) (-767.862) [-766.310] (-765.937) * (-765.398) (-765.543) [-771.037] (-770.265) -- 0:00:00
Average standard deviation of split frequencies: 0.007691
995500 -- (-765.505) (-767.033) (-767.746) [-767.119] * (-765.717) (-766.203) (-765.193) [-765.015] -- 0:00:00
996000 -- [-766.404] (-765.776) (-768.832) (-766.597) * (-765.736) [-766.350] (-766.681) (-770.224) -- 0:00:00
996500 -- (-766.448) [-765.177] (-765.510) (-770.246) * (-771.200) [-766.297] (-767.426) (-766.758) -- 0:00:00
997000 -- (-766.027) [-766.044] (-764.928) (-769.127) * (-768.752) (-771.257) (-765.564) [-766.308] -- 0:00:00
997500 -- [-771.335] (-765.992) (-769.993) (-767.000) * [-766.887] (-767.265) (-768.761) (-767.666) -- 0:00:00
998000 -- [-765.770] (-767.340) (-766.487) (-766.261) * (-765.819) (-765.727) (-770.561) [-769.259] -- 0:00:00
998500 -- (-767.869) (-772.080) [-764.663] (-766.027) * (-774.748) (-766.651) [-770.376] (-768.247) -- 0:00:00
999000 -- (-766.401) (-769.728) (-766.429) [-766.062] * [-767.598] (-768.077) (-766.573) (-769.233) -- 0:00:00
999500 -- (-766.681) (-768.111) [-765.857] (-765.550) * (-767.671) (-766.548) [-768.342] (-766.663) -- 0:00:00
1000000 -- [-766.356] (-765.357) (-766.024) (-766.824) * [-765.697] (-765.199) (-767.967) (-767.212) -- 0:00:00
Average standard deviation of split frequencies: 0.007950
Analysis completed in 1 mins 1 seconds
Analysis used 59.10 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -764.39
Likelihood of best state for "cold" chain of run 2 was -764.39
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 64 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
30.6 % ( 28 %) Dirichlet(Pi{all})
31.3 % ( 35 %) Slider(Pi{all})
78.7 % ( 53 %) Multiplier(Alpha{1,2})
77.4 % ( 55 %) Multiplier(Alpha{3})
23.2 % ( 17 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 80 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.4 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.5 % ( 67 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
30.5 % ( 27 %) Dirichlet(Pi{all})
32.1 % ( 26 %) Slider(Pi{all})
79.2 % ( 52 %) Multiplier(Alpha{1,2})
77.6 % ( 44 %) Multiplier(Alpha{3})
22.9 % ( 26 %) Slider(Pinvar{all})
98.7 % ( 97 %) ExtSPR(Tau{all},V{all})
70.2 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 28 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.9 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166225 0.82 0.67
3 | 166441 167211 0.84
4 | 166132 167013 166978
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166455 0.82 0.67
3 | 167135 166869 0.84
4 | 166232 166894 166415
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -765.93
| 1 2 |
| 2 |
| 2 1 1 2 1 22 |
| 2 12 2 2 2 |
| 1 1 1 2 2 2 222 * 2 2 1 2 1|
| 2 1212 1 1 2 11 11 1 1 2 22 2 1 12* |
|212 2 21 22 1 1 1 1 2 2 12 1 21 11 |
|1 1 1 2 2 *2 1 12 2 12 2 1 |
| 2 22 2 *1 11 1 11 2 1 1 |
| 2 1 2 211 1 11 2|
| 2 |
| |
| 1 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -768.22
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -766.14 -770.19
2 -766.07 -769.03
--------------------------------------
TOTAL -766.10 -769.77
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895088 0.090873 0.393545 1.528508 0.867552 1501.00 1501.00 1.000
r(A<->C){all} 0.163978 0.020358 0.000012 0.445899 0.122322 211.60 248.70 1.001
r(A<->G){all} 0.152923 0.018722 0.000155 0.426808 0.112322 186.20 208.34 1.002
r(A<->T){all} 0.158461 0.017666 0.000188 0.428545 0.123467 155.77 185.31 1.000
r(C<->G){all} 0.174747 0.022551 0.000068 0.494163 0.135617 125.91 204.93 1.000
r(C<->T){all} 0.172200 0.021029 0.000008 0.466561 0.134987 200.47 227.17 1.000
r(G<->T){all} 0.177692 0.021342 0.000187 0.462759 0.137248 252.74 268.54 1.000
pi(A){all} 0.257665 0.000331 0.222846 0.294631 0.257461 1274.86 1306.96 1.000
pi(C){all} 0.244663 0.000342 0.210239 0.281290 0.244170 1055.11 1067.70 1.000
pi(G){all} 0.295800 0.000356 0.257871 0.332199 0.295703 1335.01 1418.01 1.000
pi(T){all} 0.201872 0.000284 0.168941 0.233894 0.201525 1069.68 1236.68 1.000
alpha{1,2} 0.402477 0.199402 0.000367 1.328210 0.243336 1098.08 1140.96 1.000
alpha{3} 0.470469 0.262049 0.000176 1.473438 0.302843 1112.87 1146.11 1.000
pinvar{all} 0.997142 0.000012 0.990734 0.999999 0.998309 1091.16 1296.08 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- .**.**
9 -- ..*.*.
10 -- ..*..*
11 -- ...**.
12 -- ....**
13 -- ..****
14 -- .**...
15 -- .*.***
16 -- .****.
17 -- ..**..
18 -- .*...*
19 -- ...*.*
20 -- .*.*..
21 -- .***.*
22 -- ..***.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 464 0.154564 0.003769 0.151899 0.157229 2
8 440 0.146569 0.003769 0.143904 0.149234 2
9 438 0.145903 0.006595 0.141239 0.150566 2
10 432 0.143904 0.009422 0.137242 0.150566 2
11 432 0.143904 0.007537 0.138574 0.149234 2
12 430 0.143238 0.003769 0.140573 0.145903 2
13 428 0.142572 0.003769 0.139907 0.145237 2
14 428 0.142572 0.013191 0.133245 0.151899 2
15 427 0.142239 0.014604 0.131912 0.152565 2
16 426 0.141905 0.011306 0.133911 0.149900 2
17 424 0.141239 0.010364 0.133911 0.148568 2
18 421 0.140240 0.006124 0.135909 0.144570 2
19 419 0.139574 0.006124 0.135243 0.143904 2
20 412 0.137242 0.012248 0.128581 0.145903 2
21 411 0.136909 0.004240 0.133911 0.139907 2
22 282 0.093937 0.010364 0.086609 0.101266 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097897 0.010234 0.000036 0.299509 0.067252 1.000 2
length{all}[2] 0.101024 0.010448 0.000033 0.313863 0.069541 1.000 2
length{all}[3] 0.099466 0.010330 0.000005 0.302700 0.067340 1.001 2
length{all}[4] 0.095556 0.009149 0.000028 0.281555 0.064984 1.000 2
length{all}[5] 0.098709 0.009905 0.000056 0.297518 0.066691 1.000 2
length{all}[6] 0.100721 0.009765 0.000043 0.301196 0.072426 1.000 2
length{all}[7] 0.100059 0.010619 0.000072 0.297871 0.069589 0.998 2
length{all}[8] 0.098321 0.009109 0.000127 0.295936 0.070561 0.999 2
length{all}[9] 0.095178 0.008602 0.000579 0.277561 0.068825 1.000 2
length{all}[10] 0.105825 0.009516 0.000089 0.282311 0.079779 0.998 2
length{all}[11] 0.103661 0.010101 0.000105 0.302133 0.073763 0.998 2
length{all}[12] 0.099507 0.010026 0.000343 0.301855 0.067122 0.998 2
length{all}[13] 0.106412 0.010652 0.000151 0.311632 0.079006 1.000 2
length{all}[14] 0.095338 0.008634 0.000370 0.299357 0.070405 0.998 2
length{all}[15] 0.104162 0.011846 0.000227 0.322318 0.065109 0.998 2
length{all}[16] 0.101455 0.009605 0.000632 0.305189 0.072837 1.003 2
length{all}[17] 0.099662 0.008855 0.000134 0.284658 0.077308 0.998 2
length{all}[18] 0.110864 0.012428 0.000183 0.327297 0.073476 0.998 2
length{all}[19] 0.097743 0.008883 0.000066 0.278383 0.066955 0.998 2
length{all}[20] 0.099640 0.009833 0.000119 0.300453 0.068847 0.998 2
length{all}[21] 0.094427 0.008962 0.000025 0.280916 0.066725 1.001 2
length{all}[22] 0.090627 0.009825 0.000247 0.284687 0.060627 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007950
Maximum standard deviation of split frequencies = 0.014604
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 555
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 49 patterns at 185 / 185 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 49 patterns at 185 / 185 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
47824 bytes for conP
4312 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.090567 0.064429 0.043372 0.093585 0.109920 0.100706 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -818.507101
Iterating by ming2
Initial: fx= 818.507101
x= 0.09057 0.06443 0.04337 0.09358 0.10992 0.10071 0.30000 1.30000
1 h-m-p 0.0000 0.0002 442.0543 +++ 771.710108 m 0.0002 14 | 1/8
2 h-m-p 0.0011 0.0053 65.8853 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 406.1422 ++ 752.495295 m 0.0001 45 | 2/8
4 h-m-p 0.0009 0.0085 46.7576 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 364.2071 ++ 733.212688 m 0.0001 76 | 3/8
6 h-m-p 0.0014 0.0140 33.8550 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 316.7694 ++ 731.531058 m 0.0000 107 | 4/8
8 h-m-p 0.0002 0.0244 24.0526 ----------.. | 4/8
9 h-m-p 0.0000 0.0000 258.5985 ++ 728.882041 m 0.0000 137 | 5/8
10 h-m-p 0.0005 0.0378 16.0488 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 182.9408 ++ 727.163380 m 0.0001 168 | 6/8
12 h-m-p 0.3215 8.0000 0.0000 +++ 727.163380 m 8.0000 180 | 6/8
13 h-m-p 0.0160 8.0000 0.0015 -----C 727.163380 0 0.0000 198 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 --C 727.163380 0 0.0003 213 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 ----------C 727.163380 0 0.0000 236
Out..
lnL = -727.163380
237 lfun, 237 eigenQcodon, 1422 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.072334 0.074851 0.092632 0.039600 0.074633 0.055312 0.299796 0.723527 0.596503
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.819296
np = 9
lnL0 = -800.599741
Iterating by ming2
Initial: fx= 800.599741
x= 0.07233 0.07485 0.09263 0.03960 0.07463 0.05531 0.29980 0.72353 0.59650
1 h-m-p 0.0000 0.0002 433.4941 +++ 758.434373 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0002 289.2288 ++ 744.144774 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0000 144271.4121 ++ 731.761872 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 476.0568 ++ 730.463431 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 57729231875.5185
h-m-p: 5.40179012e-15 2.70089506e-14 5.77292319e+10 730.463431
.. | 4/9
6 h-m-p 0.0000 0.0000 256.0242 ++ 730.384752 m 0.0000 72 | 5/9
7 h-m-p 0.0000 0.0073 30.2054 +++++ 727.163310 m 0.0073 87 | 6/9
8 h-m-p 1.6000 8.0000 0.0005 ++ 727.163309 m 8.0000 99 | 6/9
9 h-m-p 0.0156 3.6058 0.2551 -----------C 727.163309 0 0.0000 125 | 6/9
10 h-m-p 0.0160 8.0000 0.0003 +++++ 727.163308 m 8.0000 143 | 6/9
11 h-m-p 0.0094 2.8048 0.2947 -----------N 727.163308 0 0.0000 169 | 6/9
12 h-m-p 0.0040 1.9899 0.1127 +++++ 727.163242 m 1.9899 187 | 7/9
13 h-m-p 0.6357 8.0000 0.1087 ------------Y 727.163242 0 0.0000 214 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 -------Y 727.163242 0 0.0000 235
Out..
lnL = -727.163242
236 lfun, 708 eigenQcodon, 2832 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.101145 0.071128 0.082285 0.083844 0.063066 0.051755 0.138953 1.503645 0.124498 0.116850 1.439113
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 14.342533
np = 11
lnL0 = -797.365764
Iterating by ming2
Initial: fx= 797.365764
x= 0.10114 0.07113 0.08229 0.08384 0.06307 0.05175 0.13895 1.50364 0.12450 0.11685 1.43911
1 h-m-p 0.0000 0.0004 331.2024 +++ 751.832242 m 0.0004 17 | 1/11
2 h-m-p 0.0000 0.0002 295.3529 ++ 742.183332 m 0.0002 31 | 2/11
3 h-m-p 0.0000 0.0001 581.3118 ++ 736.024356 m 0.0001 45 | 3/11
4 h-m-p 0.0000 0.0000 21623.6714 ++ 735.914332 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0060 17.5187 ++++ 735.738019 m 0.0060 75 | 5/11
6 h-m-p 0.0002 0.0011 47.4695 ++ 735.590440 m 0.0011 89 | 6/11
7 h-m-p 0.0029 0.6062 11.4109 ------------.. | 6/11
8 h-m-p 0.0000 0.0001 235.2639 ++ 731.494826 m 0.0001 127 | 7/11
9 h-m-p 0.0160 8.0000 5.8715 -------------.. | 7/11
10 h-m-p 0.0000 0.0001 171.2801 ++ 727.163277 m 0.0001 166 | 8/11
11 h-m-p 0.5167 8.0000 0.0000 ++ 727.163277 m 8.0000 180 | 8/11
12 h-m-p 0.0160 8.0000 0.0595 ---------N 727.163277 0 0.0000 206 | 8/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 727.163277 m 8.0000 226 | 8/11
14 h-m-p 0.0160 8.0000 1.3672 ----------Y 727.163277 0 0.0000 253 | 8/11
15 h-m-p 0.0160 8.0000 0.0042 +++++ 727.163275 m 8.0000 270 | 8/11
16 h-m-p 0.0224 8.0000 1.4924 ------------Y 727.163275 0 0.0000 299 | 8/11
17 h-m-p 0.0160 8.0000 0.0000 ----Y 727.163275 0 0.0000 317 | 8/11
18 h-m-p 0.0160 8.0000 0.0000 Y 727.163275 0 0.0160 334
Out..
lnL = -727.163275
335 lfun, 1340 eigenQcodon, 6030 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -727.179837 S = -727.160786 -0.007305
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:02
did 20 / 49 patterns 0:03
did 30 / 49 patterns 0:03
did 40 / 49 patterns 0:03
did 49 / 49 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.086713 0.086885 0.092974 0.060545 0.014549 0.106370 0.000100 0.761378 1.800153
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 20.881495
np = 9
lnL0 = -801.281322
Iterating by ming2
Initial: fx= 801.281322
x= 0.08671 0.08689 0.09297 0.06055 0.01455 0.10637 0.00011 0.76138 1.80015
1 h-m-p 0.0000 0.0000 378.8394 ++ 801.178599 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0048 67.6062 +++++ 782.258693 m 0.0048 29 | 2/9
3 h-m-p 0.0002 0.0010 65.7650 ++ 765.858517 m 0.0010 41 | 3/9
4 h-m-p 0.0005 0.0053 107.5508 ++ 743.799046 m 0.0053 53 | 4/9
5 h-m-p 0.0001 0.0004 212.3093 ++ 739.173946 m 0.0004 65 | 5/9
6 h-m-p 0.0000 0.0002 480.9339 ++ 734.412084 m 0.0002 77 | 6/9
7 h-m-p 0.0011 0.0053 14.4009 -----------.. | 6/9
8 h-m-p 0.0000 0.0001 229.9679 ++ 727.251638 m 0.0001 110 | 7/9
9 h-m-p 0.0241 8.0000 0.9037 -------------.. | 7/9
10 h-m-p 0.0000 0.0000 166.5720 ++ 727.162982 m 0.0000 147 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 -C 727.162982 0 0.1000 160 | 8/9
12 h-m-p 1.6000 8.0000 0.0000 Y 727.162982 0 1.6000 173
Out..
lnL = -727.162982
174 lfun, 1914 eigenQcodon, 10440 P(t)
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.088345 0.011684 0.091744 0.077619 0.099214 0.063685 0.000100 0.900000 1.031788 1.792144 1.299805
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.738487
np = 11
lnL0 = -798.632407
Iterating by ming2
Initial: fx= 798.632407
x= 0.08834 0.01168 0.09174 0.07762 0.09921 0.06369 0.00011 0.90000 1.03179 1.79214 1.29981
1 h-m-p 0.0000 0.0000 375.3338 ++ 798.497332 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 168.9425 +++ 786.586274 m 0.0005 31 | 2/11
3 h-m-p 0.0002 0.0012 141.2776 ++ 744.188462 m 0.0012 45 | 3/11
4 h-m-p 0.0005 0.0024 92.2762 ++ 733.907024 m 0.0024 59 | 4/11
5 h-m-p 0.0001 0.0003 1090.1390 ++ 728.891609 m 0.0003 73 | 5/11
6 h-m-p 0.0000 0.0000 3820.3653 ++ 727.974475 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0000 30176.2699 ++ 727.163298 m 0.0000 101 | 7/11
8 h-m-p 1.6000 8.0000 0.0013 ++ 727.163298 m 8.0000 115 | 7/11
9 h-m-p 0.0196 3.1097 0.5414 ----------Y 727.163298 0 0.0000 143 | 7/11
10 h-m-p 0.0160 8.0000 0.0004 +++++ 727.163298 m 8.0000 164 | 7/11
11 h-m-p 0.0160 8.0000 0.4431 ------------C 727.163298 0 0.0000 194 | 7/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 727.163297 m 8.0000 215 | 7/11
13 h-m-p 0.0109 5.4386 0.4033 ----------C 727.163297 0 0.0000 243 | 7/11
14 h-m-p 0.0160 8.0000 0.0192 +++++ 727.163258 m 8.0000 264 | 7/11
15 h-m-p 0.3688 5.1001 0.4165 ---------------.. | 7/11
16 h-m-p 0.0160 8.0000 0.0007 +++++ 727.163255 m 8.0000 316 | 7/11
17 h-m-p 0.0416 6.7950 0.1314 -----------C 727.163255 0 0.0000 345 | 7/11
18 h-m-p 0.0160 8.0000 0.0015 +++++ 727.163247 m 8.0000 366 | 7/11
19 h-m-p 0.0711 6.5030 0.1689 -----------C 727.163247 0 0.0000 395 | 7/11
20 h-m-p 0.0067 3.3698 0.0430 +++++ 727.163084 m 3.3698 416 | 8/11
21 h-m-p 0.4921 8.0000 0.1840 --------------N 727.163084 0 0.0000 448 | 8/11
22 h-m-p 0.0160 8.0000 0.0001 +++++ 727.163084 m 8.0000 468 | 8/11
23 h-m-p 0.0059 2.9573 0.4920 ------------.. | 8/11
24 h-m-p 0.0160 8.0000 0.0006 +++++ 727.163081 m 8.0000 515 | 8/11
25 h-m-p 0.0186 8.0000 0.2423 -------------.. | 8/11
26 h-m-p 0.0160 8.0000 0.0006 +++++ 727.163079 m 8.0000 563 | 8/11
27 h-m-p 0.0192 8.0000 0.2397 -------------.. | 8/11
28 h-m-p 0.0160 8.0000 0.0006 +++++ 727.163076 m 8.0000 611 | 8/11
29 h-m-p 0.0198 8.0000 0.2369 -------------.. | 8/11
30 h-m-p 0.0160 8.0000 0.0006 +++++ 727.163073 m 8.0000 659 | 8/11
31 h-m-p 0.0204 8.0000 0.2341 -----------C 727.163073 0 0.0000 687 | 8/11
32 h-m-p 0.0160 8.0000 0.0001 -------Y 727.163073 0 0.0000 711 | 8/11
33 h-m-p 0.0160 8.0000 0.0004 +++++ 727.163072 m 8.0000 731 | 8/11
34 h-m-p 0.0160 8.0000 0.3481 -----------Y 727.163072 0 0.0000 759 | 8/11
35 h-m-p 0.0160 8.0000 0.0039 +++++ 727.163058 m 8.0000 779 | 8/11
36 h-m-p 0.1033 8.0000 0.2990 -------------Y 727.163058 0 0.0000 809 | 8/11
37 h-m-p 0.0160 8.0000 0.0000 +++++ 727.163058 m 8.0000 829 | 8/11
38 h-m-p 0.0074 3.7090 1.1267 -----------Y 727.163058 0 0.0000 857 | 8/11
39 h-m-p 0.0160 8.0000 0.0000 ----Y 727.163058 0 0.0000 875 | 8/11
40 h-m-p 0.0123 6.1415 25.3695 -------------.. | 8/11
41 h-m-p 0.0160 8.0000 0.0007 +++++ 727.163054 m 8.0000 920 | 8/11
42 h-m-p 0.0239 8.0000 0.2282 -----------Y 727.163054 0 0.0000 948 | 8/11
43 h-m-p 0.0160 8.0000 0.0001 -------------.. | 8/11
44 h-m-p 0.0160 8.0000 0.0007 +++++ 727.163050 m 8.0000 996 | 8/11
45 h-m-p 0.0262 8.0000 0.2138 ------------Y 727.163050 0 0.0000 1025 | 8/11
46 h-m-p 0.0160 8.0000 0.0001 +++++ 727.163050 m 8.0000 1045 | 8/11
47 h-m-p 0.0160 8.0000 0.2535 -------------.. | 8/11
48 h-m-p 0.0160 8.0000 0.0007 +++++ 727.163046 m 8.0000 1093 | 8/11
49 h-m-p 0.0273 8.0000 0.2109 --------------.. | 8/11
50 h-m-p 0.0160 8.0000 0.0007 +++++ 727.163041 m 8.0000 1142 | 8/11
51 h-m-p 0.0284 8.0000 0.2085 -------------C 727.163041 0 0.0000 1172 | 8/11
52 h-m-p 0.0160 8.0000 0.0007 +++++ 727.163038 m 8.0000 1192 | 8/11
53 h-m-p 0.0176 3.5673 0.3373 -------------.. | 8/11
54 h-m-p 0.0160 8.0000 0.0008 +++++ 727.163033 m 8.0000 1240 | 8/11
55 h-m-p 0.0301 8.0000 0.2059 -------------Y 727.163033 0 0.0000 1270 | 8/11
56 h-m-p 0.0160 8.0000 0.0023 +++++ 727.163021 m 8.0000 1290 | 8/11
57 h-m-p 0.0637 8.0000 0.2908 ------------C 727.163021 0 0.0000 1319 | 8/11
58 h-m-p 0.0160 8.0000 0.0002 +++++ 727.163020 m 8.0000 1339 | 8/11
59 h-m-p 0.0160 8.0000 0.6340 -------------.. | 8/11
60 h-m-p 0.0160 8.0000 0.0009 +++++ 727.163014 m 8.0000 1387 | 8/11
61 h-m-p 0.0303 8.0000 0.2272 ------------Y 727.163014 0 0.0000 1416 | 8/11
62 h-m-p 0.0160 8.0000 0.0017 +++++ 727.163004 m 8.0000 1436 | 8/11
63 h-m-p 0.0287 5.0052 0.4870 ------------Y 727.163004 0 0.0000 1465 | 8/11
64 h-m-p 0.0160 8.0000 0.0004 +++++ 727.163004 m 8.0000 1485 | 8/11
65 h-m-p 0.0006 0.0232 5.2422 ++
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
+ 727.162982 m 0.0232 1503
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.184018e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144078e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
| 9/11
66 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
N 727.162982 0 1.6000 1517
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.184018e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27628) = 1.144157e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
| 9/11
67 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
Y 727.162982 0 0.0640 1534
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
Out..
lnL = -727.162982
1535 lfun, 18420 eigenQcodon, 101310 P(t)
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -727.233559 S = -727.164087 -0.030952
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:31
did 20 / 49 patterns 0:31
did 30 / 49 patterns 0:31
did 40 / 49 patterns 0:31
did 49 / 49 patterns 0:31
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
Time used: 0:31
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=185
NC_011896_1_WP_010908418_1_1682_MLBR_RS07970 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
NC_002677_1_NP_302097_1_969_frr MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
NZ_LVXE01000006_1_WP_010908418_1_2306_A3216_RS03700 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
NZ_LYPH01000002_1_WP_010908418_1_274_A8144_RS01290 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
NZ_CP029543_1_WP_010908418_1_1713_DIJ64_RS08715 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
NZ_AP014567_1_WP_010908418_1_1756_JK2ML_RS08930 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP
**************************************************
NC_011896_1_WP_010908418_1_1682_MLBR_RS07970 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
NC_002677_1_NP_302097_1_969_frr ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
NZ_LVXE01000006_1_WP_010908418_1_2306_A3216_RS03700 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
NZ_LYPH01000002_1_WP_010908418_1_274_A8144_RS01290 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
NZ_CP029543_1_WP_010908418_1_1713_DIJ64_RS08715 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
NZ_AP014567_1_WP_010908418_1_1756_JK2ML_RS08930 ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV
**************************************************
NC_011896_1_WP_010908418_1_1682_MLBR_RS07970 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
NC_002677_1_NP_302097_1_969_frr AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
NZ_LVXE01000006_1_WP_010908418_1_2306_A3216_RS03700 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
NZ_LYPH01000002_1_WP_010908418_1_274_A8144_RS01290 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
NZ_CP029543_1_WP_010908418_1_1713_DIJ64_RS08715 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
NZ_AP014567_1_WP_010908418_1_1756_JK2ML_RS08930 AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE
**************************************************
NC_011896_1_WP_010908418_1_1682_MLBR_RS07970 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
NC_002677_1_NP_302097_1_969_frr DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
NZ_LVXE01000006_1_WP_010908418_1_2306_A3216_RS03700 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
NZ_LYPH01000002_1_WP_010908418_1_274_A8144_RS01290 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
NZ_CP029543_1_WP_010908418_1_1713_DIJ64_RS08715 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
NZ_AP014567_1_WP_010908418_1_1756_JK2ML_RS08930 DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
***********************************
>NC_011896_1_WP_010908418_1_1682_MLBR_RS07970 ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG AGGTC >NC_002677_1_NP_302097_1_969_frr ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG AGGTC >NZ_LVXE01000006_1_WP_010908418_1_2306_A3216_RS03700 ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG AGGTC >NZ_LYPH01000002_1_WP_010908418_1_274_A8144_RS01290 ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG AGGTC >NZ_CP029543_1_WP_010908418_1_1713_DIJ64_RS08715 ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG AGGTC >NZ_AP014567_1_WP_010908418_1_1756_JK2ML_RS08930 ATGATCGATGAAGCTCTTTTCGATGCAGAAGAGAAAATGGAGAAGGCTGT TTCGGTGGCGCGTGAAGATTTGTCGATGATTCGGACCGGCCGCGCCAATC CAGGTATGTTCTCTCGACTCGTCATTGATTATTATGGCTCGGCCACCCCG ATCACCCAGCTGGCCAGCATTAATGTACCTGAGGCGAGGCTTGTTGTCAT CAAGCCGTATGACGCCATTCAGCTGCATGCCATTGAAACTGCTATTCGTA ACTCCGACCTCGGGGTGAACCCTAGTAACGACGGTACCTTGATCCGGGTA GCCGTACCGCAGCTAACCGAGGAACGTCGGCGGGAGTTGGTCAAACAGGC CAAGTGCAAGGGGGAGGACGCCAAAGTCTCGGTACGCAACATCCGTCGCA AAGTGATGGAGGAACTGCATCGCATTCGTAAAGATGGCGAGGCAGGCGAA GATGAGGTCAGCCGGGCGGAAAAGGACCTAGATAAGACCACCCACCAGTA CGTTATCCAGATTGACGAACTGGTCAAGCACAAAGAAGGTGAGCTGCTGG AGGTC
>NC_011896_1_WP_010908418_1_1682_MLBR_RS07970 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV >NC_002677_1_NP_302097_1_969_frr MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV >NZ_LVXE01000006_1_WP_010908418_1_2306_A3216_RS03700 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV >NZ_LYPH01000002_1_WP_010908418_1_274_A8144_RS01290 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV >NZ_CP029543_1_WP_010908418_1_1713_DIJ64_RS08715 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV >NZ_AP014567_1_WP_010908418_1_1756_JK2ML_RS08930 MIDEALFDAEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATP ITQLASINVPEARLVVIKPYDAIQLHAIETAIRNSDLGVNPSNDGTLIRV AVPQLTEERRRELVKQAKCKGEDAKVSVRNIRRKVMEELHRIRKDGEAGE DEVSRAEKDLDKTTHQYVIQIDELVKHKEGELLEV
#NEXUS
[ID: 0172722612]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908418_1_1682_MLBR_RS07970
NC_002677_1_NP_302097_1_969_frr
NZ_LVXE01000006_1_WP_010908418_1_2306_A3216_RS03700
NZ_LYPH01000002_1_WP_010908418_1_274_A8144_RS01290
NZ_CP029543_1_WP_010908418_1_1713_DIJ64_RS08715
NZ_AP014567_1_WP_010908418_1_1756_JK2ML_RS08930
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908418_1_1682_MLBR_RS07970,
2 NC_002677_1_NP_302097_1_969_frr,
3 NZ_LVXE01000006_1_WP_010908418_1_2306_A3216_RS03700,
4 NZ_LYPH01000002_1_WP_010908418_1_274_A8144_RS01290,
5 NZ_CP029543_1_WP_010908418_1_1713_DIJ64_RS08715,
6 NZ_AP014567_1_WP_010908418_1_1756_JK2ML_RS08930
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06725164,2:0.0695405,3:0.06734042,4:0.06498433,5:0.06669087,6:0.07242551);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06725164,2:0.0695405,3:0.06734042,4:0.06498433,5:0.06669087,6:0.07242551);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -766.14 -770.19
2 -766.07 -769.03
--------------------------------------
TOTAL -766.10 -769.77
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/frr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895088 0.090873 0.393545 1.528508 0.867552 1501.00 1501.00 1.000
r(A<->C){all} 0.163978 0.020358 0.000012 0.445899 0.122322 211.60 248.70 1.001
r(A<->G){all} 0.152923 0.018722 0.000155 0.426808 0.112322 186.20 208.34 1.002
r(A<->T){all} 0.158461 0.017666 0.000188 0.428545 0.123467 155.77 185.31 1.000
r(C<->G){all} 0.174747 0.022551 0.000068 0.494163 0.135617 125.91 204.93 1.000
r(C<->T){all} 0.172200 0.021029 0.000008 0.466561 0.134987 200.47 227.17 1.000
r(G<->T){all} 0.177692 0.021342 0.000187 0.462759 0.137248 252.74 268.54 1.000
pi(A){all} 0.257665 0.000331 0.222846 0.294631 0.257461 1274.86 1306.96 1.000
pi(C){all} 0.244663 0.000342 0.210239 0.281290 0.244170 1055.11 1067.70 1.000
pi(G){all} 0.295800 0.000356 0.257871 0.332199 0.295703 1335.01 1418.01 1.000
pi(T){all} 0.201872 0.000284 0.168941 0.233894 0.201525 1069.68 1236.68 1.000
alpha{1,2} 0.402477 0.199402 0.000367 1.328210 0.243336 1098.08 1140.96 1.000
alpha{3} 0.470469 0.262049 0.000176 1.473438 0.302843 1112.87 1146.11 1.000
pinvar{all} 0.997142 0.000012 0.990734 0.999999 0.998309 1091.16 1296.08 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/2res/frr/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 185
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 2 2 2 2 2 2 | Arg CGT 5 5 5 5 5 5
CTC 2 2 2 2 2 2 | CCC 0 0 0 0 0 0 | CAC 2 2 2 2 2 2 | CGC 4 4 4 4 4 4
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 6 6 6 6 6 6 | CCG 3 3 3 3 3 3 | CAG 6 6 6 6 6 6 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 8 8 8 8 8 8 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 6 6 6 6 6 6 | ACC 7 7 7 7 7 7 | AAC 4 4 4 4 4 4 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 6 6 6 6 6 6 | Arg AGA 0 0 0 0 0 0
Met ATG 5 5 5 5 5 5 | ACG 0 0 0 0 0 0 | AAG 7 7 7 7 7 7 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 3 3 3 3 3 3 | Asp GAT 7 7 7 7 7 7 | Gly GGT 3 3 3 3 3 3
GTC 7 7 7 7 7 7 | GCC 8 8 8 8 8 8 | GAC 6 6 6 6 6 6 | GGC 4 4 4 4 4 4
GTA 4 4 4 4 4 4 | GCA 2 2 2 2 2 2 | Glu GAA 10 10 10 10 10 10 | GGA 0 0 0 0 0 0
GTG 3 3 3 3 3 3 | GCG 3 3 3 3 3 3 | GAG 11 11 11 11 11 11 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908418_1_1682_MLBR_RS07970
position 1: T:0.08649 C:0.23243 A:0.27027 G:0.41081
position 2: T:0.28649 C:0.19459 A:0.36216 G:0.15676
position 3: T:0.23243 C:0.30811 A:0.14054 G:0.31892
Average T:0.20180 C:0.24505 A:0.25766 G:0.29550
#2: NC_002677_1_NP_302097_1_969_frr
position 1: T:0.08649 C:0.23243 A:0.27027 G:0.41081
position 2: T:0.28649 C:0.19459 A:0.36216 G:0.15676
position 3: T:0.23243 C:0.30811 A:0.14054 G:0.31892
Average T:0.20180 C:0.24505 A:0.25766 G:0.29550
#3: NZ_LVXE01000006_1_WP_010908418_1_2306_A3216_RS03700
position 1: T:0.08649 C:0.23243 A:0.27027 G:0.41081
position 2: T:0.28649 C:0.19459 A:0.36216 G:0.15676
position 3: T:0.23243 C:0.30811 A:0.14054 G:0.31892
Average T:0.20180 C:0.24505 A:0.25766 G:0.29550
#4: NZ_LYPH01000002_1_WP_010908418_1_274_A8144_RS01290
position 1: T:0.08649 C:0.23243 A:0.27027 G:0.41081
position 2: T:0.28649 C:0.19459 A:0.36216 G:0.15676
position 3: T:0.23243 C:0.30811 A:0.14054 G:0.31892
Average T:0.20180 C:0.24505 A:0.25766 G:0.29550
#5: NZ_CP029543_1_WP_010908418_1_1713_DIJ64_RS08715
position 1: T:0.08649 C:0.23243 A:0.27027 G:0.41081
position 2: T:0.28649 C:0.19459 A:0.36216 G:0.15676
position 3: T:0.23243 C:0.30811 A:0.14054 G:0.31892
Average T:0.20180 C:0.24505 A:0.25766 G:0.29550
#6: NZ_AP014567_1_WP_010908418_1_1756_JK2ML_RS08930
position 1: T:0.08649 C:0.23243 A:0.27027 G:0.41081
position 2: T:0.28649 C:0.19459 A:0.36216 G:0.15676
position 3: T:0.23243 C:0.30811 A:0.14054 G:0.31892
Average T:0.20180 C:0.24505 A:0.25766 G:0.29550
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 18 | Cys C TGT 0
TTC 12 | TCC 6 | TAC 6 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 24 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 12 | His H CAT 12 | Arg R CGT 30
CTC 12 | CCC 0 | CAC 12 | CGC 24
CTA 12 | CCA 6 | Gln Q CAA 0 | CGA 6
CTG 36 | CCG 18 | CAG 36 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 48 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 6
ATC 36 | ACC 42 | AAC 24 | AGC 12
ATA 0 | ACA 0 | Lys K AAA 36 | Arg R AGA 0
Met M ATG 30 | ACG 0 | AAG 42 | AGG 6
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 18 | Asp D GAT 42 | Gly G GGT 18
GTC 42 | GCC 48 | GAC 36 | GGC 24
GTA 24 | GCA 12 | Glu E GAA 60 | GGA 0
GTG 18 | GCG 18 | GAG 66 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.08649 C:0.23243 A:0.27027 G:0.41081
position 2: T:0.28649 C:0.19459 A:0.36216 G:0.15676
position 3: T:0.23243 C:0.30811 A:0.14054 G:0.31892
Average T:0.20180 C:0.24505 A:0.25766 G:0.29550
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -727.163380 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299796 1.299805
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908418_1_1682_MLBR_RS07970: 0.000004, NC_002677_1_NP_302097_1_969_frr: 0.000004, NZ_LVXE01000006_1_WP_010908418_1_2306_A3216_RS03700: 0.000004, NZ_LYPH01000002_1_WP_010908418_1_274_A8144_RS01290: 0.000004, NZ_CP029543_1_WP_010908418_1_1713_DIJ64_RS08715: 0.000004, NZ_AP014567_1_WP_010908418_1_1756_JK2ML_RS08930: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29980
omega (dN/dS) = 1.29981
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 449.4 105.6 1.2998 0.0000 0.0000 0.0 0.0
7..2 0.000 449.4 105.6 1.2998 0.0000 0.0000 0.0 0.0
7..3 0.000 449.4 105.6 1.2998 0.0000 0.0000 0.0 0.0
7..4 0.000 449.4 105.6 1.2998 0.0000 0.0000 0.0 0.0
7..5 0.000 449.4 105.6 1.2998 0.0000 0.0000 0.0 0.0
7..6 0.000 449.4 105.6 1.2998 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -727.163242 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.138953 0.999990 0.211051
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908418_1_1682_MLBR_RS07970: 0.000004, NC_002677_1_NP_302097_1_969_frr: 0.000004, NZ_LVXE01000006_1_WP_010908418_1_2306_A3216_RS03700: 0.000004, NZ_LYPH01000002_1_WP_010908418_1_274_A8144_RS01290: 0.000004, NZ_CP029543_1_WP_010908418_1_1713_DIJ64_RS08715: 0.000004, NZ_AP014567_1_WP_010908418_1_1756_JK2ML_RS08930: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.13895
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.21105 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 455.7 99.3 0.2111 0.0000 0.0000 0.0 0.0
7..2 0.000 455.7 99.3 0.2111 0.0000 0.0000 0.0 0.0
7..3 0.000 455.7 99.3 0.2111 0.0000 0.0000 0.0 0.0
7..4 0.000 455.7 99.3 0.2111 0.0000 0.0000 0.0 0.0
7..5 0.000 455.7 99.3 0.2111 0.0000 0.0000 0.0 0.0
7..6 0.000 455.7 99.3 0.2111 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -727.163275 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.698976 0.155981 0.000001 1.466525
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908418_1_1682_MLBR_RS07970: 0.000004, NC_002677_1_NP_302097_1_969_frr: 0.000004, NZ_LVXE01000006_1_WP_010908418_1_2306_A3216_RS03700: 0.000004, NZ_LYPH01000002_1_WP_010908418_1_274_A8144_RS01290: 0.000004, NZ_CP029543_1_WP_010908418_1_1713_DIJ64_RS08715: 0.000004, NZ_AP014567_1_WP_010908418_1_1756_JK2ML_RS08930: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.69898 0.15598 0.14504
w: 0.00000 1.00000 1.46652
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 461.9 93.1 0.3687 0.0000 0.0000 0.0 0.0
7..2 0.000 461.9 93.1 0.3687 0.0000 0.0000 0.0 0.0
7..3 0.000 461.9 93.1 0.3687 0.0000 0.0000 0.0 0.0
7..4 0.000 461.9 93.1 0.3687 0.0000 0.0000 0.0 0.0
7..5 0.000 461.9 93.1 0.3687 0.0000 0.0000 0.0 0.0
7..6 0.000 461.9 93.1 0.3687 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908418_1_1682_MLBR_RS07970)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908418_1_1682_MLBR_RS07970)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -727.162982 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.420646
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908418_1_1682_MLBR_RS07970: 0.000004, NC_002677_1_NP_302097_1_969_frr: 0.000004, NZ_LVXE01000006_1_WP_010908418_1_2306_A3216_RS03700: 0.000004, NZ_LYPH01000002_1_WP_010908418_1_274_A8144_RS01290: 0.000004, NZ_CP029543_1_WP_010908418_1_1713_DIJ64_RS08715: 0.000004, NZ_AP014567_1_WP_010908418_1_1756_JK2ML_RS08930: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.42065
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 461.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 461.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 461.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 461.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 461.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 461.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -727.162982 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 2.276401 1.874809
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908418_1_1682_MLBR_RS07970: 0.000004, NC_002677_1_NP_302097_1_969_frr: 0.000004, NZ_LVXE01000006_1_WP_010908418_1_2306_A3216_RS03700: 0.000004, NZ_LYPH01000002_1_WP_010908418_1_274_A8144_RS01290: 0.000004, NZ_CP029543_1_WP_010908418_1_1713_DIJ64_RS08715: 0.000004, NZ_AP014567_1_WP_010908418_1_1756_JK2ML_RS08930: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 2.27640
(p1 = 0.00001) w = 1.87481
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.87481
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 461.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 461.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 461.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 461.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 461.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 461.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908418_1_1682_MLBR_RS07970)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.101 0.102 0.103 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.105 0.104 0.103 0.102 0.100 0.099 0.098 0.097 0.096 0.095
Time used: 0:31
Model 1: NearlyNeutral -727.163242 Model 2: PositiveSelection -727.163275 Model 0: one-ratio -727.16338 Model 7: beta -727.162982 Model 8: beta&w>1 -727.162982 Model 0 vs 1 2.75999999985288E-4 Model 2 vs 1 6.60000000607397E-5 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
