--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:22:49 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/2res/ftsX/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1241.11 -1244.02 2 -1241.10 -1244.44 -------------------------------------- TOTAL -1241.10 -1244.25 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.883563 0.090213 0.339266 1.458836 0.853578 1459.78 1480.39 1.000 r(A<->C){all} 0.159357 0.018953 0.000152 0.435069 0.127730 227.42 259.16 1.000 r(A<->G){all} 0.175886 0.022400 0.000023 0.481242 0.137223 156.88 226.35 1.005 r(A<->T){all} 0.176030 0.021145 0.000009 0.463421 0.139570 214.01 270.21 1.003 r(C<->G){all} 0.148266 0.018592 0.000041 0.435925 0.106179 133.08 234.94 1.005 r(C<->T){all} 0.188184 0.024711 0.000042 0.488147 0.149998 199.79 271.48 1.000 r(G<->T){all} 0.152276 0.017988 0.000007 0.421353 0.113307 187.90 261.27 1.008 pi(A){all} 0.192414 0.000171 0.168058 0.218645 0.192280 1333.60 1417.30 1.002 pi(C){all} 0.273708 0.000221 0.244906 0.302453 0.273287 1328.43 1355.23 1.000 pi(G){all} 0.281420 0.000223 0.250556 0.308676 0.281219 1096.23 1213.99 1.000 pi(T){all} 0.252458 0.000204 0.225635 0.281342 0.252063 1187.39 1229.84 1.000 alpha{1,2} 0.396227 0.181071 0.000142 1.298777 0.246990 989.97 1100.13 1.000 alpha{3} 0.416430 0.222341 0.000114 1.389022 0.249504 1183.56 1257.68 1.000 pinvar{all} 0.996541 0.000010 0.990967 0.999935 0.997396 1215.57 1290.70 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1189.162555 Model 2: PositiveSelection -1184.240392 Model 0: one-ratio -1188.511295 Model 7: beta -1189.162831 Model 8: beta&w>1 -1184.240392 Model 0 vs 1 1.302520000000186 Model 2 vs 1 9.844326000000365 Additional information for M1 vs M2: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320) Pr(w>1) post mean +- SE for w 196 A 1.000** 999.000 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320) Pr(w>1) post mean +- SE for w 196 A 0.945 7.212 +- 2.751 Model 8 vs 7 9.844878000000335 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320) Pr(w>1) post mean +- SE for w 196 A 1.000** 999.000 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320) Pr(w>1) post mean +- SE for w 1 V 0.520 3.906 +- 3.746 2 R 0.521 3.914 +- 3.747 3 F 0.520 3.909 +- 3.747 4 G 0.520 3.909 +- 3.747 5 F 0.521 3.915 +- 3.748 6 L 0.521 3.917 +- 3.748 7 L 0.520 3.910 +- 3.747 8 N 0.520 3.909 +- 3.747 9 E 0.520 3.912 +- 3.747 10 V 0.520 3.912 +- 3.747 11 V 0.520 3.906 +- 3.746 12 T 0.520 3.912 +- 3.747 13 G 0.520 3.909 +- 3.747 14 L 0.520 3.910 +- 3.747 15 R 0.521 3.917 +- 3.748 16 R 0.521 3.914 +- 3.747 17 N 0.521 3.915 +- 3.748 18 V 0.519 3.904 +- 3.746 19 T 0.520 3.906 +- 3.746 20 M 0.519 3.902 +- 3.745 21 T 0.520 3.906 +- 3.746 22 I 0.520 3.908 +- 3.746 23 A 0.519 3.904 +- 3.746 24 M 0.519 3.902 +- 3.745 25 I 0.519 3.902 +- 3.745 26 L 0.521 3.918 +- 3.748 27 T 0.520 3.906 +- 3.746 28 T 0.519 3.904 +- 3.746 29 A 0.519 3.904 +- 3.746 30 I 0.519 3.902 +- 3.745 31 S 0.520 3.911 +- 3.747 32 I 0.520 3.911 +- 3.747 33 G 0.520 3.909 +- 3.747 34 L 0.521 3.918 +- 3.748 35 F 0.521 3.915 +- 3.748 36 G 0.521 3.915 +- 3.748 37 G 0.520 3.909 +- 3.747 38 G 0.520 3.911 +- 3.747 39 L 0.521 3.917 +- 3.748 40 L 0.521 3.917 +- 3.748 41 V 0.520 3.906 +- 3.746 42 V 0.519 3.904 +- 3.746 43 R 0.521 3.915 +- 3.748 44 L 0.521 3.918 +- 3.748 45 A 0.519 3.902 +- 3.745 46 D 0.520 3.910 +- 3.747 47 N 0.520 3.909 +- 3.747 48 S 0.520 3.910 +- 3.747 49 R 0.521 3.920 +- 3.749 50 S 0.520 3.910 +- 3.747 51 I 0.519 3.902 +- 3.745 52 Y 0.521 3.914 +- 3.747 53 L 0.521 3.917 +- 3.748 54 D 0.521 3.916 +- 3.748 55 R 0.521 3.920 +- 3.749 56 V 0.519 3.904 +- 3.746 57 E 0.520 3.912 +- 3.747 58 T 0.521 3.917 +- 3.748 59 Q 0.521 3.919 +- 3.748 60 V 0.519 3.904 +- 3.746 61 F 0.521 3.915 +- 3.748 62 L 0.520 3.910 +- 3.747 63 T 0.519 3.904 +- 3.746 64 D 0.521 3.916 +- 3.748 65 D 0.520 3.910 +- 3.747 66 I 0.519 3.902 +- 3.745 67 S 0.520 3.910 +- 3.747 68 A 0.519 3.902 +- 3.745 69 N 0.520 3.909 +- 3.747 70 D 0.521 3.916 +- 3.748 71 L 0.521 3.917 +- 3.748 72 T 0.519 3.904 +- 3.746 73 C 0.521 3.914 +- 3.748 74 N 0.520 3.909 +- 3.747 75 T 0.521 3.917 +- 3.748 76 N 0.520 3.909 +- 3.747 77 L 0.521 3.918 +- 3.748 78 C 0.521 3.918 +- 3.748 79 K 0.520 3.911 +- 3.747 80 A 0.519 3.904 +- 3.746 81 L 0.521 3.915 +- 3.748 82 R 0.521 3.915 +- 3.748 83 G 0.521 3.918 +- 3.748 84 K 0.520 3.911 +- 3.747 85 I 0.519 3.902 +- 3.745 86 E 0.521 3.918 +- 3.748 87 A 0.520 3.911 +- 3.747 88 R 0.521 3.920 +- 3.749 89 D 0.521 3.916 +- 3.748 90 D 0.520 3.910 +- 3.747 91 V 0.519 3.904 +- 3.746 92 K 0.521 3.918 +- 3.748 93 S 0.520 3.910 +- 3.747 94 L 0.522 3.921 +- 3.749 95 R 0.521 3.915 +- 3.748 96 F 0.520 3.909 +- 3.747 97 L 0.521 3.915 +- 3.748 98 N 0.520 3.909 +- 3.747 99 R 0.521 3.917 +- 3.748 100 Q 0.521 3.919 +- 3.748 101 D 0.520 3.910 +- 3.747 102 A 0.520 3.911 +- 3.747 103 Y 0.521 3.914 +- 3.747 104 D 0.520 3.910 +- 3.747 105 D 0.520 3.910 +- 3.747 106 A 0.520 3.911 +- 3.747 107 I 0.519 3.902 +- 3.745 108 R 0.521 3.920 +- 3.749 109 K 0.521 3.918 +- 3.748 110 F 0.520 3.909 +- 3.747 111 P 0.520 3.911 +- 3.747 112 Q 0.521 3.919 +- 3.748 113 Y 0.521 3.914 +- 3.747 114 R 0.520 3.912 +- 3.747 115 D 0.521 3.916 +- 3.748 116 V 0.520 3.912 +- 3.747 117 A 0.519 3.904 +- 3.746 118 G 0.520 3.909 +- 3.747 119 K 0.520 3.911 +- 3.747 120 D 0.521 3.916 +- 3.748 121 S 0.521 3.915 +- 3.748 122 F 0.520 3.909 +- 3.747 123 P 0.520 3.909 +- 3.747 124 A 0.520 3.911 +- 3.747 125 S 0.520 3.911 +- 3.747 126 F 0.520 3.909 +- 3.747 127 I 0.519 3.902 +- 3.745 128 I 0.519 3.902 +- 3.745 129 K 0.520 3.911 +- 3.747 130 L 0.521 3.920 +- 3.749 131 A 0.520 3.911 +- 3.747 132 N 0.520 3.909 +- 3.747 133 P 0.520 3.909 +- 3.747 134 V 0.520 3.912 +- 3.747 135 Q 0.522 3.921 +- 3.749 136 H 0.521 3.914 +- 3.748 137 K 0.520 3.911 +- 3.747 138 E 0.521 3.918 +- 3.748 139 F 0.521 3.915 +- 3.748 140 D 0.520 3.910 +- 3.747 141 A 0.519 3.902 +- 3.745 142 A 0.519 3.904 +- 3.746 143 T 0.520 3.906 +- 3.746 144 Q 0.521 3.919 +- 3.748 145 G 0.520 3.909 +- 3.747 146 Q 0.521 3.919 +- 3.748 147 P 0.520 3.909 +- 3.747 148 G 0.520 3.911 +- 3.747 149 V 0.520 3.906 +- 3.746 150 L 0.521 3.915 +- 3.748 151 S 0.520 3.910 +- 3.747 152 V 0.520 3.906 +- 3.746 153 L 0.520 3.910 +- 3.747 154 N 0.521 3.915 +- 3.748 155 Q 0.521 3.919 +- 3.748 156 K 0.520 3.911 +- 3.747 157 E 0.521 3.918 +- 3.748 158 L 0.521 3.917 +- 3.748 159 I 0.519 3.902 +- 3.745 160 D 0.520 3.910 +- 3.747 161 R 0.521 3.917 +- 3.748 162 L 0.521 3.917 +- 3.748 163 F 0.520 3.909 +- 3.747 164 A 0.519 3.902 +- 3.745 165 V 0.520 3.906 +- 3.746 166 L 0.521 3.918 +- 3.748 167 D 0.520 3.910 +- 3.747 168 G 0.521 3.915 +- 3.748 169 L 0.521 3.918 +- 3.748 170 S 0.520 3.910 +- 3.747 171 D 0.520 3.910 +- 3.747 172 V 0.519 3.904 +- 3.746 173 A 0.519 3.904 +- 3.746 174 F 0.520 3.909 +- 3.747 175 V 0.519 3.904 +- 3.746 176 I 0.520 3.908 +- 3.746 177 A 0.520 3.911 +- 3.747 178 L 0.522 3.921 +- 3.749 179 V 0.520 3.906 +- 3.746 180 Q 0.521 3.919 +- 3.748 181 A 0.520 3.911 +- 3.747 182 I 0.519 3.902 +- 3.745 183 G 0.521 3.918 +- 3.748 184 A 0.521 3.916 +- 3.748 185 I 0.519 3.902 +- 3.745 186 L 0.521 3.917 +- 3.748 187 L 0.521 3.920 +- 3.749 188 I 0.520 3.911 +- 3.747 189 A 0.519 3.902 +- 3.745 190 N 0.521 3.915 +- 3.748 191 M 0.519 3.902 +- 3.745 192 V 0.520 3.912 +- 3.747 193 Q 0.522 3.921 +- 3.749 194 V 0.519 3.904 +- 3.746 195 A 0.519 3.904 +- 3.746 196 A 0.980* 7.193 +- 2.575 197 Y 0.521 3.917 +- 3.748 198 T 0.520 3.906 +- 3.746 199 R 0.521 3.915 +- 3.748 200 R 0.521 3.914 +- 3.747 201 T 0.519 3.904 +- 3.746 202 E 0.520 3.912 +- 3.747 203 I 0.519 3.902 +- 3.745 204 G 0.520 3.909 +- 3.747 205 I 0.519 3.902 +- 3.745 206 M 0.519 3.902 +- 3.745 207 R 0.521 3.920 +- 3.749 208 L 0.521 3.917 +- 3.748 209 V 0.519 3.904 +- 3.746 210 G 0.520 3.909 +- 3.747 211 A 0.519 3.902 +- 3.745 212 S 0.520 3.910 +- 3.747 213 R 0.521 3.914 +- 3.747 214 W 0.521 3.919 +- 3.748 215 Y 0.521 3.917 +- 3.748 216 T 0.520 3.912 +- 3.747 217 Q 0.522 3.921 +- 3.749 218 L 0.521 3.915 +- 3.748 219 P 0.521 3.915 +- 3.748 220 F 0.521 3.915 +- 3.748 221 L 0.521 3.918 +- 3.748 222 L 0.521 3.917 +- 3.748 223 E 0.520 3.912 +- 3.747 224 A 0.521 3.916 +- 3.748 225 M 0.519 3.902 +- 3.745 226 V 0.520 3.906 +- 3.746 227 A 0.520 3.911 +- 3.747 228 A 0.519 3.904 +- 3.746 229 T 0.519 3.904 +- 3.746 230 V 0.521 3.917 +- 3.748 231 G 0.520 3.909 +- 3.747 232 A 0.519 3.902 +- 3.745 233 V 0.519 3.904 +- 3.746 234 I 0.519 3.902 +- 3.745 235 A 0.519 3.904 +- 3.746 236 I 0.519 3.902 +- 3.745 237 V 0.520 3.912 +- 3.747 238 G 0.521 3.915 +- 3.748 239 L 0.521 3.917 +- 3.748 240 L 0.521 3.915 +- 3.748 241 V 0.520 3.906 +- 3.746 242 A 0.519 3.904 +- 3.746 243 R 0.521 3.920 +- 3.749 244 A 0.521 3.916 +- 3.748 245 M 0.519 3.902 +- 3.745 246 F 0.521 3.915 +- 3.748 247 L 0.521 3.918 +- 3.748 248 N 0.520 3.909 +- 3.747 249 N 0.521 3.915 +- 3.748 250 A 0.521 3.916 +- 3.748 251 L 0.521 3.917 +- 3.748 252 N 0.520 3.909 +- 3.747 253 Q 0.521 3.919 +- 3.748 254 F 0.520 3.909 +- 3.747 255 Y 0.521 3.917 +- 3.748 256 Q 0.522 3.921 +- 3.749 257 A 0.520 3.911 +- 3.747 258 N 0.521 3.915 +- 3.748 259 L 0.521 3.917 +- 3.748 260 I 0.520 3.911 +- 3.747 261 A 0.519 3.902 +- 3.745 262 R 0.521 3.915 +- 3.748 263 V 0.519 3.904 +- 3.746 264 D 0.521 3.916 +- 3.748 265 Y 0.521 3.917 +- 3.748 266 A 0.519 3.902 +- 3.745 267 D 0.521 3.916 +- 3.748 268 V 0.519 3.904 +- 3.746 269 L 0.521 3.917 +- 3.748 270 Y 0.521 3.914 +- 3.747 271 V 0.520 3.912 +- 3.747 272 S 0.520 3.910 +- 3.747 273 P 0.520 3.911 +- 3.747 274 W 0.521 3.919 +- 3.748 275 L 0.521 3.918 +- 3.748 276 L 0.521 3.918 +- 3.748 277 L 0.521 3.918 +- 3.748 278 L 0.520 3.910 +- 3.747 279 G 0.520 3.909 +- 3.747 280 V 0.520 3.906 +- 3.746 281 A 0.519 3.904 +- 3.746 282 L 0.521 3.918 +- 3.748 283 A 0.519 3.902 +- 3.745 284 A 0.519 3.904 +- 3.746 285 L 0.521 3.918 +- 3.748 286 T 0.519 3.904 +- 3.746 287 G 0.521 3.915 +- 3.748 288 Y 0.521 3.914 +- 3.747 289 A 0.521 3.916 +- 3.748 290 T 0.521 3.917 +- 3.748 291 L 0.521 3.918 +- 3.748 292 R 0.521 3.914 +- 3.747 293 I 0.520 3.911 +- 3.747 294 Y 0.521 3.914 +- 3.747 295 V 0.520 3.906 +- 3.746 296 R 0.521 3.920 +- 3.749 297 R 0.521 3.915 +- 3.748
>C1 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR >C2 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR >C3 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR >C4 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR >C5 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR >C6 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=297 C1 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS C2 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS C3 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS C4 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS C5 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS C6 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS ************************************************** C1 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ C2 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ C3 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ C4 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ C5 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ C6 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ ************************************************** C1 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL C2 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL C3 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL C4 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL C5 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL C6 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL ************************************************** C1 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR C2 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR C3 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR C4 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR C5 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR C6 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR *********************************************.**** C1 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA C2 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA C3 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA C4 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA C5 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA C6 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA ************************************************** C1 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR C2 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR C3 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR C4 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR C5 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR C6 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR *********************************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8910] Library Relaxation: Multi_proc [96] Relaxation Summary: [8910]--->[8910] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.496 Mb, Max= 30.848 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS C2 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS C3 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS C4 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS C5 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS C6 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS ************************************************** C1 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ C2 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ C3 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ C4 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ C5 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ C6 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ ************************************************** C1 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL C2 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL C3 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL C4 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL C5 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL C6 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL ************************************************** C1 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR C2 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR C3 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR C4 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR C5 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR C6 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR *********************************************.**** C1 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA C2 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA C3 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA C4 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA C5 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA C6 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA ************************************************** C1 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR C2 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR C3 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR C4 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR C5 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR C6 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR *********************************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 99.66 C1 C3 99.66 TOP 2 0 99.66 C3 C1 99.66 BOT 0 3 99.66 C1 C4 99.66 TOP 3 0 99.66 C4 C1 99.66 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 99.66 C2 C3 99.66 TOP 2 1 99.66 C3 C2 99.66 BOT 1 3 99.66 C2 C4 99.66 TOP 3 1 99.66 C4 C2 99.66 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 99.66 C3 C5 99.66 TOP 4 2 99.66 C5 C3 99.66 BOT 2 5 99.66 C3 C6 99.66 TOP 5 2 99.66 C6 C3 99.66 BOT 3 4 99.66 C4 C5 99.66 TOP 4 3 99.66 C5 C4 99.66 BOT 3 5 99.66 C4 C6 99.66 TOP 5 3 99.66 C6 C4 99.66 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 99.87 AVG 1 C2 * 99.87 AVG 2 C3 * 99.73 AVG 3 C4 * 99.73 AVG 4 C5 * 99.87 AVG 5 C6 * 99.87 TOT TOT * 99.82 CLUSTAL W (1.83) multiple sequence alignment C1 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA C2 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA C3 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA C4 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA C5 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA C6 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA ************************************************** C1 TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT C2 TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT C3 TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT C4 TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT C5 TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT C6 TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT ************************************************** C1 TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC C2 TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC C3 TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC C4 TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC C5 TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC C6 TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC ************************************************** C1 ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC C2 ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC C3 ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC C4 ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC C5 ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC C6 ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC ************************************************** C1 CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA C2 CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA C3 CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA C4 CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA C5 CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA C6 CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA ************************************************** C1 AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG C2 AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG C3 AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG C4 AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG C5 AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG C6 AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG ************************************************** C1 GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC C2 GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC C3 GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC C4 GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC C5 GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC C6 GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC ************************************************** C1 GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG C2 GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG C3 GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG C4 GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG C5 GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG C6 GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG ************************************************** C1 TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT C2 TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT C3 TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT C4 TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT C5 TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT C6 TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT ************************************************** C1 TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA C2 TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA C3 TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA C4 TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA C5 TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA C6 TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA ************************************************** C1 CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG C2 CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG C3 CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG C4 CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG C5 CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG C6 CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG ************************************************** C1 CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC C2 CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC C3 CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGTCTATACGCGGCGC C4 CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGTCTATACGCGGCGC C5 CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC C6 CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC ************************************ ************* C1 ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA C2 ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA C3 ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA C4 ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA C5 ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA C6 ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA ************************************************** C1 ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA C2 ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA C3 ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA C4 ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA C5 ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA C6 ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA ************************************************** C1 TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA C2 TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA C3 TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA C4 TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA C5 TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA C6 TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA ************************************************** C1 CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA C2 CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA C3 CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA C4 CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA C5 CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA C6 CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA ************************************************** C1 TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG C2 TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG C3 TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG C4 TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG C5 TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG C6 TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG ************************************************** C1 CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG C2 CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG C3 CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG C4 CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG C5 CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG C6 CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG ***************************************** >C1 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG >C2 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG >C3 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGTCTATACGCGGCGC ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG >C4 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGTCTATACGCGGCGC ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG >C5 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG >C6 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG >C1 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR >C2 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR >C3 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR >C4 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR >C5 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR >C6 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 891 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579789270 Setting output file names to "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1690982660 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0330019407 Seed = 600877443 Swapseed = 1579789270 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 5 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2000.807779 -- -24.965149 Chain 2 -- -2000.772505 -- -24.965149 Chain 3 -- -1997.467880 -- -24.965149 Chain 4 -- -2000.772505 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2000.134247 -- -24.965149 Chain 2 -- -1997.467880 -- -24.965149 Chain 3 -- -2000.134247 -- -24.965149 Chain 4 -- -2000.134247 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2000.808] (-2000.773) (-1997.468) (-2000.773) * [-2000.134] (-1997.468) (-2000.134) (-2000.134) 500 -- (-1251.128) (-1250.996) (-1248.897) [-1247.500] * (-1260.019) [-1242.071] (-1257.920) (-1256.979) -- 0:33:19 1000 -- (-1245.565) (-1243.656) [-1247.426] (-1244.713) * (-1245.912) [-1242.516] (-1245.133) (-1246.560) -- 0:16:39 1500 -- (-1246.291) [-1242.885] (-1243.425) (-1245.274) * (-1247.515) (-1250.270) (-1246.858) [-1243.483] -- 0:11:05 2000 -- (-1246.754) [-1247.818] (-1249.448) (-1248.276) * (-1243.783) [-1244.462] (-1255.256) (-1240.419) -- 0:08:19 2500 -- (-1245.300) (-1248.256) [-1248.126] (-1247.698) * (-1244.550) [-1244.196] (-1245.931) (-1241.600) -- 0:06:39 3000 -- (-1242.035) (-1245.569) [-1255.468] (-1245.323) * [-1246.444] (-1246.796) (-1251.490) (-1245.160) -- 0:05:32 3500 -- (-1253.376) (-1247.417) (-1253.595) [-1244.724] * (-1254.587) [-1249.895] (-1250.886) (-1248.917) -- 0:04:44 4000 -- (-1247.841) (-1251.432) [-1243.582] (-1242.028) * (-1248.060) (-1247.882) [-1249.982] (-1243.680) -- 0:04:09 4500 -- [-1246.702] (-1248.269) (-1247.047) (-1245.944) * (-1240.956) (-1251.583) (-1249.419) [-1246.866] -- 0:03:41 5000 -- (-1248.597) (-1243.282) (-1244.684) [-1245.270] * (-1250.772) (-1241.782) (-1246.887) [-1243.174] -- 0:03:19 Average standard deviation of split frequencies: 0.071425 5500 -- [-1249.355] (-1242.132) (-1244.592) (-1248.273) * (-1243.050) (-1248.054) (-1239.884) [-1247.603] -- 0:03:00 6000 -- (-1256.631) (-1242.008) [-1243.224] (-1246.867) * (-1243.281) [-1240.396] (-1242.878) (-1244.645) -- 0:02:45 6500 -- (-1253.129) (-1248.351) (-1246.901) [-1247.463] * (-1250.394) (-1247.058) [-1242.929] (-1245.075) -- 0:02:32 7000 -- [-1240.061] (-1243.347) (-1243.489) (-1247.637) * [-1242.934] (-1255.821) (-1247.044) (-1245.602) -- 0:02:21 7500 -- (-1241.690) (-1248.486) (-1245.489) [-1243.729] * (-1243.312) (-1245.520) [-1244.070] (-1246.707) -- 0:02:12 8000 -- (-1262.656) (-1248.791) [-1245.678] (-1246.935) * (-1253.895) (-1250.709) [-1248.586] (-1247.602) -- 0:02:04 8500 -- (-1244.031) [-1247.817] (-1249.938) (-1246.092) * (-1252.039) (-1258.464) (-1242.886) [-1248.977] -- 0:01:56 9000 -- (-1244.981) (-1245.214) (-1250.017) [-1245.332] * [-1245.927] (-1242.040) (-1250.954) (-1243.343) -- 0:01:50 9500 -- (-1243.832) (-1241.642) (-1249.434) [-1243.075] * (-1241.677) [-1238.362] (-1248.619) (-1253.072) -- 0:01:44 10000 -- (-1240.160) [-1241.382] (-1249.458) (-1247.790) * (-1248.205) (-1240.017) (-1246.227) [-1242.775] -- 0:01:39 Average standard deviation of split frequencies: 0.068300 10500 -- (-1252.221) (-1252.881) (-1244.735) [-1244.538] * [-1246.912] (-1248.275) (-1247.067) (-1255.505) -- 0:01:34 11000 -- (-1244.823) (-1244.100) (-1247.485) [-1245.692] * [-1245.620] (-1240.151) (-1261.494) (-1247.595) -- 0:01:29 11500 -- (-1246.724) [-1245.679] (-1244.853) (-1249.186) * (-1240.829) (-1241.892) [-1245.489] (-1243.242) -- 0:01:25 12000 -- (-1244.788) [-1241.952] (-1253.019) (-1243.796) * (-1250.522) (-1241.399) [-1245.358] (-1241.980) -- 0:01:22 12500 -- (-1245.883) [-1253.440] (-1246.652) (-1250.223) * (-1240.343) (-1241.204) [-1244.872] (-1246.720) -- 0:01:19 13000 -- (-1244.371) [-1243.492] (-1253.039) (-1247.660) * (-1243.876) (-1241.471) (-1244.327) [-1254.008] -- 0:02:31 13500 -- [-1249.598] (-1240.232) (-1250.497) (-1245.532) * (-1240.380) (-1242.375) (-1254.807) [-1242.442] -- 0:02:26 14000 -- [-1243.585] (-1246.279) (-1247.470) (-1247.387) * (-1241.428) (-1243.566) (-1252.088) [-1243.490] -- 0:02:20 14500 -- (-1248.215) (-1249.846) [-1252.429] (-1242.741) * (-1242.830) [-1246.355] (-1252.318) (-1240.506) -- 0:02:15 15000 -- (-1247.484) (-1242.631) [-1245.838] (-1248.391) * (-1241.591) [-1241.690] (-1255.515) (-1242.953) -- 0:02:11 Average standard deviation of split frequencies: 0.029463 15500 -- (-1246.473) (-1244.034) [-1245.586] (-1248.950) * [-1241.999] (-1242.318) (-1243.440) (-1243.190) -- 0:02:07 16000 -- (-1250.390) (-1251.475) (-1249.459) [-1245.098] * (-1241.581) (-1243.140) (-1241.269) [-1240.533] -- 0:02:03 16500 -- (-1246.944) (-1242.977) (-1249.538) [-1245.389] * [-1242.426] (-1245.789) (-1242.155) (-1243.297) -- 0:01:59 17000 -- [-1245.732] (-1244.606) (-1245.147) (-1252.591) * (-1239.931) (-1245.207) [-1244.704] (-1241.149) -- 0:01:55 17500 -- (-1242.439) (-1247.433) (-1255.838) [-1242.766] * [-1242.294] (-1243.509) (-1242.689) (-1244.638) -- 0:01:52 18000 -- (-1241.176) (-1240.031) (-1243.430) [-1242.529] * [-1241.831] (-1241.868) (-1241.932) (-1242.438) -- 0:01:49 18500 -- (-1241.453) [-1243.686] (-1245.655) (-1252.489) * [-1242.998] (-1242.823) (-1242.329) (-1241.247) -- 0:01:46 19000 -- (-1243.707) [-1243.033] (-1246.161) (-1243.747) * [-1245.077] (-1241.687) (-1242.925) (-1242.046) -- 0:01:43 19500 -- (-1241.131) (-1246.599) (-1244.502) [-1245.682] * [-1243.052] (-1244.630) (-1242.286) (-1242.933) -- 0:01:40 20000 -- [-1239.613] (-1243.203) (-1244.795) (-1248.767) * (-1246.877) (-1242.245) [-1244.021] (-1242.650) -- 0:01:38 Average standard deviation of split frequencies: 0.060826 20500 -- (-1242.034) (-1250.708) [-1242.270] (-1249.082) * (-1241.807) (-1241.004) (-1241.173) [-1240.425] -- 0:01:35 21000 -- (-1243.541) (-1246.264) [-1241.280] (-1244.843) * (-1242.541) [-1241.876] (-1244.357) (-1241.938) -- 0:01:33 21500 -- (-1243.059) [-1242.535] (-1248.224) (-1249.945) * [-1242.023] (-1244.956) (-1240.551) (-1241.080) -- 0:01:31 22000 -- (-1241.566) (-1246.568) (-1249.588) [-1251.891] * [-1239.806] (-1244.715) (-1240.678) (-1244.185) -- 0:01:28 22500 -- (-1248.347) (-1242.761) [-1253.542] (-1251.802) * [-1239.923] (-1241.173) (-1240.424) (-1241.053) -- 0:01:26 23000 -- (-1241.539) [-1243.900] (-1246.755) (-1249.796) * (-1245.364) (-1244.702) [-1241.337] (-1242.098) -- 0:01:24 23500 -- [-1240.974] (-1243.884) (-1245.317) (-1259.319) * (-1244.429) (-1242.411) (-1242.998) [-1244.150] -- 0:01:23 24000 -- [-1242.099] (-1246.501) (-1246.855) (-1274.125) * (-1240.595) [-1241.153] (-1240.786) (-1248.026) -- 0:01:21 24500 -- (-1243.644) (-1248.583) [-1248.227] (-1241.021) * [-1241.893] (-1241.203) (-1241.727) (-1245.660) -- 0:01:19 25000 -- (-1240.978) (-1246.650) [-1242.256] (-1240.947) * (-1243.892) [-1243.822] (-1242.592) (-1241.181) -- 0:01:18 Average standard deviation of split frequencies: 0.058577 25500 -- (-1242.142) [-1242.120] (-1245.021) (-1241.565) * (-1241.326) (-1245.417) [-1242.494] (-1241.198) -- 0:01:16 26000 -- (-1246.180) [-1243.937] (-1248.363) (-1245.099) * (-1249.048) (-1239.149) [-1240.086] (-1243.381) -- 0:01:14 26500 -- (-1240.130) (-1249.753) [-1243.909] (-1242.773) * [-1242.976] (-1240.483) (-1241.250) (-1243.260) -- 0:01:13 27000 -- [-1244.896] (-1247.997) (-1241.777) (-1241.472) * (-1243.044) [-1241.076] (-1246.949) (-1244.047) -- 0:01:12 27500 -- (-1241.278) [-1240.359] (-1249.310) (-1242.072) * (-1242.165) [-1241.125] (-1244.521) (-1241.358) -- 0:01:46 28000 -- [-1241.823] (-1252.564) (-1242.720) (-1242.371) * (-1243.913) (-1243.064) (-1244.519) [-1242.056] -- 0:01:44 28500 -- [-1242.602] (-1246.410) (-1249.949) (-1243.817) * (-1241.327) (-1243.447) (-1240.628) [-1242.879] -- 0:01:42 29000 -- [-1243.809] (-1253.924) (-1246.054) (-1242.983) * (-1243.432) (-1242.724) (-1242.199) [-1242.894] -- 0:01:40 29500 -- (-1245.825) [-1251.096] (-1241.476) (-1242.363) * (-1242.977) (-1240.027) (-1240.430) [-1242.063] -- 0:01:38 30000 -- (-1244.852) [-1242.646] (-1248.129) (-1244.675) * [-1243.888] (-1240.824) (-1239.929) (-1245.908) -- 0:01:37 Average standard deviation of split frequencies: 0.059438 30500 -- (-1241.537) (-1245.242) [-1245.163] (-1241.287) * [-1242.890] (-1241.584) (-1244.253) (-1247.988) -- 0:01:35 31000 -- (-1243.338) [-1246.483] (-1246.680) (-1240.340) * (-1243.683) (-1247.550) (-1241.053) [-1239.257] -- 0:01:33 31500 -- (-1242.545) [-1246.883] (-1251.644) (-1243.032) * (-1244.960) (-1242.659) (-1243.238) [-1241.403] -- 0:01:32 32000 -- (-1241.705) [-1240.950] (-1248.441) (-1243.188) * [-1241.868] (-1243.887) (-1241.474) (-1243.736) -- 0:01:30 32500 -- (-1241.813) [-1244.871] (-1246.185) (-1239.050) * [-1240.970] (-1241.793) (-1245.346) (-1245.000) -- 0:01:29 33000 -- (-1242.946) [-1244.449] (-1247.659) (-1241.943) * (-1245.992) (-1241.902) (-1246.151) [-1247.077] -- 0:01:27 33500 -- (-1241.845) [-1248.182] (-1241.979) (-1241.523) * (-1244.814) (-1247.428) [-1245.967] (-1243.614) -- 0:01:26 34000 -- (-1241.723) (-1245.458) (-1251.482) [-1241.951] * (-1243.338) (-1241.604) (-1241.046) [-1245.384] -- 0:01:25 34500 -- (-1240.985) (-1247.515) [-1246.447] (-1241.452) * [-1243.742] (-1245.697) (-1242.793) (-1245.453) -- 0:01:23 35000 -- [-1243.758] (-1250.165) (-1246.964) (-1241.637) * (-1244.038) [-1243.630] (-1247.306) (-1244.891) -- 0:01:22 Average standard deviation of split frequencies: 0.071085 35500 -- (-1245.024) (-1246.625) (-1242.340) [-1242.341] * (-1244.074) (-1244.808) [-1243.836] (-1243.142) -- 0:01:21 36000 -- (-1243.108) (-1251.556) (-1251.202) [-1244.302] * (-1239.705) (-1247.048) [-1242.093] (-1243.130) -- 0:01:20 36500 -- [-1243.625] (-1245.839) (-1243.808) (-1241.925) * [-1242.889] (-1244.371) (-1240.098) (-1246.831) -- 0:01:19 37000 -- (-1242.316) (-1245.692) [-1245.288] (-1241.553) * (-1242.398) [-1244.153] (-1240.936) (-1247.541) -- 0:01:18 37500 -- (-1241.696) [-1249.437] (-1242.689) (-1248.315) * (-1248.732) (-1246.797) [-1242.411] (-1245.167) -- 0:01:17 38000 -- (-1242.110) [-1248.958] (-1248.112) (-1246.946) * (-1246.278) (-1250.420) (-1240.547) [-1242.859] -- 0:01:15 38500 -- (-1244.869) (-1244.995) [-1245.758] (-1244.220) * (-1247.530) (-1243.409) (-1240.780) [-1243.209] -- 0:01:14 39000 -- [-1243.387] (-1245.901) (-1244.576) (-1242.462) * [-1245.416] (-1241.965) (-1241.665) (-1240.804) -- 0:01:13 39500 -- (-1243.452) (-1242.700) [-1247.597] (-1244.314) * [-1242.854] (-1241.618) (-1241.859) (-1241.440) -- 0:01:12 40000 -- [-1242.871] (-1251.969) (-1244.156) (-1242.814) * (-1242.252) (-1241.835) [-1242.662] (-1246.482) -- 0:01:12 Average standard deviation of split frequencies: 0.073415 40500 -- (-1241.327) (-1248.861) [-1246.129] (-1242.681) * (-1243.223) [-1242.576] (-1241.965) (-1244.077) -- 0:01:11 41000 -- (-1241.773) (-1254.302) [-1242.674] (-1243.907) * (-1244.571) [-1242.327] (-1246.245) (-1240.519) -- 0:01:10 41500 -- (-1241.628) (-1251.173) [-1246.436] (-1244.037) * (-1241.309) (-1243.851) [-1243.155] (-1241.839) -- 0:01:32 42000 -- (-1243.481) (-1249.545) [-1244.697] (-1244.109) * (-1241.910) [-1241.502] (-1242.637) (-1244.487) -- 0:01:31 42500 -- (-1241.184) (-1244.821) [-1240.966] (-1249.255) * (-1242.337) [-1244.861] (-1248.167) (-1243.016) -- 0:01:30 43000 -- (-1243.904) [-1248.553] (-1241.483) (-1246.966) * (-1241.248) (-1246.634) [-1244.944] (-1246.509) -- 0:01:29 43500 -- [-1240.422] (-1243.721) (-1243.909) (-1243.764) * [-1242.618] (-1245.941) (-1242.012) (-1244.756) -- 0:01:27 44000 -- (-1240.652) (-1245.396) [-1241.754] (-1243.145) * [-1241.141] (-1245.862) (-1241.577) (-1241.726) -- 0:01:26 44500 -- (-1244.566) [-1246.491] (-1258.253) (-1243.173) * (-1241.876) (-1245.974) [-1244.884] (-1244.756) -- 0:01:25 45000 -- (-1243.064) (-1246.974) (-1244.363) [-1243.681] * (-1240.635) [-1242.991] (-1241.481) (-1245.106) -- 0:01:24 Average standard deviation of split frequencies: 0.073354 45500 -- (-1245.160) (-1246.892) [-1254.230] (-1243.330) * (-1245.228) (-1245.365) (-1245.705) [-1240.470] -- 0:01:23 46000 -- (-1241.749) (-1245.523) [-1243.567] (-1244.216) * (-1241.315) (-1241.997) [-1242.091] (-1241.802) -- 0:01:22 46500 -- (-1239.736) (-1249.657) (-1242.138) [-1241.660] * (-1241.035) (-1242.298) (-1243.730) [-1243.060] -- 0:01:22 47000 -- (-1242.476) [-1240.368] (-1242.937) (-1244.400) * (-1240.576) (-1242.229) (-1242.732) [-1240.574] -- 0:01:21 47500 -- (-1246.340) [-1247.388] (-1243.777) (-1243.356) * [-1240.190] (-1245.706) (-1242.499) (-1243.717) -- 0:01:20 48000 -- (-1241.315) (-1240.940) (-1245.178) [-1242.272] * (-1240.704) (-1242.530) [-1243.692] (-1243.221) -- 0:01:19 48500 -- [-1243.402] (-1243.284) (-1242.958) (-1241.341) * (-1243.237) (-1242.163) (-1245.397) [-1240.590] -- 0:01:18 49000 -- (-1241.603) [-1253.188] (-1243.356) (-1242.481) * [-1240.985] (-1242.566) (-1251.773) (-1243.540) -- 0:01:17 49500 -- (-1241.790) (-1248.477) [-1243.499] (-1243.654) * (-1240.480) [-1241.027] (-1243.092) (-1240.975) -- 0:01:16 50000 -- [-1244.957] (-1248.936) (-1239.998) (-1244.822) * [-1243.045] (-1243.068) (-1247.424) (-1246.235) -- 0:01:16 Average standard deviation of split frequencies: 0.070814 50500 -- (-1241.576) (-1243.605) [-1241.278] (-1247.226) * (-1241.761) (-1241.899) (-1245.268) [-1241.371] -- 0:01:15 51000 -- (-1243.706) (-1240.746) [-1240.791] (-1242.820) * [-1241.957] (-1241.145) (-1245.383) (-1243.653) -- 0:01:14 51500 -- (-1241.753) (-1248.986) [-1243.029] (-1242.199) * (-1241.731) (-1242.264) (-1241.532) [-1242.867] -- 0:01:13 52000 -- (-1241.941) (-1252.017) [-1241.733] (-1242.414) * (-1240.751) (-1244.087) [-1241.517] (-1241.835) -- 0:01:12 52500 -- (-1240.817) [-1243.306] (-1246.366) (-1246.160) * (-1239.312) (-1245.374) [-1240.781] (-1240.774) -- 0:01:12 53000 -- (-1241.563) [-1247.349] (-1242.142) (-1245.010) * (-1242.133) (-1244.329) (-1240.552) [-1242.132] -- 0:01:11 53500 -- (-1241.601) [-1250.382] (-1242.771) (-1242.173) * (-1243.582) (-1241.936) (-1239.553) [-1242.243] -- 0:01:10 54000 -- (-1241.327) (-1253.409) (-1242.129) [-1241.744] * [-1241.482] (-1241.296) (-1242.442) (-1242.252) -- 0:01:10 54500 -- (-1241.611) [-1254.020] (-1243.562) (-1241.775) * (-1243.024) [-1243.015] (-1244.257) (-1240.997) -- 0:01:09 55000 -- (-1242.732) (-1250.309) (-1242.336) [-1241.718] * (-1241.977) [-1243.868] (-1241.168) (-1242.479) -- 0:01:25 Average standard deviation of split frequencies: 0.072605 55500 -- [-1242.099] (-1245.734) (-1242.998) (-1247.722) * (-1245.404) (-1244.355) (-1240.743) [-1241.573] -- 0:01:25 56000 -- (-1243.718) [-1243.953] (-1242.877) (-1244.255) * (-1240.151) (-1242.765) [-1241.311] (-1242.977) -- 0:01:24 56500 -- (-1240.848) [-1242.969] (-1242.225) (-1243.885) * [-1240.463] (-1241.834) (-1246.329) (-1244.713) -- 0:01:23 57000 -- (-1242.743) (-1245.438) [-1241.673] (-1243.745) * (-1240.543) [-1240.987] (-1244.722) (-1242.217) -- 0:01:22 57500 -- (-1241.190) [-1244.064] (-1242.326) (-1243.061) * (-1239.954) (-1240.923) (-1242.191) [-1242.461] -- 0:01:21 58000 -- (-1240.827) (-1250.084) [-1241.035] (-1243.637) * (-1240.948) [-1242.572] (-1244.733) (-1239.447) -- 0:01:21 58500 -- (-1240.707) [-1241.823] (-1239.495) (-1241.744) * (-1241.706) [-1241.769] (-1243.848) (-1239.805) -- 0:01:20 59000 -- (-1240.749) [-1242.148] (-1239.914) (-1241.683) * [-1241.884] (-1240.934) (-1241.367) (-1241.794) -- 0:01:19 59500 -- (-1244.745) (-1244.758) (-1242.193) [-1240.419] * [-1241.162] (-1241.381) (-1241.965) (-1244.452) -- 0:01:19 60000 -- [-1242.469] (-1244.174) (-1240.158) (-1241.073) * [-1241.084] (-1244.867) (-1241.764) (-1245.760) -- 0:01:18 Average standard deviation of split frequencies: 0.069934 60500 -- (-1243.181) [-1240.992] (-1240.320) (-1243.109) * (-1240.726) (-1241.477) (-1240.929) [-1241.381] -- 0:01:17 61000 -- [-1243.165] (-1245.984) (-1241.101) (-1242.827) * [-1241.527] (-1242.358) (-1241.784) (-1241.389) -- 0:01:16 61500 -- (-1244.471) (-1241.887) [-1238.297] (-1241.714) * (-1240.389) [-1242.474] (-1242.134) (-1243.242) -- 0:01:16 62000 -- (-1243.958) (-1245.670) [-1243.578] (-1243.496) * (-1241.916) [-1244.605] (-1243.493) (-1240.324) -- 0:01:15 62500 -- (-1242.417) [-1241.291] (-1245.944) (-1243.414) * (-1240.888) [-1241.563] (-1243.756) (-1241.073) -- 0:01:15 63000 -- (-1243.875) (-1242.441) (-1241.459) [-1242.268] * [-1240.932] (-1240.810) (-1244.776) (-1242.075) -- 0:01:14 63500 -- [-1242.957] (-1241.167) (-1240.287) (-1241.017) * [-1240.822] (-1240.237) (-1243.183) (-1246.408) -- 0:01:13 64000 -- (-1241.216) (-1244.399) [-1240.191] (-1241.112) * [-1241.380] (-1241.706) (-1243.205) (-1243.044) -- 0:01:13 64500 -- (-1242.486) (-1241.135) [-1240.516] (-1241.169) * (-1242.213) (-1242.802) (-1240.566) [-1242.800] -- 0:01:12 65000 -- (-1245.493) [-1241.486] (-1241.649) (-1240.773) * (-1243.548) [-1243.077] (-1241.665) (-1242.799) -- 0:01:11 Average standard deviation of split frequencies: 0.061902 65500 -- [-1242.193] (-1242.350) (-1239.537) (-1241.544) * (-1241.555) [-1240.957] (-1244.718) (-1246.844) -- 0:01:11 66000 -- (-1244.231) (-1241.345) (-1244.771) [-1245.026] * (-1238.236) (-1244.403) (-1243.042) [-1244.377] -- 0:01:10 66500 -- (-1243.404) (-1249.574) (-1242.774) [-1244.611] * (-1247.768) (-1246.418) [-1243.613] (-1241.947) -- 0:01:10 67000 -- (-1242.068) (-1242.109) [-1239.817] (-1241.863) * (-1247.893) (-1240.673) (-1243.212) [-1242.374] -- 0:01:09 67500 -- (-1245.372) (-1242.895) [-1240.157] (-1241.288) * (-1241.027) (-1240.827) [-1242.109] (-1242.782) -- 0:01:09 68000 -- (-1243.341) (-1242.699) [-1242.370] (-1242.929) * [-1242.469] (-1240.951) (-1241.209) (-1241.674) -- 0:01:08 68500 -- (-1240.707) (-1242.719) (-1241.103) [-1241.601] * (-1244.671) (-1241.450) [-1244.364] (-1242.370) -- 0:01:07 69000 -- [-1241.203] (-1243.610) (-1243.142) (-1242.883) * (-1242.287) [-1242.381] (-1242.303) (-1244.849) -- 0:01:07 69500 -- (-1241.939) (-1242.036) [-1244.944] (-1243.234) * (-1242.042) [-1247.055] (-1242.242) (-1239.937) -- 0:01:20 70000 -- [-1241.403] (-1241.744) (-1243.509) (-1249.247) * (-1242.210) (-1245.376) (-1242.931) [-1242.786] -- 0:01:19 Average standard deviation of split frequencies: 0.062632 70500 -- [-1243.731] (-1242.074) (-1243.300) (-1244.168) * (-1243.907) (-1243.139) (-1242.619) [-1244.014] -- 0:01:19 71000 -- (-1244.618) [-1239.419] (-1246.105) (-1242.505) * (-1243.826) [-1239.792] (-1245.215) (-1246.345) -- 0:01:18 71500 -- (-1241.879) (-1242.280) [-1246.348] (-1242.453) * [-1244.351] (-1241.005) (-1244.725) (-1241.476) -- 0:01:17 72000 -- (-1242.172) (-1241.979) [-1242.094] (-1242.266) * (-1239.580) [-1242.094] (-1243.101) (-1240.371) -- 0:01:17 72500 -- (-1243.379) [-1242.578] (-1244.173) (-1240.740) * (-1241.381) (-1242.353) [-1243.984] (-1242.061) -- 0:01:16 73000 -- (-1246.536) (-1243.350) [-1241.594] (-1240.075) * [-1241.840] (-1241.280) (-1244.349) (-1242.949) -- 0:01:16 73500 -- (-1242.546) (-1242.484) (-1242.147) [-1241.829] * [-1242.271] (-1240.993) (-1246.716) (-1243.672) -- 0:01:15 74000 -- [-1242.320] (-1242.220) (-1243.447) (-1242.292) * (-1241.188) (-1241.437) [-1243.183] (-1242.036) -- 0:01:15 74500 -- (-1244.251) (-1242.498) [-1244.210] (-1243.859) * (-1240.471) (-1246.992) (-1243.615) [-1242.272] -- 0:01:14 75000 -- (-1242.501) (-1243.207) [-1244.360] (-1240.368) * (-1241.137) (-1243.101) [-1243.166] (-1242.293) -- 0:01:14 Average standard deviation of split frequencies: 0.061338 75500 -- (-1241.003) (-1243.591) (-1242.145) [-1241.686] * (-1240.104) (-1246.854) (-1240.881) [-1241.576] -- 0:01:13 76000 -- (-1240.930) (-1241.909) (-1240.769) [-1241.667] * (-1241.567) [-1243.274] (-1244.234) (-1242.731) -- 0:01:12 76500 -- (-1239.601) [-1240.683] (-1242.208) (-1242.650) * (-1242.386) [-1240.957] (-1243.569) (-1241.178) -- 0:01:12 77000 -- (-1244.400) (-1241.074) (-1242.936) [-1241.916] * [-1240.776] (-1240.026) (-1245.596) (-1240.997) -- 0:01:11 77500 -- [-1241.163] (-1242.338) (-1240.794) (-1244.380) * (-1241.310) [-1243.552] (-1241.195) (-1244.635) -- 0:01:11 78000 -- (-1242.725) (-1241.466) (-1240.373) [-1242.040] * [-1241.146] (-1242.501) (-1243.119) (-1241.127) -- 0:01:10 78500 -- (-1239.875) (-1243.046) (-1243.150) [-1242.849] * [-1240.735] (-1240.225) (-1241.775) (-1242.808) -- 0:01:10 79000 -- [-1240.821] (-1243.673) (-1243.232) (-1241.342) * [-1243.390] (-1241.306) (-1241.101) (-1243.986) -- 0:01:09 79500 -- [-1240.806] (-1246.088) (-1242.575) (-1240.938) * [-1241.622] (-1242.145) (-1241.830) (-1241.530) -- 0:01:09 80000 -- (-1245.217) (-1245.347) [-1241.111] (-1244.360) * (-1242.738) (-1242.680) (-1241.873) [-1242.374] -- 0:01:09 Average standard deviation of split frequencies: 0.054748 80500 -- (-1244.864) (-1245.984) [-1242.678] (-1240.243) * [-1242.340] (-1247.690) (-1243.301) (-1244.220) -- 0:01:08 81000 -- (-1242.866) (-1244.557) (-1243.004) [-1240.017] * [-1241.359] (-1244.786) (-1242.443) (-1241.788) -- 0:01:08 81500 -- (-1246.592) (-1247.256) (-1241.365) [-1241.358] * (-1244.527) (-1242.035) (-1242.639) [-1242.892] -- 0:01:07 82000 -- (-1243.402) (-1241.386) (-1244.318) [-1240.689] * (-1243.225) (-1243.501) [-1244.941] (-1241.510) -- 0:01:07 82500 -- (-1241.032) [-1244.331] (-1243.286) (-1242.732) * (-1241.484) [-1245.014] (-1243.646) (-1240.522) -- 0:01:06 83000 -- (-1245.414) (-1247.640) (-1243.522) [-1240.343] * [-1240.149] (-1244.230) (-1242.842) (-1241.687) -- 0:01:06 83500 -- [-1242.193] (-1248.317) (-1242.737) (-1243.019) * [-1239.912] (-1244.597) (-1246.441) (-1244.959) -- 0:01:05 84000 -- (-1241.812) (-1246.554) (-1245.304) [-1241.427] * [-1242.522] (-1244.164) (-1243.601) (-1239.791) -- 0:01:05 84500 -- [-1241.950] (-1242.520) (-1241.336) (-1241.326) * (-1242.790) (-1245.981) (-1242.556) [-1238.872] -- 0:01:15 85000 -- (-1242.537) (-1242.003) [-1241.949] (-1241.738) * [-1241.475] (-1243.082) (-1247.347) (-1241.619) -- 0:01:15 Average standard deviation of split frequencies: 0.048468 85500 -- (-1239.666) (-1241.105) (-1240.605) [-1240.438] * (-1240.941) (-1242.708) [-1240.985] (-1244.424) -- 0:01:14 86000 -- (-1242.649) (-1246.833) (-1242.811) [-1240.170] * [-1240.863] (-1241.578) (-1241.572) (-1243.513) -- 0:01:14 86500 -- (-1241.253) (-1244.453) (-1241.808) [-1241.783] * [-1241.482] (-1244.900) (-1244.962) (-1241.702) -- 0:01:13 87000 -- (-1240.641) (-1242.380) (-1239.430) [-1240.526] * (-1241.998) (-1248.811) (-1240.411) [-1240.882] -- 0:01:13 87500 -- (-1243.681) (-1241.629) (-1241.815) [-1238.843] * (-1242.814) (-1245.164) (-1243.736) [-1238.697] -- 0:01:13 88000 -- (-1242.092) (-1242.087) [-1241.187] (-1242.574) * [-1241.085] (-1243.237) (-1242.081) (-1239.682) -- 0:01:12 88500 -- [-1241.715] (-1244.912) (-1244.173) (-1248.170) * (-1241.212) (-1241.524) (-1244.540) [-1240.758] -- 0:01:12 89000 -- (-1242.150) (-1242.678) (-1241.872) [-1242.649] * (-1239.897) (-1243.249) (-1241.512) [-1244.568] -- 0:01:11 89500 -- (-1241.371) (-1242.986) [-1243.324] (-1242.248) * (-1242.117) [-1242.469] (-1241.969) (-1244.854) -- 0:01:11 90000 -- (-1240.578) (-1242.878) (-1242.675) [-1239.475] * (-1240.950) (-1243.367) (-1241.078) [-1242.222] -- 0:01:10 Average standard deviation of split frequencies: 0.048436 90500 -- (-1241.127) (-1242.593) (-1241.151) [-1240.252] * (-1244.813) (-1243.341) (-1240.807) [-1243.833] -- 0:01:10 91000 -- (-1241.440) (-1243.107) [-1242.939] (-1242.431) * (-1248.801) [-1239.852] (-1244.305) (-1247.495) -- 0:01:09 91500 -- (-1241.442) (-1246.851) [-1242.463] (-1242.118) * (-1243.034) [-1241.695] (-1245.619) (-1237.545) -- 0:01:09 92000 -- [-1242.767] (-1245.288) (-1241.133) (-1244.329) * (-1242.444) (-1241.911) (-1241.519) [-1239.972] -- 0:01:09 92500 -- (-1241.658) (-1243.758) (-1241.230) [-1240.762] * (-1243.288) (-1239.988) [-1240.828] (-1242.416) -- 0:01:08 93000 -- [-1243.205] (-1243.973) (-1240.242) (-1241.791) * (-1241.769) (-1244.831) (-1241.263) [-1240.949] -- 0:01:08 93500 -- [-1246.497] (-1245.511) (-1244.308) (-1241.183) * (-1240.445) (-1245.528) (-1245.583) [-1242.384] -- 0:01:07 94000 -- [-1243.840] (-1242.431) (-1244.501) (-1241.677) * (-1240.990) (-1242.735) [-1242.848] (-1238.315) -- 0:01:07 94500 -- (-1239.482) (-1243.214) [-1246.963] (-1242.110) * (-1243.274) (-1242.085) (-1245.002) [-1238.872] -- 0:01:07 95000 -- (-1240.835) (-1243.984) [-1242.608] (-1242.214) * (-1241.657) [-1245.232] (-1243.736) (-1243.469) -- 0:01:06 Average standard deviation of split frequencies: 0.046895 95500 -- (-1240.807) [-1242.950] (-1240.643) (-1244.321) * [-1242.276] (-1242.269) (-1242.221) (-1243.609) -- 0:01:06 96000 -- [-1240.892] (-1240.680) (-1245.681) (-1243.739) * (-1241.755) (-1246.949) [-1243.332] (-1242.412) -- 0:01:05 96500 -- (-1241.424) [-1243.577] (-1244.468) (-1243.570) * [-1243.202] (-1245.866) (-1241.683) (-1239.343) -- 0:01:05 97000 -- (-1245.331) (-1245.066) [-1240.832] (-1249.604) * [-1242.429] (-1244.338) (-1242.151) (-1241.310) -- 0:01:05 97500 -- (-1244.500) (-1246.519) [-1241.164] (-1242.598) * [-1241.790] (-1242.246) (-1242.479) (-1240.917) -- 0:01:04 98000 -- [-1241.616] (-1242.031) (-1241.401) (-1241.974) * (-1246.614) [-1243.539] (-1243.746) (-1239.732) -- 0:01:04 98500 -- (-1242.377) (-1241.794) (-1242.540) [-1242.829] * [-1241.283] (-1243.219) (-1250.130) (-1240.986) -- 0:01:04 99000 -- (-1242.110) [-1243.255] (-1240.976) (-1242.232) * (-1241.193) [-1239.754] (-1242.390) (-1239.167) -- 0:01:03 99500 -- (-1246.397) (-1242.695) (-1241.686) [-1241.497] * (-1239.924) [-1245.685] (-1241.746) (-1240.705) -- 0:01:03 100000 -- [-1242.672] (-1245.005) (-1242.368) (-1241.449) * (-1243.536) [-1241.828] (-1240.629) (-1242.029) -- 0:01:12 Average standard deviation of split frequencies: 0.041160 100500 -- (-1242.465) (-1242.811) (-1243.776) [-1243.351] * (-1244.547) [-1242.926] (-1241.611) (-1244.024) -- 0:01:11 101000 -- (-1242.104) (-1243.717) [-1243.994] (-1241.014) * (-1243.720) (-1243.041) (-1245.064) [-1242.549] -- 0:01:11 101500 -- (-1242.025) (-1243.213) [-1240.669] (-1242.856) * (-1241.909) [-1244.069] (-1244.083) (-1246.595) -- 0:01:10 102000 -- (-1243.052) [-1244.839] (-1243.860) (-1244.430) * [-1243.819] (-1241.641) (-1242.430) (-1242.141) -- 0:01:10 102500 -- [-1241.090] (-1245.175) (-1244.059) (-1241.553) * (-1244.498) (-1242.461) (-1240.996) [-1242.289] -- 0:01:10 103000 -- (-1241.458) (-1246.667) [-1243.164] (-1241.593) * (-1241.464) [-1246.608] (-1240.939) (-1242.232) -- 0:01:09 103500 -- (-1241.272) (-1243.631) (-1240.817) [-1239.348] * [-1242.151] (-1245.654) (-1242.131) (-1240.958) -- 0:01:09 104000 -- (-1241.494) [-1242.477] (-1241.611) (-1239.918) * (-1244.671) [-1247.001] (-1243.586) (-1243.542) -- 0:01:08 104500 -- (-1241.218) (-1241.490) (-1242.915) [-1241.125] * (-1242.753) [-1241.917] (-1241.787) (-1241.783) -- 0:01:08 105000 -- (-1241.192) (-1244.496) (-1242.389) [-1243.364] * (-1247.811) (-1245.002) [-1240.767] (-1240.767) -- 0:01:08 Average standard deviation of split frequencies: 0.040025 105500 -- (-1241.392) (-1242.214) (-1242.114) [-1242.066] * (-1250.282) (-1241.747) (-1241.136) [-1242.620] -- 0:01:07 106000 -- [-1241.593] (-1244.104) (-1242.438) (-1241.668) * [-1243.792] (-1242.724) (-1241.953) (-1242.880) -- 0:01:07 106500 -- (-1247.889) (-1242.970) (-1243.194) [-1240.380] * (-1243.141) [-1242.696] (-1242.184) (-1244.264) -- 0:01:07 107000 -- (-1247.204) (-1246.287) (-1245.216) [-1242.301] * (-1244.661) [-1242.758] (-1240.730) (-1244.401) -- 0:01:06 107500 -- [-1243.628] (-1242.678) (-1244.024) (-1240.151) * [-1242.167] (-1239.972) (-1240.827) (-1241.391) -- 0:01:06 108000 -- (-1243.433) [-1239.474] (-1241.940) (-1242.474) * [-1241.933] (-1239.855) (-1243.987) (-1238.730) -- 0:01:06 108500 -- (-1244.559) (-1241.111) [-1240.848] (-1240.686) * [-1241.935] (-1241.184) (-1243.259) (-1243.279) -- 0:01:05 109000 -- (-1242.208) [-1239.085] (-1243.207) (-1241.092) * (-1240.818) (-1242.754) [-1240.181] (-1244.145) -- 0:01:05 109500 -- (-1244.039) (-1243.784) [-1242.397] (-1241.231) * [-1244.198] (-1242.216) (-1244.791) (-1244.205) -- 0:01:05 110000 -- (-1242.000) (-1243.589) (-1243.081) [-1240.657] * (-1245.207) (-1247.982) [-1244.819] (-1239.737) -- 0:01:04 Average standard deviation of split frequencies: 0.037391 110500 -- (-1247.282) (-1241.341) (-1243.477) [-1241.313] * (-1243.672) (-1241.059) [-1241.577] (-1243.803) -- 0:01:04 111000 -- [-1245.166] (-1243.485) (-1241.899) (-1239.242) * (-1240.818) (-1246.279) [-1240.050] (-1241.248) -- 0:01:04 111500 -- (-1246.885) (-1246.169) [-1242.424] (-1242.750) * (-1245.500) (-1243.582) [-1246.673] (-1243.431) -- 0:01:03 112000 -- (-1243.382) (-1244.590) (-1246.872) [-1242.245] * (-1242.128) [-1245.854] (-1242.531) (-1242.624) -- 0:01:03 112500 -- (-1243.112) (-1242.257) (-1243.538) [-1242.944] * [-1242.627] (-1242.200) (-1241.510) (-1241.102) -- 0:01:03 113000 -- (-1241.199) [-1241.874] (-1241.498) (-1242.185) * (-1245.844) (-1243.722) (-1244.369) [-1240.232] -- 0:01:02 113500 -- [-1241.715] (-1241.672) (-1240.650) (-1243.337) * (-1245.440) (-1243.370) [-1243.600] (-1239.726) -- 0:01:02 114000 -- (-1240.362) [-1241.230] (-1242.275) (-1240.794) * (-1246.252) [-1243.163] (-1241.152) (-1242.003) -- 0:01:02 114500 -- [-1243.013] (-1241.160) (-1242.079) (-1240.965) * (-1246.835) (-1243.445) [-1243.230] (-1241.752) -- 0:01:09 115000 -- (-1242.155) (-1243.550) (-1242.189) [-1242.671] * (-1240.077) [-1243.061] (-1241.057) (-1243.382) -- 0:01:09 Average standard deviation of split frequencies: 0.033188 115500 -- (-1243.778) (-1241.153) [-1242.720] (-1240.887) * (-1242.367) (-1246.364) [-1241.569] (-1242.220) -- 0:01:08 116000 -- [-1245.578] (-1241.052) (-1244.290) (-1240.530) * [-1240.999] (-1245.109) (-1241.322) (-1242.427) -- 0:01:08 116500 -- [-1244.277] (-1241.754) (-1245.781) (-1240.201) * (-1243.030) (-1240.779) [-1238.847] (-1242.993) -- 0:01:08 117000 -- (-1242.068) [-1242.950] (-1244.178) (-1242.639) * [-1241.459] (-1240.433) (-1242.448) (-1245.989) -- 0:01:07 117500 -- (-1241.471) [-1241.495] (-1241.981) (-1241.533) * [-1241.114] (-1242.708) (-1244.943) (-1246.582) -- 0:01:07 118000 -- (-1243.256) [-1241.552] (-1242.130) (-1241.112) * [-1240.768] (-1241.116) (-1243.879) (-1242.795) -- 0:01:07 118500 -- (-1244.109) [-1240.706] (-1241.952) (-1241.650) * [-1241.584] (-1241.909) (-1243.030) (-1241.953) -- 0:01:06 119000 -- [-1242.342] (-1244.393) (-1241.350) (-1243.171) * (-1241.697) (-1242.852) (-1243.803) [-1241.910] -- 0:01:06 119500 -- (-1242.627) [-1242.459] (-1246.212) (-1241.421) * [-1242.217] (-1242.644) (-1244.744) (-1240.870) -- 0:01:06 120000 -- (-1243.583) [-1241.866] (-1246.456) (-1241.718) * [-1241.355] (-1241.959) (-1241.885) (-1240.887) -- 0:01:06 Average standard deviation of split frequencies: 0.034075 120500 -- [-1242.068] (-1244.647) (-1242.883) (-1242.599) * [-1244.329] (-1242.996) (-1242.347) (-1245.163) -- 0:01:05 121000 -- (-1241.765) [-1244.731] (-1241.265) (-1242.349) * (-1242.305) (-1243.359) [-1243.955] (-1244.959) -- 0:01:05 121500 -- [-1244.022] (-1244.061) (-1241.022) (-1243.828) * [-1243.568] (-1240.084) (-1244.402) (-1243.971) -- 0:01:05 122000 -- (-1242.896) (-1240.094) [-1242.512] (-1242.321) * (-1241.349) (-1245.478) (-1243.645) [-1241.053] -- 0:01:04 122500 -- (-1243.323) (-1241.589) (-1243.167) [-1241.778] * (-1245.565) [-1241.630] (-1242.165) (-1243.491) -- 0:01:04 123000 -- (-1242.683) [-1242.206] (-1242.173) (-1243.427) * (-1243.224) (-1245.887) [-1241.050] (-1242.663) -- 0:01:04 123500 -- [-1243.105] (-1241.189) (-1243.772) (-1244.591) * [-1242.854] (-1242.026) (-1242.817) (-1243.305) -- 0:01:03 124000 -- (-1245.250) (-1245.938) [-1241.556] (-1241.903) * (-1241.203) [-1240.546] (-1249.139) (-1241.452) -- 0:01:03 124500 -- (-1246.156) (-1245.415) [-1242.749] (-1243.964) * (-1242.547) [-1243.028] (-1241.535) (-1241.042) -- 0:01:03 125000 -- (-1242.113) (-1241.543) (-1244.659) [-1243.126] * (-1244.950) (-1245.187) (-1242.424) [-1238.132] -- 0:01:03 Average standard deviation of split frequencies: 0.028946 125500 -- [-1249.098] (-1243.934) (-1241.304) (-1243.428) * [-1241.586] (-1246.320) (-1243.233) (-1239.644) -- 0:01:02 126000 -- (-1250.533) [-1244.151] (-1240.943) (-1243.169) * (-1242.905) (-1246.971) (-1242.624) [-1240.490] -- 0:01:02 126500 -- (-1242.600) [-1244.144] (-1240.471) (-1243.063) * [-1242.321] (-1241.900) (-1240.355) (-1239.114) -- 0:01:02 127000 -- (-1239.859) (-1244.049) [-1242.070] (-1242.329) * (-1242.643) (-1243.701) (-1241.122) [-1240.463] -- 0:01:01 127500 -- [-1242.440] (-1243.316) (-1241.782) (-1241.421) * (-1241.791) (-1240.516) (-1241.848) [-1240.513] -- 0:01:01 128000 -- (-1240.725) (-1247.170) (-1242.351) [-1243.810] * [-1242.093] (-1241.919) (-1239.532) (-1240.435) -- 0:01:01 128500 -- (-1241.488) [-1242.480] (-1245.391) (-1241.882) * (-1241.562) (-1241.666) (-1242.667) [-1240.345] -- 0:01:01 129000 -- (-1242.434) (-1244.114) (-1246.589) [-1241.742] * (-1241.558) (-1243.187) (-1243.280) [-1242.234] -- 0:01:00 129500 -- (-1242.103) (-1242.004) [-1242.564] (-1241.128) * (-1246.001) (-1243.388) (-1241.575) [-1242.165] -- 0:01:07 130000 -- [-1242.189] (-1242.170) (-1241.280) (-1242.528) * (-1239.497) (-1242.562) [-1241.987] (-1243.736) -- 0:01:06 Average standard deviation of split frequencies: 0.029663 130500 -- (-1242.311) [-1241.834] (-1242.930) (-1241.728) * (-1242.788) [-1241.327] (-1240.875) (-1242.677) -- 0:01:06 131000 -- [-1241.495] (-1241.148) (-1244.601) (-1242.379) * (-1241.174) (-1242.299) (-1240.408) [-1242.572] -- 0:01:06 131500 -- (-1241.594) [-1240.992] (-1243.101) (-1243.306) * (-1243.228) (-1241.189) [-1241.630] (-1242.033) -- 0:01:06 132000 -- (-1241.955) [-1243.173] (-1243.332) (-1242.448) * (-1241.118) (-1242.926) (-1241.693) [-1242.719] -- 0:01:05 132500 -- (-1241.554) (-1244.377) [-1242.049] (-1243.805) * (-1241.139) (-1240.801) [-1241.750] (-1241.845) -- 0:01:05 133000 -- [-1241.454] (-1243.155) (-1242.467) (-1242.072) * [-1240.957] (-1241.449) (-1243.845) (-1242.202) -- 0:01:05 133500 -- (-1241.086) [-1242.123] (-1242.153) (-1240.108) * (-1241.828) [-1244.047] (-1244.376) (-1241.459) -- 0:01:04 134000 -- (-1241.731) (-1238.647) (-1241.709) [-1242.770] * [-1242.393] (-1241.680) (-1242.014) (-1241.396) -- 0:01:04 134500 -- (-1243.184) (-1243.447) [-1239.673] (-1242.050) * (-1242.301) (-1243.913) [-1241.176] (-1242.080) -- 0:01:04 135000 -- (-1239.481) (-1242.688) (-1244.624) [-1241.425] * (-1242.400) (-1245.821) (-1241.847) [-1244.280] -- 0:01:04 Average standard deviation of split frequencies: 0.027365 135500 -- (-1241.422) (-1241.267) (-1241.815) [-1242.604] * [-1243.510] (-1244.184) (-1241.748) (-1244.038) -- 0:01:03 136000 -- (-1243.215) (-1242.508) [-1239.209] (-1243.938) * [-1240.736] (-1241.152) (-1244.137) (-1244.187) -- 0:01:03 136500 -- (-1242.135) (-1242.279) [-1242.899] (-1241.105) * [-1242.850] (-1241.590) (-1243.417) (-1242.804) -- 0:01:03 137000 -- [-1243.042] (-1242.855) (-1239.799) (-1241.972) * (-1243.731) (-1239.445) [-1241.865] (-1243.440) -- 0:01:02 137500 -- (-1241.421) [-1242.487] (-1242.533) (-1241.815) * (-1241.083) (-1242.109) [-1241.659] (-1243.840) -- 0:01:02 138000 -- [-1241.805] (-1243.474) (-1244.385) (-1243.290) * (-1244.422) (-1239.321) [-1240.432] (-1247.464) -- 0:01:02 138500 -- (-1242.589) (-1244.455) (-1242.682) [-1242.411] * (-1243.514) (-1240.539) [-1242.795] (-1246.368) -- 0:01:02 139000 -- [-1243.905] (-1241.772) (-1243.839) (-1243.566) * (-1241.341) [-1239.415] (-1245.292) (-1243.574) -- 0:01:01 139500 -- (-1238.452) (-1242.766) [-1240.652] (-1248.560) * (-1241.757) [-1241.116] (-1247.659) (-1243.533) -- 0:01:01 140000 -- [-1240.371] (-1243.247) (-1242.040) (-1242.864) * (-1242.001) (-1243.578) (-1244.517) [-1241.694] -- 0:01:01 Average standard deviation of split frequencies: 0.028574 140500 -- [-1251.480] (-1241.877) (-1242.080) (-1242.369) * (-1243.386) (-1243.003) [-1241.134] (-1243.978) -- 0:01:01 141000 -- (-1242.836) [-1241.437] (-1242.374) (-1245.832) * [-1242.736] (-1240.780) (-1241.777) (-1239.047) -- 0:01:00 141500 -- [-1243.307] (-1242.036) (-1241.091) (-1248.292) * [-1243.918] (-1240.680) (-1241.311) (-1240.929) -- 0:01:00 142000 -- (-1240.455) (-1242.214) [-1238.920] (-1249.244) * (-1247.099) (-1242.080) [-1242.548] (-1242.223) -- 0:01:00 142500 -- (-1243.795) (-1242.211) [-1240.138] (-1241.391) * [-1243.372] (-1244.679) (-1244.249) (-1241.927) -- 0:01:00 143000 -- (-1244.385) (-1241.645) (-1241.236) [-1239.523] * (-1242.178) (-1244.038) (-1243.432) [-1242.574] -- 0:00:59 143500 -- (-1240.207) (-1242.140) [-1242.826] (-1242.868) * (-1242.568) [-1243.397] (-1241.727) (-1242.149) -- 0:00:59 144000 -- [-1242.602] (-1244.433) (-1245.100) (-1238.753) * (-1241.971) [-1240.766] (-1243.204) (-1241.227) -- 0:00:59 144500 -- (-1245.090) (-1246.382) (-1244.074) [-1241.554] * (-1243.308) (-1242.095) (-1242.442) [-1243.134] -- 0:01:05 145000 -- (-1246.244) (-1241.904) [-1243.489] (-1242.683) * [-1239.830] (-1246.072) (-1242.809) (-1241.411) -- 0:01:04 Average standard deviation of split frequencies: 0.023961 145500 -- [-1243.232] (-1241.898) (-1246.406) (-1245.737) * (-1241.024) [-1242.871] (-1246.491) (-1243.574) -- 0:01:04 146000 -- (-1241.913) [-1242.122] (-1242.338) (-1243.421) * (-1243.132) (-1248.097) [-1241.545] (-1240.809) -- 0:01:04 146500 -- (-1243.332) (-1242.254) [-1240.564] (-1243.784) * [-1247.333] (-1240.928) (-1242.610) (-1242.697) -- 0:01:04 147000 -- (-1244.850) [-1241.344] (-1241.242) (-1241.655) * (-1239.925) (-1246.141) [-1245.319] (-1239.698) -- 0:01:03 147500 -- (-1247.250) (-1243.751) [-1242.535] (-1241.498) * (-1248.825) (-1244.667) [-1244.061] (-1243.388) -- 0:01:03 148000 -- (-1243.468) (-1242.214) [-1242.279] (-1240.928) * [-1241.004] (-1241.841) (-1242.225) (-1243.640) -- 0:01:03 148500 -- [-1249.477] (-1242.480) (-1241.262) (-1240.825) * (-1241.158) [-1239.016] (-1242.834) (-1242.904) -- 0:01:03 149000 -- (-1245.030) (-1241.802) (-1243.630) [-1239.753] * (-1241.106) (-1241.194) (-1240.962) [-1245.332] -- 0:01:02 149500 -- (-1250.022) (-1241.093) (-1247.656) [-1241.761] * (-1241.586) [-1242.327] (-1245.015) (-1247.636) -- 0:01:02 150000 -- (-1242.188) (-1243.816) [-1242.194] (-1242.907) * (-1243.197) (-1242.879) [-1242.981] (-1244.345) -- 0:01:02 Average standard deviation of split frequencies: 0.026018 150500 -- (-1243.986) (-1241.593) [-1241.881] (-1244.934) * (-1241.744) (-1242.798) (-1242.650) [-1245.357] -- 0:01:02 151000 -- (-1240.952) (-1242.732) (-1248.567) [-1245.401] * (-1241.174) [-1242.043] (-1242.145) (-1244.079) -- 0:01:01 151500 -- (-1245.118) (-1243.614) (-1244.493) [-1245.348] * (-1241.353) [-1241.611] (-1247.192) (-1241.640) -- 0:01:01 152000 -- [-1248.023] (-1243.612) (-1240.391) (-1246.594) * (-1242.041) (-1240.788) [-1242.774] (-1241.550) -- 0:01:01 152500 -- [-1239.424] (-1242.502) (-1241.905) (-1245.848) * (-1244.321) (-1244.475) [-1242.237] (-1244.068) -- 0:01:01 153000 -- (-1239.040) (-1242.108) [-1242.956] (-1241.345) * [-1244.206] (-1243.610) (-1242.744) (-1244.715) -- 0:01:00 153500 -- (-1242.662) (-1241.623) (-1239.933) [-1241.538] * (-1242.098) (-1239.981) [-1244.461] (-1241.227) -- 0:01:00 154000 -- (-1242.175) (-1241.498) [-1242.858] (-1243.166) * [-1241.777] (-1241.033) (-1245.305) (-1243.223) -- 0:01:00 154500 -- (-1246.091) [-1239.836] (-1242.434) (-1241.834) * (-1243.247) [-1240.373] (-1241.210) (-1245.614) -- 0:01:00 155000 -- (-1243.865) [-1242.485] (-1241.063) (-1243.218) * (-1239.588) (-1241.814) [-1242.169] (-1245.011) -- 0:00:59 Average standard deviation of split frequencies: 0.025837 155500 -- [-1243.580] (-1242.229) (-1241.943) (-1245.128) * (-1240.753) [-1240.888] (-1241.270) (-1242.695) -- 0:00:59 156000 -- (-1242.695) [-1242.025] (-1242.854) (-1242.891) * [-1240.651] (-1241.801) (-1241.868) (-1243.662) -- 0:00:59 156500 -- [-1241.466] (-1243.794) (-1242.549) (-1245.382) * (-1238.815) (-1243.513) [-1241.392] (-1239.778) -- 0:00:59 157000 -- (-1241.694) [-1242.118] (-1240.020) (-1241.881) * (-1239.154) (-1242.615) (-1241.243) [-1241.453] -- 0:00:59 157500 -- (-1242.484) (-1241.594) (-1241.229) [-1243.092] * (-1243.565) (-1244.503) (-1243.712) [-1242.060] -- 0:00:58 158000 -- [-1242.365] (-1240.598) (-1239.877) (-1243.472) * (-1248.006) [-1241.642] (-1241.877) (-1243.483) -- 0:00:58 158500 -- (-1243.851) (-1244.255) (-1241.415) [-1242.762] * (-1247.545) (-1242.237) [-1241.643] (-1239.938) -- 0:00:58 159000 -- (-1244.935) (-1241.490) (-1242.883) [-1243.203] * (-1239.567) (-1242.898) (-1243.251) [-1241.305] -- 0:00:58 159500 -- [-1241.711] (-1244.802) (-1239.801) (-1241.547) * (-1242.618) [-1244.858] (-1243.473) (-1237.819) -- 0:01:03 160000 -- [-1241.457] (-1242.906) (-1243.994) (-1241.566) * (-1245.138) (-1243.490) (-1245.534) [-1240.501] -- 0:01:02 Average standard deviation of split frequencies: 0.021465 160500 -- (-1240.542) [-1242.491] (-1244.911) (-1242.046) * (-1240.828) [-1242.526] (-1242.208) (-1241.831) -- 0:01:02 161000 -- (-1240.756) (-1242.840) (-1244.423) [-1243.139] * (-1240.223) (-1242.954) [-1242.324] (-1241.316) -- 0:01:02 161500 -- [-1241.670] (-1242.653) (-1243.380) (-1243.774) * (-1243.118) [-1243.749] (-1242.389) (-1243.555) -- 0:01:02 162000 -- (-1242.166) (-1242.555) [-1242.624] (-1242.470) * (-1241.360) (-1246.132) (-1243.666) [-1243.185] -- 0:01:02 162500 -- [-1244.626] (-1242.786) (-1245.155) (-1242.995) * (-1240.845) (-1241.848) (-1242.919) [-1243.252] -- 0:01:01 163000 -- (-1246.267) (-1247.334) (-1243.656) [-1240.480] * (-1241.637) (-1240.794) (-1240.958) [-1241.298] -- 0:01:01 163500 -- (-1247.230) (-1250.490) (-1244.116) [-1239.597] * [-1242.997] (-1243.100) (-1240.962) (-1247.148) -- 0:01:01 164000 -- (-1244.848) (-1242.321) (-1241.742) [-1242.502] * (-1247.165) [-1243.529] (-1241.277) (-1243.467) -- 0:01:01 164500 -- (-1240.210) [-1242.429] (-1242.735) (-1242.785) * (-1242.124) (-1243.383) (-1241.039) [-1240.592] -- 0:01:00 165000 -- (-1241.315) [-1245.027] (-1246.716) (-1241.025) * (-1241.957) (-1242.437) [-1241.846] (-1242.759) -- 0:01:00 Average standard deviation of split frequencies: 0.021523 165500 -- (-1243.233) (-1244.956) [-1242.327] (-1241.040) * (-1238.852) (-1246.241) (-1240.971) [-1242.000] -- 0:01:00 166000 -- (-1241.816) (-1241.848) (-1241.938) [-1243.005] * [-1242.635] (-1241.399) (-1243.226) (-1241.232) -- 0:01:00 166500 -- (-1240.734) (-1241.591) [-1243.055] (-1243.289) * (-1247.303) [-1239.661] (-1241.761) (-1241.472) -- 0:01:00 167000 -- (-1240.403) [-1240.944] (-1241.572) (-1243.587) * (-1242.124) (-1244.139) [-1243.112] (-1245.970) -- 0:00:59 167500 -- (-1243.194) (-1241.890) (-1242.017) [-1242.532] * (-1240.902) [-1241.702] (-1244.475) (-1244.577) -- 0:00:59 168000 -- (-1241.295) (-1241.292) (-1243.431) [-1241.881] * (-1239.912) (-1242.152) (-1244.761) [-1241.583] -- 0:00:59 168500 -- (-1243.441) (-1242.468) (-1244.124) [-1242.020] * (-1239.415) [-1241.226] (-1246.130) (-1243.236) -- 0:00:59 169000 -- (-1243.479) [-1241.880] (-1240.962) (-1240.731) * (-1240.604) [-1242.485] (-1243.172) (-1244.634) -- 0:00:59 169500 -- (-1242.799) (-1243.264) (-1240.654) [-1242.380] * [-1241.397] (-1241.769) (-1243.908) (-1244.412) -- 0:00:58 170000 -- [-1240.149] (-1244.630) (-1243.807) (-1240.777) * (-1240.788) [-1242.413] (-1244.312) (-1242.772) -- 0:00:58 Average standard deviation of split frequencies: 0.021176 170500 -- [-1241.926] (-1243.046) (-1241.410) (-1242.267) * (-1242.062) [-1241.158] (-1247.527) (-1242.855) -- 0:00:58 171000 -- (-1242.715) (-1244.352) (-1241.721) [-1242.185] * (-1238.540) (-1244.725) [-1244.825] (-1241.638) -- 0:00:58 171500 -- (-1244.140) (-1243.116) (-1241.091) [-1243.513] * [-1239.937] (-1242.290) (-1250.170) (-1242.264) -- 0:00:57 172000 -- (-1245.309) (-1244.155) (-1242.574) [-1242.830] * [-1240.557] (-1241.742) (-1243.388) (-1239.743) -- 0:00:57 172500 -- (-1246.918) [-1243.734] (-1242.563) (-1243.341) * [-1239.210] (-1244.985) (-1240.425) (-1239.900) -- 0:00:57 173000 -- (-1241.280) (-1240.691) [-1241.749] (-1243.713) * (-1241.307) [-1244.078] (-1241.007) (-1245.370) -- 0:00:57 173500 -- (-1242.424) (-1242.300) (-1241.963) [-1244.103] * (-1245.430) [-1241.011] (-1242.022) (-1241.620) -- 0:00:57 174000 -- (-1244.250) (-1248.110) (-1246.084) [-1242.940] * [-1240.441] (-1240.649) (-1241.391) (-1245.884) -- 0:00:56 174500 -- (-1245.968) (-1242.719) (-1243.847) [-1244.596] * (-1244.285) (-1243.243) (-1242.342) [-1244.922] -- 0:01:01 175000 -- (-1248.293) [-1241.600] (-1241.919) (-1241.481) * (-1243.112) (-1241.596) (-1245.381) [-1242.087] -- 0:01:01 Average standard deviation of split frequencies: 0.019454 175500 -- (-1242.894) [-1241.560] (-1242.174) (-1244.371) * (-1242.412) (-1242.617) (-1241.391) [-1245.025] -- 0:01:01 176000 -- (-1241.818) (-1241.137) [-1241.313] (-1241.822) * (-1243.577) (-1239.663) [-1241.321] (-1244.633) -- 0:01:00 176500 -- [-1242.245] (-1242.755) (-1244.925) (-1241.631) * (-1240.767) (-1239.930) (-1243.200) [-1243.751] -- 0:01:00 177000 -- [-1241.688] (-1242.843) (-1244.208) (-1242.012) * (-1241.358) [-1241.911] (-1242.348) (-1248.760) -- 0:01:00 177500 -- (-1240.652) (-1243.605) [-1240.686] (-1241.562) * (-1243.691) [-1242.796] (-1241.866) (-1244.187) -- 0:01:00 178000 -- (-1241.862) (-1243.892) [-1241.004] (-1240.822) * [-1242.554] (-1243.120) (-1241.889) (-1243.087) -- 0:01:00 178500 -- (-1242.758) [-1243.216] (-1241.390) (-1240.690) * (-1242.560) (-1245.961) [-1242.869] (-1244.894) -- 0:00:59 179000 -- (-1242.109) [-1243.203] (-1242.169) (-1241.736) * (-1242.000) (-1244.165) [-1242.757] (-1241.594) -- 0:00:59 179500 -- (-1244.957) (-1242.021) [-1239.268] (-1241.730) * (-1241.894) [-1240.932] (-1242.373) (-1241.039) -- 0:00:59 180000 -- (-1243.182) [-1240.099] (-1241.394) (-1246.937) * (-1242.360) [-1240.809] (-1241.524) (-1239.299) -- 0:00:59 Average standard deviation of split frequencies: 0.019714 180500 -- (-1240.708) [-1241.736] (-1242.447) (-1241.246) * [-1239.640] (-1240.306) (-1241.793) (-1241.539) -- 0:00:59 181000 -- [-1243.902] (-1239.953) (-1245.000) (-1243.840) * (-1238.864) [-1241.781] (-1244.486) (-1241.644) -- 0:00:58 181500 -- [-1244.412] (-1239.160) (-1241.386) (-1243.950) * (-1240.685) (-1241.835) (-1247.396) [-1241.534] -- 0:00:58 182000 -- (-1244.411) (-1243.033) (-1248.686) [-1242.374] * [-1241.507] (-1241.318) (-1244.838) (-1239.050) -- 0:00:58 182500 -- (-1244.647) [-1242.193] (-1243.930) (-1244.043) * (-1242.864) (-1242.596) [-1243.093] (-1242.278) -- 0:00:58 183000 -- (-1245.094) (-1242.505) (-1244.200) [-1242.380] * [-1241.626] (-1244.507) (-1241.667) (-1242.192) -- 0:00:58 183500 -- (-1244.776) [-1242.895] (-1242.737) (-1243.930) * [-1242.597] (-1246.148) (-1244.853) (-1243.384) -- 0:00:57 184000 -- (-1244.053) [-1241.495] (-1242.397) (-1245.174) * (-1241.197) [-1241.143] (-1244.400) (-1240.633) -- 0:00:57 184500 -- (-1240.926) [-1241.365] (-1241.663) (-1242.248) * (-1242.476) (-1240.750) (-1243.743) [-1245.300] -- 0:00:57 185000 -- (-1243.499) (-1244.437) [-1244.256] (-1240.771) * (-1241.494) [-1242.670] (-1241.546) (-1241.408) -- 0:00:57 Average standard deviation of split frequencies: 0.019431 185500 -- [-1241.661] (-1245.318) (-1239.704) (-1240.459) * (-1242.750) [-1243.844] (-1243.355) (-1240.614) -- 0:00:57 186000 -- (-1242.364) [-1240.718] (-1243.970) (-1242.616) * (-1243.340) (-1240.688) (-1241.284) [-1245.310] -- 0:00:56 186500 -- (-1243.347) (-1241.850) [-1241.661] (-1245.215) * (-1247.660) (-1242.455) (-1241.515) [-1241.891] -- 0:00:56 187000 -- [-1241.718] (-1241.196) (-1244.292) (-1242.320) * (-1241.713) (-1242.390) [-1241.314] (-1245.275) -- 0:00:56 187500 -- (-1244.564) [-1240.193] (-1244.091) (-1244.304) * (-1244.417) [-1241.538] (-1242.907) (-1246.999) -- 0:00:56 188000 -- (-1244.129) (-1240.811) (-1241.602) [-1244.789] * (-1239.577) (-1242.774) (-1242.899) [-1242.681] -- 0:00:56 188500 -- (-1243.106) (-1243.302) (-1243.003) [-1246.143] * [-1242.560] (-1241.401) (-1242.205) (-1242.317) -- 0:00:55 189000 -- (-1240.527) [-1240.953] (-1243.106) (-1243.837) * [-1242.974] (-1241.219) (-1241.280) (-1242.974) -- 0:00:55 189500 -- (-1243.862) (-1241.344) [-1249.510] (-1244.095) * [-1242.949] (-1242.415) (-1242.878) (-1244.074) -- 0:00:55 190000 -- (-1242.357) [-1241.121] (-1241.578) (-1245.098) * (-1243.326) (-1240.735) [-1242.191] (-1243.321) -- 0:00:59 Average standard deviation of split frequencies: 0.017444 190500 -- (-1242.678) [-1242.370] (-1243.199) (-1245.028) * (-1238.203) (-1241.562) [-1242.031] (-1246.891) -- 0:00:59 191000 -- (-1242.333) [-1241.672] (-1240.987) (-1243.998) * (-1238.408) (-1240.807) [-1242.122] (-1243.146) -- 0:00:59 191500 -- [-1242.547] (-1243.553) (-1245.141) (-1243.355) * (-1242.152) [-1243.369] (-1241.581) (-1242.407) -- 0:00:59 192000 -- (-1245.112) [-1241.241] (-1245.824) (-1242.430) * [-1242.804] (-1243.181) (-1244.950) (-1243.089) -- 0:00:58 192500 -- (-1242.812) (-1243.215) (-1245.544) [-1243.004] * (-1244.011) (-1244.755) [-1246.302] (-1243.014) -- 0:00:58 193000 -- (-1243.166) [-1241.194] (-1245.543) (-1243.048) * (-1243.244) [-1243.298] (-1242.913) (-1243.078) -- 0:00:58 193500 -- (-1241.624) (-1242.442) (-1245.352) [-1242.594] * [-1239.327] (-1241.897) (-1241.683) (-1245.140) -- 0:00:58 194000 -- [-1240.525] (-1242.670) (-1244.995) (-1243.280) * (-1240.862) (-1240.599) [-1242.414] (-1242.637) -- 0:00:58 194500 -- (-1243.891) [-1241.628] (-1244.217) (-1243.602) * (-1241.724) [-1241.146] (-1242.142) (-1241.323) -- 0:00:57 195000 -- (-1241.479) (-1242.071) [-1239.907] (-1243.257) * (-1242.158) (-1243.571) (-1241.809) [-1243.160] -- 0:00:57 Average standard deviation of split frequencies: 0.018861 195500 -- [-1241.304] (-1246.288) (-1241.951) (-1242.887) * (-1249.245) (-1242.736) (-1243.080) [-1242.507] -- 0:00:57 196000 -- (-1243.262) [-1241.427] (-1242.847) (-1241.497) * (-1240.451) [-1242.732] (-1241.175) (-1242.799) -- 0:00:57 196500 -- [-1242.108] (-1240.087) (-1244.020) (-1243.637) * (-1240.961) (-1243.864) (-1244.118) [-1242.682] -- 0:00:57 197000 -- (-1242.811) [-1238.781] (-1243.256) (-1241.024) * (-1242.384) (-1246.409) [-1240.804] (-1243.130) -- 0:00:57 197500 -- [-1242.538] (-1242.691) (-1240.435) (-1241.560) * (-1239.359) (-1241.983) [-1241.999] (-1240.963) -- 0:00:56 198000 -- (-1241.955) (-1244.851) [-1242.600] (-1241.097) * (-1241.549) (-1245.739) [-1240.431] (-1243.092) -- 0:00:56 198500 -- (-1242.411) [-1241.679] (-1244.938) (-1241.142) * [-1241.550] (-1242.914) (-1243.003) (-1240.623) -- 0:00:56 199000 -- (-1240.778) (-1241.977) (-1242.296) [-1247.715] * (-1240.827) [-1243.134] (-1240.358) (-1241.699) -- 0:00:56 199500 -- [-1241.216] (-1241.474) (-1237.894) (-1244.185) * [-1242.656] (-1243.229) (-1241.356) (-1244.285) -- 0:00:56 200000 -- (-1246.635) (-1244.204) [-1241.475] (-1244.377) * (-1243.532) [-1239.739] (-1244.731) (-1242.216) -- 0:00:55 Average standard deviation of split frequencies: 0.018141 200500 -- (-1244.133) [-1241.636] (-1242.789) (-1246.100) * (-1243.332) [-1240.169] (-1243.802) (-1241.770) -- 0:00:55 201000 -- (-1241.406) (-1245.110) [-1241.103] (-1247.389) * (-1243.921) (-1239.293) [-1244.796] (-1241.483) -- 0:00:55 201500 -- (-1242.769) [-1243.004] (-1242.668) (-1248.822) * (-1243.473) (-1242.958) [-1239.913] (-1241.263) -- 0:00:55 202000 -- (-1241.237) (-1242.292) [-1240.942] (-1245.457) * (-1244.188) [-1242.187] (-1241.726) (-1242.185) -- 0:00:55 202500 -- (-1243.742) [-1241.640] (-1239.374) (-1243.616) * (-1244.767) (-1241.899) (-1241.390) [-1243.221] -- 0:00:55 203000 -- (-1241.299) (-1241.129) (-1241.202) [-1241.058] * (-1242.255) (-1244.885) [-1242.090] (-1243.829) -- 0:00:54 203500 -- (-1242.272) (-1240.788) [-1243.709] (-1244.036) * (-1243.178) (-1243.865) [-1242.184] (-1240.995) -- 0:00:54 204000 -- (-1243.493) (-1242.318) [-1241.459] (-1242.107) * [-1243.757] (-1240.088) (-1241.290) (-1241.691) -- 0:00:54 204500 -- (-1244.528) (-1243.149) [-1241.089] (-1240.161) * (-1247.448) (-1242.367) [-1243.496] (-1244.641) -- 0:00:54 205000 -- (-1244.103) (-1245.614) (-1240.325) [-1241.576] * (-1247.879) [-1241.498] (-1242.935) (-1243.539) -- 0:00:58 Average standard deviation of split frequencies: 0.019030 205500 -- (-1243.193) [-1240.653] (-1242.097) (-1240.121) * (-1248.522) [-1243.592] (-1244.472) (-1244.781) -- 0:00:57 206000 -- [-1243.172] (-1238.470) (-1244.631) (-1240.505) * (-1244.559) [-1240.286] (-1246.273) (-1246.622) -- 0:00:57 206500 -- [-1243.560] (-1245.439) (-1240.891) (-1240.537) * [-1240.795] (-1240.932) (-1244.508) (-1242.024) -- 0:00:57 207000 -- (-1242.834) (-1241.969) (-1241.947) [-1240.288] * (-1243.010) [-1241.643] (-1242.404) (-1245.158) -- 0:00:57 207500 -- [-1243.200] (-1241.580) (-1242.478) (-1241.368) * (-1246.082) (-1241.248) (-1240.033) [-1246.880] -- 0:00:57 208000 -- (-1246.984) (-1246.285) [-1242.219] (-1239.665) * (-1242.501) [-1240.640] (-1239.317) (-1241.985) -- 0:00:57 208500 -- (-1238.951) [-1242.131] (-1240.958) (-1243.493) * (-1242.096) (-1240.697) [-1241.264] (-1241.923) -- 0:00:56 209000 -- (-1241.265) (-1247.788) [-1242.873] (-1244.882) * (-1240.009) (-1241.387) [-1240.403] (-1242.553) -- 0:00:56 209500 -- (-1241.655) [-1241.028] (-1240.591) (-1243.173) * (-1240.985) [-1242.766] (-1241.241) (-1241.159) -- 0:00:56 210000 -- (-1244.216) (-1244.908) (-1244.637) [-1240.370] * [-1239.362] (-1243.122) (-1240.676) (-1241.892) -- 0:00:56 Average standard deviation of split frequencies: 0.018137 210500 -- (-1243.918) [-1242.595] (-1243.061) (-1240.811) * (-1239.323) (-1244.870) [-1243.016] (-1242.183) -- 0:00:56 211000 -- (-1246.644) (-1242.241) (-1243.233) [-1240.927] * (-1244.177) (-1243.218) (-1241.094) [-1242.262] -- 0:00:56 211500 -- [-1241.264] (-1241.787) (-1243.663) (-1241.814) * (-1241.793) [-1252.031] (-1242.783) (-1246.007) -- 0:00:55 212000 -- (-1250.189) [-1242.078] (-1244.798) (-1241.355) * [-1239.342] (-1241.560) (-1240.682) (-1241.612) -- 0:00:55 212500 -- [-1243.867] (-1248.203) (-1241.212) (-1242.586) * (-1244.952) (-1242.877) [-1240.100] (-1246.969) -- 0:00:55 213000 -- (-1244.048) (-1243.481) [-1243.392] (-1240.892) * (-1244.443) (-1241.632) [-1242.020] (-1244.167) -- 0:00:55 213500 -- (-1244.886) (-1241.730) [-1240.865] (-1240.728) * [-1241.853] (-1242.911) (-1241.730) (-1244.446) -- 0:00:55 214000 -- [-1243.124] (-1244.970) (-1241.945) (-1240.624) * (-1241.739) (-1242.516) (-1242.519) [-1244.536] -- 0:00:55 214500 -- (-1245.100) [-1244.772] (-1241.282) (-1244.131) * (-1241.933) (-1241.910) [-1245.820] (-1240.434) -- 0:00:54 215000 -- [-1242.659] (-1243.209) (-1241.798) (-1242.947) * (-1242.312) (-1241.457) (-1241.053) [-1241.890] -- 0:00:54 Average standard deviation of split frequencies: 0.016689 215500 -- (-1242.988) [-1241.255] (-1242.974) (-1243.314) * (-1242.218) [-1241.638] (-1240.225) (-1241.374) -- 0:00:54 216000 -- (-1241.584) (-1245.588) (-1243.355) [-1242.023] * [-1241.397] (-1243.414) (-1242.696) (-1243.106) -- 0:00:54 216500 -- [-1243.038] (-1242.936) (-1243.496) (-1242.261) * (-1242.251) (-1241.773) [-1243.016] (-1246.165) -- 0:00:54 217000 -- (-1242.578) (-1239.777) (-1241.338) [-1241.467] * (-1242.438) (-1243.121) [-1244.798] (-1241.251) -- 0:00:54 217500 -- (-1242.657) (-1241.426) (-1241.835) [-1239.549] * [-1241.826] (-1243.420) (-1239.961) (-1242.631) -- 0:00:53 218000 -- (-1242.011) (-1240.969) [-1244.262] (-1241.919) * (-1240.247) (-1242.199) [-1240.765] (-1245.041) -- 0:00:53 218500 -- (-1241.574) [-1238.191] (-1243.554) (-1240.898) * [-1238.945] (-1241.860) (-1240.689) (-1241.449) -- 0:00:53 219000 -- [-1243.066] (-1241.777) (-1242.616) (-1242.878) * (-1239.810) (-1241.408) [-1241.348] (-1241.550) -- 0:00:53 219500 -- (-1244.453) [-1243.200] (-1249.422) (-1242.746) * (-1239.640) (-1243.427) [-1238.470] (-1242.554) -- 0:00:53 220000 -- (-1244.246) (-1241.614) (-1243.442) [-1241.766] * [-1242.947] (-1241.411) (-1241.658) (-1243.486) -- 0:00:56 Average standard deviation of split frequencies: 0.017719 220500 -- (-1241.709) (-1242.283) (-1244.533) [-1243.404] * (-1239.586) (-1242.524) (-1239.866) [-1241.643] -- 0:00:56 221000 -- (-1242.273) (-1245.227) [-1242.077] (-1246.115) * (-1240.086) (-1242.256) [-1238.952] (-1241.943) -- 0:00:56 221500 -- (-1241.786) (-1245.237) (-1245.066) [-1244.737] * (-1240.857) (-1244.825) (-1241.658) [-1239.418] -- 0:00:56 222000 -- (-1241.062) [-1242.756] (-1242.565) (-1244.991) * (-1241.392) (-1242.598) (-1240.760) [-1240.771] -- 0:00:56 222500 -- (-1245.133) [-1241.734] (-1243.772) (-1242.192) * (-1242.450) (-1241.476) [-1241.128] (-1241.211) -- 0:00:55 223000 -- (-1246.084) (-1241.436) (-1243.504) [-1243.268] * (-1241.884) (-1241.409) (-1240.629) [-1241.010] -- 0:00:55 223500 -- [-1241.984] (-1250.312) (-1242.370) (-1241.702) * (-1241.994) (-1240.115) [-1244.747] (-1241.701) -- 0:00:55 224000 -- (-1241.138) (-1242.096) (-1241.051) [-1239.566] * [-1241.595] (-1242.483) (-1241.758) (-1242.729) -- 0:00:55 224500 -- [-1241.109] (-1241.543) (-1241.528) (-1243.327) * (-1241.963) (-1242.985) [-1241.630] (-1241.483) -- 0:00:55 225000 -- (-1241.942) (-1242.342) [-1241.827] (-1241.692) * (-1245.038) (-1240.929) (-1242.276) [-1242.769] -- 0:00:55 Average standard deviation of split frequencies: 0.016932 225500 -- (-1242.108) [-1244.715] (-1242.499) (-1245.258) * (-1240.429) [-1241.222] (-1241.652) (-1242.868) -- 0:00:54 226000 -- (-1239.680) (-1240.207) [-1243.041] (-1242.234) * (-1246.608) (-1241.142) [-1240.810] (-1242.021) -- 0:00:54 226500 -- (-1242.639) (-1240.953) [-1243.409] (-1243.158) * [-1240.721] (-1241.931) (-1242.642) (-1244.165) -- 0:00:54 227000 -- [-1243.473] (-1242.690) (-1241.458) (-1241.457) * [-1241.492] (-1242.511) (-1244.347) (-1244.235) -- 0:00:54 227500 -- (-1244.410) (-1239.627) [-1240.691] (-1243.846) * (-1241.154) (-1241.995) [-1240.703] (-1244.674) -- 0:00:54 228000 -- (-1243.122) [-1241.332] (-1242.274) (-1243.188) * (-1240.748) (-1246.748) [-1243.552] (-1241.078) -- 0:00:54 228500 -- (-1243.386) (-1242.041) [-1242.100] (-1241.857) * (-1242.060) (-1241.104) (-1241.534) [-1241.845] -- 0:00:54 229000 -- (-1242.585) [-1240.699] (-1243.753) (-1245.139) * (-1242.497) (-1242.819) [-1240.015] (-1243.213) -- 0:00:53 229500 -- (-1242.738) (-1243.180) (-1242.312) [-1245.163] * (-1242.819) [-1241.885] (-1241.714) (-1244.853) -- 0:00:53 230000 -- (-1239.593) [-1243.204] (-1244.878) (-1241.149) * [-1243.619] (-1240.767) (-1243.950) (-1241.011) -- 0:00:53 Average standard deviation of split frequencies: 0.017598 230500 -- (-1245.937) [-1244.721] (-1242.194) (-1242.903) * (-1242.537) (-1244.060) (-1242.781) [-1241.887] -- 0:00:53 231000 -- (-1241.102) [-1240.847] (-1242.184) (-1240.964) * (-1245.187) (-1242.602) (-1242.877) [-1241.406] -- 0:00:53 231500 -- (-1244.272) (-1242.126) (-1241.561) [-1244.014] * [-1241.476] (-1240.897) (-1240.510) (-1239.867) -- 0:00:53 232000 -- [-1243.460] (-1243.400) (-1240.824) (-1242.946) * (-1241.561) [-1243.687] (-1240.815) (-1244.495) -- 0:00:52 232500 -- [-1242.273] (-1242.486) (-1242.078) (-1244.366) * (-1239.429) (-1244.732) [-1240.997] (-1246.666) -- 0:00:52 233000 -- [-1245.519] (-1238.663) (-1240.100) (-1241.472) * [-1241.282] (-1245.489) (-1242.554) (-1243.522) -- 0:00:52 233500 -- (-1245.107) (-1242.511) (-1241.854) [-1241.003] * [-1241.160] (-1240.911) (-1241.738) (-1245.875) -- 0:00:52 234000 -- (-1241.243) (-1241.287) (-1242.970) [-1238.335] * [-1242.415] (-1242.667) (-1242.020) (-1241.650) -- 0:00:52 234500 -- [-1242.652] (-1239.958) (-1243.062) (-1240.987) * [-1238.432] (-1242.225) (-1242.264) (-1244.046) -- 0:00:52 235000 -- (-1243.291) (-1243.322) [-1244.562] (-1243.801) * (-1242.254) [-1243.506] (-1241.589) (-1244.509) -- 0:00:55 Average standard deviation of split frequencies: 0.017557 235500 -- (-1243.054) (-1240.494) (-1244.336) [-1240.613] * (-1244.334) (-1242.257) (-1241.994) [-1242.419] -- 0:00:55 236000 -- [-1242.324] (-1242.835) (-1243.046) (-1241.153) * (-1242.366) (-1243.723) [-1241.011] (-1242.345) -- 0:00:55 236500 -- (-1242.060) (-1242.371) (-1242.408) [-1241.080] * [-1246.754] (-1240.502) (-1241.349) (-1243.735) -- 0:00:54 237000 -- (-1241.186) (-1239.629) (-1242.626) [-1240.306] * [-1244.932] (-1243.841) (-1241.905) (-1242.880) -- 0:00:54 237500 -- (-1243.016) (-1239.732) [-1240.869] (-1239.962) * [-1241.865] (-1242.641) (-1240.627) (-1240.884) -- 0:00:54 238000 -- (-1239.604) (-1245.390) (-1242.605) [-1240.859] * (-1241.830) (-1241.569) (-1240.856) [-1246.144] -- 0:00:54 238500 -- [-1244.386] (-1245.204) (-1243.193) (-1240.622) * [-1241.185] (-1241.467) (-1240.667) (-1241.757) -- 0:00:54 239000 -- (-1244.710) [-1243.324] (-1243.956) (-1240.648) * (-1243.356) (-1242.890) [-1242.525] (-1242.434) -- 0:00:54 239500 -- (-1242.630) [-1244.631] (-1242.785) (-1243.286) * [-1242.329] (-1242.985) (-1241.659) (-1241.619) -- 0:00:53 240000 -- [-1242.662] (-1243.350) (-1241.292) (-1243.203) * [-1243.643] (-1241.020) (-1248.412) (-1241.052) -- 0:00:53 Average standard deviation of split frequencies: 0.018282 240500 -- (-1239.853) [-1245.028] (-1243.150) (-1242.113) * (-1239.934) (-1243.029) [-1242.354] (-1241.224) -- 0:00:53 241000 -- (-1242.330) (-1247.836) (-1241.773) [-1240.450] * [-1242.634] (-1240.647) (-1242.576) (-1239.537) -- 0:00:53 241500 -- (-1241.707) [-1242.062] (-1243.024) (-1245.069) * (-1242.892) (-1240.592) (-1241.105) [-1239.814] -- 0:00:53 242000 -- (-1241.191) (-1246.432) [-1242.508] (-1242.530) * (-1243.431) (-1241.313) [-1241.538] (-1241.758) -- 0:00:53 242500 -- (-1245.628) (-1248.865) (-1241.600) [-1240.029] * [-1241.560] (-1245.308) (-1242.687) (-1243.819) -- 0:00:53 243000 -- (-1243.955) (-1246.288) [-1242.730] (-1243.001) * (-1245.738) (-1243.027) (-1244.239) [-1244.973] -- 0:00:52 243500 -- (-1242.530) (-1241.813) (-1241.658) [-1244.585] * [-1240.930] (-1241.102) (-1243.685) (-1244.928) -- 0:00:52 244000 -- (-1244.487) [-1242.524] (-1242.151) (-1243.581) * (-1242.597) (-1245.011) [-1241.044] (-1244.322) -- 0:00:52 244500 -- (-1241.484) [-1241.221] (-1242.524) (-1242.513) * (-1248.183) (-1241.455) [-1240.662] (-1243.544) -- 0:00:52 245000 -- (-1246.182) [-1242.770] (-1244.899) (-1244.781) * (-1245.436) (-1241.138) (-1240.714) [-1243.337] -- 0:00:52 Average standard deviation of split frequencies: 0.018053 245500 -- (-1244.885) [-1246.667] (-1244.997) (-1241.504) * [-1242.535] (-1243.268) (-1241.055) (-1240.768) -- 0:00:52 246000 -- (-1243.399) (-1242.325) [-1242.266] (-1241.637) * (-1240.667) [-1242.411] (-1240.335) (-1241.688) -- 0:00:52 246500 -- (-1241.677) (-1242.121) (-1245.386) [-1241.665] * (-1242.420) (-1241.819) [-1241.421] (-1242.879) -- 0:00:51 247000 -- (-1240.468) [-1240.184] (-1243.367) (-1241.812) * (-1242.511) [-1239.864] (-1246.846) (-1245.018) -- 0:00:51 247500 -- (-1243.573) [-1240.413] (-1241.479) (-1242.079) * (-1242.776) [-1239.602] (-1241.221) (-1241.885) -- 0:00:51 248000 -- (-1242.939) [-1241.433] (-1242.602) (-1242.208) * (-1245.611) (-1244.470) [-1242.564] (-1243.099) -- 0:00:51 248500 -- (-1241.662) (-1242.242) [-1245.953] (-1240.553) * (-1243.735) (-1243.367) [-1240.697] (-1243.597) -- 0:00:51 249000 -- (-1247.491) (-1240.428) (-1243.317) [-1238.977] * (-1248.603) (-1241.191) (-1244.123) [-1245.463] -- 0:00:51 249500 -- (-1246.536) [-1241.305] (-1242.367) (-1243.719) * (-1248.190) [-1246.366] (-1244.434) (-1241.285) -- 0:00:51 250000 -- (-1239.582) (-1244.360) (-1246.846) [-1242.304] * [-1246.740] (-1247.452) (-1250.894) (-1245.463) -- 0:00:54 Average standard deviation of split frequencies: 0.017618 250500 -- (-1242.746) [-1239.697] (-1242.801) (-1241.791) * [-1243.414] (-1241.654) (-1242.445) (-1242.335) -- 0:00:53 251000 -- (-1242.932) (-1242.344) [-1241.899] (-1244.184) * (-1241.965) (-1242.016) [-1240.183] (-1241.965) -- 0:00:53 251500 -- (-1241.536) (-1244.205) (-1242.160) [-1240.856] * (-1241.255) (-1242.603) [-1244.031] (-1242.912) -- 0:00:53 252000 -- (-1240.974) [-1244.745] (-1241.017) (-1240.907) * (-1242.307) [-1243.757] (-1240.558) (-1243.242) -- 0:00:53 252500 -- (-1238.445) [-1242.787] (-1242.745) (-1245.850) * (-1242.322) (-1242.285) (-1243.379) [-1240.446] -- 0:00:53 253000 -- [-1240.931] (-1241.708) (-1242.223) (-1243.224) * (-1244.613) (-1241.110) (-1243.553) [-1240.549] -- 0:00:53 253500 -- [-1242.914] (-1242.250) (-1243.155) (-1241.106) * (-1243.708) (-1246.849) (-1242.304) [-1240.798] -- 0:00:53 254000 -- (-1239.479) (-1241.520) [-1242.483] (-1240.827) * (-1243.997) (-1243.513) (-1242.685) [-1243.399] -- 0:00:52 254500 -- (-1244.703) (-1242.669) [-1241.743] (-1241.206) * (-1243.141) [-1243.495] (-1240.431) (-1240.507) -- 0:00:52 255000 -- [-1241.330] (-1240.880) (-1241.498) (-1242.900) * (-1241.350) (-1245.174) (-1244.267) [-1242.207] -- 0:00:52 Average standard deviation of split frequencies: 0.017154 255500 -- (-1240.208) (-1241.535) (-1242.727) [-1241.376] * (-1242.703) (-1241.971) (-1244.194) [-1242.323] -- 0:00:52 256000 -- (-1241.822) [-1241.071] (-1241.218) (-1241.477) * (-1244.317) (-1241.864) [-1244.976] (-1245.062) -- 0:00:52 256500 -- (-1244.804) (-1245.697) (-1241.964) [-1241.412] * (-1243.418) (-1242.262) [-1242.618] (-1243.565) -- 0:00:52 257000 -- (-1243.633) (-1239.827) [-1241.759] (-1241.088) * (-1242.674) [-1242.178] (-1240.470) (-1247.938) -- 0:00:52 257500 -- (-1240.571) (-1241.678) (-1242.847) [-1241.829] * [-1243.238] (-1239.963) (-1241.298) (-1241.128) -- 0:00:51 258000 -- (-1243.809) (-1241.675) (-1244.512) [-1241.483] * (-1240.883) (-1238.789) (-1240.994) [-1243.198] -- 0:00:51 258500 -- (-1242.907) [-1241.072] (-1240.092) (-1241.856) * [-1241.285] (-1240.787) (-1241.190) (-1241.038) -- 0:00:51 259000 -- (-1248.907) (-1243.224) (-1242.636) [-1242.428] * (-1241.162) (-1247.459) (-1242.263) [-1243.106] -- 0:00:51 259500 -- (-1242.832) (-1242.922) (-1241.916) [-1240.802] * (-1243.344) (-1242.045) (-1244.316) [-1241.117] -- 0:00:51 260000 -- (-1243.252) [-1242.103] (-1242.918) (-1240.937) * (-1241.708) (-1241.016) (-1248.022) [-1240.350] -- 0:00:51 Average standard deviation of split frequencies: 0.016371 260500 -- (-1243.569) (-1241.052) [-1244.397] (-1241.092) * (-1244.212) (-1245.661) (-1243.311) [-1243.061] -- 0:00:51 261000 -- (-1242.193) (-1241.466) [-1242.850] (-1242.078) * (-1243.661) (-1241.450) (-1242.725) [-1244.961] -- 0:00:50 261500 -- (-1242.837) [-1241.616] (-1241.064) (-1241.434) * (-1244.521) (-1242.347) [-1243.239] (-1241.664) -- 0:00:50 262000 -- [-1242.028] (-1244.613) (-1245.842) (-1244.273) * [-1246.647] (-1244.518) (-1241.995) (-1244.109) -- 0:00:50 262500 -- (-1241.581) [-1242.219] (-1244.385) (-1240.115) * [-1243.604] (-1243.698) (-1241.600) (-1241.284) -- 0:00:50 263000 -- (-1240.895) (-1243.615) (-1242.606) [-1242.799] * [-1242.646] (-1238.482) (-1241.945) (-1246.147) -- 0:00:50 263500 -- (-1240.393) [-1241.193] (-1244.820) (-1243.631) * [-1240.282] (-1240.320) (-1242.951) (-1241.099) -- 0:00:50 264000 -- (-1241.119) (-1241.161) (-1240.875) [-1239.892] * (-1241.830) (-1241.874) (-1241.377) [-1242.544] -- 0:00:50 264500 -- [-1240.899] (-1241.187) (-1241.059) (-1240.263) * [-1242.524] (-1241.335) (-1244.075) (-1241.854) -- 0:00:50 265000 -- (-1243.769) [-1243.468] (-1241.189) (-1241.366) * [-1242.460] (-1242.827) (-1240.975) (-1242.298) -- 0:00:52 Average standard deviation of split frequencies: 0.016230 265500 -- (-1246.304) (-1245.799) [-1240.080] (-1242.355) * [-1239.857] (-1243.655) (-1240.845) (-1241.479) -- 0:00:52 266000 -- (-1243.658) [-1248.329] (-1246.760) (-1242.543) * [-1241.804] (-1241.518) (-1241.776) (-1242.553) -- 0:00:52 266500 -- (-1242.076) (-1242.279) (-1244.004) [-1243.275] * [-1242.548] (-1241.783) (-1240.571) (-1244.367) -- 0:00:52 267000 -- (-1242.644) [-1243.032] (-1243.398) (-1242.000) * (-1243.139) [-1244.515] (-1239.283) (-1242.974) -- 0:00:52 267500 -- (-1241.255) (-1241.289) (-1242.374) [-1241.135] * (-1242.413) (-1243.701) [-1242.402] (-1244.860) -- 0:00:52 268000 -- [-1242.096] (-1244.072) (-1244.326) (-1241.898) * (-1242.757) [-1240.870] (-1240.872) (-1243.277) -- 0:00:51 268500 -- (-1243.450) (-1244.151) (-1241.621) [-1243.032] * (-1244.985) [-1241.075] (-1246.282) (-1242.039) -- 0:00:51 269000 -- (-1242.766) (-1241.013) (-1242.511) [-1240.762] * (-1242.921) (-1241.339) (-1245.679) [-1245.201] -- 0:00:51 269500 -- (-1240.634) [-1240.497] (-1241.820) (-1246.850) * (-1243.021) (-1241.306) [-1242.269] (-1243.871) -- 0:00:51 270000 -- [-1242.678] (-1240.481) (-1242.933) (-1244.349) * (-1242.718) (-1239.578) [-1242.682] (-1242.528) -- 0:00:51 Average standard deviation of split frequencies: 0.014575 270500 -- (-1246.775) (-1240.568) (-1244.223) [-1241.624] * (-1241.986) (-1241.565) (-1241.980) [-1242.259] -- 0:00:51 271000 -- [-1242.026] (-1243.688) (-1245.057) (-1243.136) * (-1241.575) [-1242.134] (-1242.928) (-1242.019) -- 0:00:51 271500 -- (-1241.533) (-1243.368) (-1245.889) [-1241.764] * [-1241.341] (-1242.175) (-1251.636) (-1242.670) -- 0:00:50 272000 -- (-1245.026) [-1240.382] (-1244.158) (-1242.942) * [-1242.396] (-1244.084) (-1241.867) (-1241.880) -- 0:00:50 272500 -- (-1244.950) (-1245.546) [-1246.612] (-1244.757) * (-1242.949) (-1244.107) [-1240.774] (-1243.027) -- 0:00:50 273000 -- (-1246.055) (-1241.240) [-1244.777] (-1240.135) * (-1241.358) (-1240.980) [-1243.565] (-1243.257) -- 0:00:50 273500 -- (-1242.954) (-1241.938) (-1242.992) [-1242.095] * [-1243.392] (-1240.990) (-1248.987) (-1243.977) -- 0:00:50 274000 -- (-1241.547) (-1242.955) (-1242.394) [-1240.971] * (-1242.081) (-1245.601) [-1241.635] (-1243.800) -- 0:00:50 274500 -- (-1240.646) (-1240.178) (-1242.951) [-1244.696] * [-1241.971] (-1240.767) (-1241.261) (-1243.713) -- 0:00:50 275000 -- (-1242.634) (-1244.881) (-1243.457) [-1242.758] * (-1243.274) [-1239.997] (-1241.465) (-1238.979) -- 0:00:50 Average standard deviation of split frequencies: 0.013394 275500 -- (-1243.910) (-1242.743) [-1241.195] (-1243.188) * (-1246.588) (-1240.250) (-1241.285) [-1242.627] -- 0:00:49 276000 -- [-1241.035] (-1239.801) (-1242.334) (-1242.881) * (-1245.767) [-1240.369] (-1243.055) (-1241.665) -- 0:00:49 276500 -- (-1241.074) (-1243.665) (-1244.000) [-1243.138] * (-1243.950) (-1241.072) [-1243.839] (-1241.869) -- 0:00:49 277000 -- (-1241.941) (-1239.331) (-1245.312) [-1241.837] * [-1241.565] (-1246.466) (-1245.762) (-1245.152) -- 0:00:49 277500 -- [-1242.949] (-1239.659) (-1245.133) (-1241.499) * [-1243.373] (-1245.494) (-1242.278) (-1243.483) -- 0:00:49 278000 -- [-1242.273] (-1238.560) (-1243.865) (-1242.724) * (-1244.095) (-1243.449) (-1244.100) [-1241.807] -- 0:00:49 278500 -- (-1242.984) (-1240.795) (-1242.694) [-1241.752] * [-1239.578] (-1242.875) (-1245.487) (-1241.904) -- 0:00:49 279000 -- (-1241.668) (-1241.425) [-1245.953] (-1243.160) * [-1241.441] (-1242.541) (-1244.315) (-1242.530) -- 0:00:49 279500 -- [-1240.874] (-1240.742) (-1240.666) (-1240.120) * (-1244.745) (-1241.615) [-1243.317] (-1245.006) -- 0:00:48 280000 -- (-1243.640) [-1239.330] (-1245.486) (-1240.621) * [-1243.061] (-1241.075) (-1242.381) (-1242.519) -- 0:00:51 Average standard deviation of split frequencies: 0.012995 280500 -- (-1241.974) (-1241.017) (-1245.173) [-1243.133] * [-1242.521] (-1241.911) (-1243.605) (-1244.305) -- 0:00:51 281000 -- (-1242.190) [-1242.168] (-1243.332) (-1242.642) * (-1241.163) (-1241.829) [-1241.989] (-1243.378) -- 0:00:51 281500 -- [-1241.417] (-1242.385) (-1242.921) (-1242.612) * (-1242.143) [-1241.174] (-1242.758) (-1241.657) -- 0:00:51 282000 -- (-1245.528) (-1242.797) [-1242.716] (-1244.099) * (-1242.107) (-1241.146) [-1241.619] (-1239.505) -- 0:00:50 282500 -- [-1241.796] (-1244.442) (-1247.723) (-1242.324) * (-1242.153) (-1241.638) [-1242.322] (-1242.121) -- 0:00:50 283000 -- (-1242.159) (-1243.417) (-1243.362) [-1242.988] * (-1243.389) (-1246.155) (-1241.912) [-1240.426] -- 0:00:50 283500 -- (-1242.482) [-1241.302] (-1242.670) (-1243.577) * [-1241.890] (-1243.943) (-1243.901) (-1240.761) -- 0:00:50 284000 -- (-1242.188) (-1243.085) (-1242.983) [-1240.603] * (-1241.102) [-1241.856] (-1243.967) (-1246.791) -- 0:00:50 284500 -- (-1241.928) (-1242.014) [-1240.963] (-1242.342) * (-1240.695) [-1241.571] (-1242.365) (-1246.025) -- 0:00:50 285000 -- [-1242.571] (-1242.105) (-1241.331) (-1242.240) * (-1243.834) (-1244.950) [-1243.473] (-1241.758) -- 0:00:50 Average standard deviation of split frequencies: 0.012405 285500 -- [-1241.545] (-1241.207) (-1241.257) (-1243.041) * (-1242.353) (-1240.963) [-1241.685] (-1241.964) -- 0:00:50 286000 -- (-1243.249) (-1241.672) [-1240.141] (-1241.852) * (-1244.532) (-1242.591) (-1242.987) [-1241.861] -- 0:00:49 286500 -- [-1241.248] (-1244.493) (-1240.990) (-1238.909) * (-1243.238) (-1241.647) (-1244.820) [-1242.571] -- 0:00:49 287000 -- [-1240.802] (-1242.774) (-1241.403) (-1244.390) * (-1243.052) (-1241.722) (-1247.922) [-1241.714] -- 0:00:49 287500 -- (-1241.208) [-1244.444] (-1241.809) (-1242.259) * (-1240.586) (-1241.759) (-1242.344) [-1240.945] -- 0:00:49 288000 -- [-1243.206] (-1245.670) (-1240.759) (-1243.794) * (-1245.863) [-1241.067] (-1243.130) (-1243.154) -- 0:00:49 288500 -- (-1242.005) [-1241.347] (-1239.618) (-1243.415) * [-1240.997] (-1245.150) (-1242.949) (-1246.269) -- 0:00:49 289000 -- (-1241.274) (-1244.600) [-1240.613] (-1245.581) * (-1243.508) [-1244.861] (-1242.097) (-1240.901) -- 0:00:49 289500 -- (-1243.613) (-1243.681) [-1242.539] (-1242.032) * (-1243.282) [-1241.209] (-1243.797) (-1243.026) -- 0:00:49 290000 -- (-1241.976) (-1242.113) (-1240.040) [-1242.604] * (-1245.782) (-1241.524) [-1241.950] (-1243.029) -- 0:00:48 Average standard deviation of split frequencies: 0.012974 290500 -- (-1241.963) (-1241.962) [-1242.203] (-1243.657) * (-1244.580) [-1242.986] (-1243.485) (-1245.370) -- 0:00:48 291000 -- (-1244.002) (-1241.878) [-1241.990] (-1245.840) * [-1242.244] (-1248.009) (-1244.515) (-1242.613) -- 0:00:48 291500 -- (-1248.311) (-1242.311) (-1244.053) [-1242.373] * (-1243.036) [-1246.677] (-1241.414) (-1243.872) -- 0:00:48 292000 -- (-1242.907) [-1241.923] (-1244.672) (-1242.437) * (-1241.602) [-1246.046] (-1241.944) (-1241.488) -- 0:00:48 292500 -- (-1243.320) (-1245.579) (-1241.518) [-1244.976] * (-1245.518) (-1243.229) (-1241.352) [-1241.967] -- 0:00:48 293000 -- [-1242.246] (-1245.388) (-1242.762) (-1242.305) * (-1243.518) (-1241.938) (-1240.867) [-1244.137] -- 0:00:48 293500 -- [-1245.207] (-1247.590) (-1240.931) (-1242.501) * (-1241.898) (-1244.009) [-1242.450] (-1244.731) -- 0:00:48 294000 -- (-1243.802) (-1239.576) (-1243.303) [-1242.588] * (-1243.963) (-1242.668) (-1244.239) [-1243.661] -- 0:00:48 294500 -- (-1241.536) (-1242.077) (-1243.275) [-1240.791] * [-1243.838] (-1245.885) (-1243.235) (-1242.492) -- 0:00:47 295000 -- (-1239.161) (-1243.784) (-1240.199) [-1242.732] * (-1248.404) (-1243.823) (-1242.228) [-1246.104] -- 0:00:50 Average standard deviation of split frequencies: 0.013998 295500 -- (-1243.373) (-1242.695) (-1241.505) [-1242.665] * (-1243.919) [-1241.859] (-1241.328) (-1243.426) -- 0:00:50 296000 -- (-1241.948) (-1242.862) (-1242.015) [-1240.846] * [-1245.023] (-1246.661) (-1242.328) (-1243.226) -- 0:00:49 296500 -- (-1242.516) (-1241.363) [-1240.924] (-1237.994) * [-1240.616] (-1242.814) (-1242.902) (-1242.487) -- 0:00:49 297000 -- (-1240.429) (-1243.169) (-1244.273) [-1241.612] * [-1242.427] (-1241.613) (-1244.018) (-1241.354) -- 0:00:49 297500 -- (-1241.314) (-1243.850) (-1242.880) [-1241.484] * (-1241.285) (-1241.723) (-1241.788) [-1240.173] -- 0:00:49 298000 -- (-1242.833) (-1244.931) (-1246.180) [-1241.556] * (-1243.550) (-1242.829) (-1241.377) [-1239.300] -- 0:00:49 298500 -- (-1244.579) (-1244.919) (-1243.494) [-1240.530] * [-1241.877] (-1242.485) (-1242.156) (-1240.617) -- 0:00:49 299000 -- (-1241.119) (-1243.172) [-1241.371] (-1241.487) * (-1245.331) (-1241.786) [-1244.829] (-1243.812) -- 0:00:49 299500 -- (-1241.246) (-1242.794) (-1244.907) [-124