--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:22:49 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/ftsX/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1241.11 -1244.02
2 -1241.10 -1244.44
--------------------------------------
TOTAL -1241.10 -1244.25
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.883563 0.090213 0.339266 1.458836 0.853578 1459.78 1480.39 1.000
r(A<->C){all} 0.159357 0.018953 0.000152 0.435069 0.127730 227.42 259.16 1.000
r(A<->G){all} 0.175886 0.022400 0.000023 0.481242 0.137223 156.88 226.35 1.005
r(A<->T){all} 0.176030 0.021145 0.000009 0.463421 0.139570 214.01 270.21 1.003
r(C<->G){all} 0.148266 0.018592 0.000041 0.435925 0.106179 133.08 234.94 1.005
r(C<->T){all} 0.188184 0.024711 0.000042 0.488147 0.149998 199.79 271.48 1.000
r(G<->T){all} 0.152276 0.017988 0.000007 0.421353 0.113307 187.90 261.27 1.008
pi(A){all} 0.192414 0.000171 0.168058 0.218645 0.192280 1333.60 1417.30 1.002
pi(C){all} 0.273708 0.000221 0.244906 0.302453 0.273287 1328.43 1355.23 1.000
pi(G){all} 0.281420 0.000223 0.250556 0.308676 0.281219 1096.23 1213.99 1.000
pi(T){all} 0.252458 0.000204 0.225635 0.281342 0.252063 1187.39 1229.84 1.000
alpha{1,2} 0.396227 0.181071 0.000142 1.298777 0.246990 989.97 1100.13 1.000
alpha{3} 0.416430 0.222341 0.000114 1.389022 0.249504 1183.56 1257.68 1.000
pinvar{all} 0.996541 0.000010 0.990967 0.999935 0.997396 1215.57 1290.70 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1189.162555
Model 2: PositiveSelection -1184.240392
Model 0: one-ratio -1188.511295
Model 7: beta -1189.162831
Model 8: beta&w>1 -1184.240392
Model 0 vs 1 1.302520000000186
Model 2 vs 1 9.844326000000365
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320)
Pr(w>1) post mean +- SE for w
196 A 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320)
Pr(w>1) post mean +- SE for w
196 A 0.945 7.212 +- 2.751
Model 8 vs 7 9.844878000000335
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320)
Pr(w>1) post mean +- SE for w
196 A 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320)
Pr(w>1) post mean +- SE for w
1 V 0.520 3.906 +- 3.746
2 R 0.521 3.914 +- 3.747
3 F 0.520 3.909 +- 3.747
4 G 0.520 3.909 +- 3.747
5 F 0.521 3.915 +- 3.748
6 L 0.521 3.917 +- 3.748
7 L 0.520 3.910 +- 3.747
8 N 0.520 3.909 +- 3.747
9 E 0.520 3.912 +- 3.747
10 V 0.520 3.912 +- 3.747
11 V 0.520 3.906 +- 3.746
12 T 0.520 3.912 +- 3.747
13 G 0.520 3.909 +- 3.747
14 L 0.520 3.910 +- 3.747
15 R 0.521 3.917 +- 3.748
16 R 0.521 3.914 +- 3.747
17 N 0.521 3.915 +- 3.748
18 V 0.519 3.904 +- 3.746
19 T 0.520 3.906 +- 3.746
20 M 0.519 3.902 +- 3.745
21 T 0.520 3.906 +- 3.746
22 I 0.520 3.908 +- 3.746
23 A 0.519 3.904 +- 3.746
24 M 0.519 3.902 +- 3.745
25 I 0.519 3.902 +- 3.745
26 L 0.521 3.918 +- 3.748
27 T 0.520 3.906 +- 3.746
28 T 0.519 3.904 +- 3.746
29 A 0.519 3.904 +- 3.746
30 I 0.519 3.902 +- 3.745
31 S 0.520 3.911 +- 3.747
32 I 0.520 3.911 +- 3.747
33 G 0.520 3.909 +- 3.747
34 L 0.521 3.918 +- 3.748
35 F 0.521 3.915 +- 3.748
36 G 0.521 3.915 +- 3.748
37 G 0.520 3.909 +- 3.747
38 G 0.520 3.911 +- 3.747
39 L 0.521 3.917 +- 3.748
40 L 0.521 3.917 +- 3.748
41 V 0.520 3.906 +- 3.746
42 V 0.519 3.904 +- 3.746
43 R 0.521 3.915 +- 3.748
44 L 0.521 3.918 +- 3.748
45 A 0.519 3.902 +- 3.745
46 D 0.520 3.910 +- 3.747
47 N 0.520 3.909 +- 3.747
48 S 0.520 3.910 +- 3.747
49 R 0.521 3.920 +- 3.749
50 S 0.520 3.910 +- 3.747
51 I 0.519 3.902 +- 3.745
52 Y 0.521 3.914 +- 3.747
53 L 0.521 3.917 +- 3.748
54 D 0.521 3.916 +- 3.748
55 R 0.521 3.920 +- 3.749
56 V 0.519 3.904 +- 3.746
57 E 0.520 3.912 +- 3.747
58 T 0.521 3.917 +- 3.748
59 Q 0.521 3.919 +- 3.748
60 V 0.519 3.904 +- 3.746
61 F 0.521 3.915 +- 3.748
62 L 0.520 3.910 +- 3.747
63 T 0.519 3.904 +- 3.746
64 D 0.521 3.916 +- 3.748
65 D 0.520 3.910 +- 3.747
66 I 0.519 3.902 +- 3.745
67 S 0.520 3.910 +- 3.747
68 A 0.519 3.902 +- 3.745
69 N 0.520 3.909 +- 3.747
70 D 0.521 3.916 +- 3.748
71 L 0.521 3.917 +- 3.748
72 T 0.519 3.904 +- 3.746
73 C 0.521 3.914 +- 3.748
74 N 0.520 3.909 +- 3.747
75 T 0.521 3.917 +- 3.748
76 N 0.520 3.909 +- 3.747
77 L 0.521 3.918 +- 3.748
78 C 0.521 3.918 +- 3.748
79 K 0.520 3.911 +- 3.747
80 A 0.519 3.904 +- 3.746
81 L 0.521 3.915 +- 3.748
82 R 0.521 3.915 +- 3.748
83 G 0.521 3.918 +- 3.748
84 K 0.520 3.911 +- 3.747
85 I 0.519 3.902 +- 3.745
86 E 0.521 3.918 +- 3.748
87 A 0.520 3.911 +- 3.747
88 R 0.521 3.920 +- 3.749
89 D 0.521 3.916 +- 3.748
90 D 0.520 3.910 +- 3.747
91 V 0.519 3.904 +- 3.746
92 K 0.521 3.918 +- 3.748
93 S 0.520 3.910 +- 3.747
94 L 0.522 3.921 +- 3.749
95 R 0.521 3.915 +- 3.748
96 F 0.520 3.909 +- 3.747
97 L 0.521 3.915 +- 3.748
98 N 0.520 3.909 +- 3.747
99 R 0.521 3.917 +- 3.748
100 Q 0.521 3.919 +- 3.748
101 D 0.520 3.910 +- 3.747
102 A 0.520 3.911 +- 3.747
103 Y 0.521 3.914 +- 3.747
104 D 0.520 3.910 +- 3.747
105 D 0.520 3.910 +- 3.747
106 A 0.520 3.911 +- 3.747
107 I 0.519 3.902 +- 3.745
108 R 0.521 3.920 +- 3.749
109 K 0.521 3.918 +- 3.748
110 F 0.520 3.909 +- 3.747
111 P 0.520 3.911 +- 3.747
112 Q 0.521 3.919 +- 3.748
113 Y 0.521 3.914 +- 3.747
114 R 0.520 3.912 +- 3.747
115 D 0.521 3.916 +- 3.748
116 V 0.520 3.912 +- 3.747
117 A 0.519 3.904 +- 3.746
118 G 0.520 3.909 +- 3.747
119 K 0.520 3.911 +- 3.747
120 D 0.521 3.916 +- 3.748
121 S 0.521 3.915 +- 3.748
122 F 0.520 3.909 +- 3.747
123 P 0.520 3.909 +- 3.747
124 A 0.520 3.911 +- 3.747
125 S 0.520 3.911 +- 3.747
126 F 0.520 3.909 +- 3.747
127 I 0.519 3.902 +- 3.745
128 I 0.519 3.902 +- 3.745
129 K 0.520 3.911 +- 3.747
130 L 0.521 3.920 +- 3.749
131 A 0.520 3.911 +- 3.747
132 N 0.520 3.909 +- 3.747
133 P 0.520 3.909 +- 3.747
134 V 0.520 3.912 +- 3.747
135 Q 0.522 3.921 +- 3.749
136 H 0.521 3.914 +- 3.748
137 K 0.520 3.911 +- 3.747
138 E 0.521 3.918 +- 3.748
139 F 0.521 3.915 +- 3.748
140 D 0.520 3.910 +- 3.747
141 A 0.519 3.902 +- 3.745
142 A 0.519 3.904 +- 3.746
143 T 0.520 3.906 +- 3.746
144 Q 0.521 3.919 +- 3.748
145 G 0.520 3.909 +- 3.747
146 Q 0.521 3.919 +- 3.748
147 P 0.520 3.909 +- 3.747
148 G 0.520 3.911 +- 3.747
149 V 0.520 3.906 +- 3.746
150 L 0.521 3.915 +- 3.748
151 S 0.520 3.910 +- 3.747
152 V 0.520 3.906 +- 3.746
153 L 0.520 3.910 +- 3.747
154 N 0.521 3.915 +- 3.748
155 Q 0.521 3.919 +- 3.748
156 K 0.520 3.911 +- 3.747
157 E 0.521 3.918 +- 3.748
158 L 0.521 3.917 +- 3.748
159 I 0.519 3.902 +- 3.745
160 D 0.520 3.910 +- 3.747
161 R 0.521 3.917 +- 3.748
162 L 0.521 3.917 +- 3.748
163 F 0.520 3.909 +- 3.747
164 A 0.519 3.902 +- 3.745
165 V 0.520 3.906 +- 3.746
166 L 0.521 3.918 +- 3.748
167 D 0.520 3.910 +- 3.747
168 G 0.521 3.915 +- 3.748
169 L 0.521 3.918 +- 3.748
170 S 0.520 3.910 +- 3.747
171 D 0.520 3.910 +- 3.747
172 V 0.519 3.904 +- 3.746
173 A 0.519 3.904 +- 3.746
174 F 0.520 3.909 +- 3.747
175 V 0.519 3.904 +- 3.746
176 I 0.520 3.908 +- 3.746
177 A 0.520 3.911 +- 3.747
178 L 0.522 3.921 +- 3.749
179 V 0.520 3.906 +- 3.746
180 Q 0.521 3.919 +- 3.748
181 A 0.520 3.911 +- 3.747
182 I 0.519 3.902 +- 3.745
183 G 0.521 3.918 +- 3.748
184 A 0.521 3.916 +- 3.748
185 I 0.519 3.902 +- 3.745
186 L 0.521 3.917 +- 3.748
187 L 0.521 3.920 +- 3.749
188 I 0.520 3.911 +- 3.747
189 A 0.519 3.902 +- 3.745
190 N 0.521 3.915 +- 3.748
191 M 0.519 3.902 +- 3.745
192 V 0.520 3.912 +- 3.747
193 Q 0.522 3.921 +- 3.749
194 V 0.519 3.904 +- 3.746
195 A 0.519 3.904 +- 3.746
196 A 0.980* 7.193 +- 2.575
197 Y 0.521 3.917 +- 3.748
198 T 0.520 3.906 +- 3.746
199 R 0.521 3.915 +- 3.748
200 R 0.521 3.914 +- 3.747
201 T 0.519 3.904 +- 3.746
202 E 0.520 3.912 +- 3.747
203 I 0.519 3.902 +- 3.745
204 G 0.520 3.909 +- 3.747
205 I 0.519 3.902 +- 3.745
206 M 0.519 3.902 +- 3.745
207 R 0.521 3.920 +- 3.749
208 L 0.521 3.917 +- 3.748
209 V 0.519 3.904 +- 3.746
210 G 0.520 3.909 +- 3.747
211 A 0.519 3.902 +- 3.745
212 S 0.520 3.910 +- 3.747
213 R 0.521 3.914 +- 3.747
214 W 0.521 3.919 +- 3.748
215 Y 0.521 3.917 +- 3.748
216 T 0.520 3.912 +- 3.747
217 Q 0.522 3.921 +- 3.749
218 L 0.521 3.915 +- 3.748
219 P 0.521 3.915 +- 3.748
220 F 0.521 3.915 +- 3.748
221 L 0.521 3.918 +- 3.748
222 L 0.521 3.917 +- 3.748
223 E 0.520 3.912 +- 3.747
224 A 0.521 3.916 +- 3.748
225 M 0.519 3.902 +- 3.745
226 V 0.520 3.906 +- 3.746
227 A 0.520 3.911 +- 3.747
228 A 0.519 3.904 +- 3.746
229 T 0.519 3.904 +- 3.746
230 V 0.521 3.917 +- 3.748
231 G 0.520 3.909 +- 3.747
232 A 0.519 3.902 +- 3.745
233 V 0.519 3.904 +- 3.746
234 I 0.519 3.902 +- 3.745
235 A 0.519 3.904 +- 3.746
236 I 0.519 3.902 +- 3.745
237 V 0.520 3.912 +- 3.747
238 G 0.521 3.915 +- 3.748
239 L 0.521 3.917 +- 3.748
240 L 0.521 3.915 +- 3.748
241 V 0.520 3.906 +- 3.746
242 A 0.519 3.904 +- 3.746
243 R 0.521 3.920 +- 3.749
244 A 0.521 3.916 +- 3.748
245 M 0.519 3.902 +- 3.745
246 F 0.521 3.915 +- 3.748
247 L 0.521 3.918 +- 3.748
248 N 0.520 3.909 +- 3.747
249 N 0.521 3.915 +- 3.748
250 A 0.521 3.916 +- 3.748
251 L 0.521 3.917 +- 3.748
252 N 0.520 3.909 +- 3.747
253 Q 0.521 3.919 +- 3.748
254 F 0.520 3.909 +- 3.747
255 Y 0.521 3.917 +- 3.748
256 Q 0.522 3.921 +- 3.749
257 A 0.520 3.911 +- 3.747
258 N 0.521 3.915 +- 3.748
259 L 0.521 3.917 +- 3.748
260 I 0.520 3.911 +- 3.747
261 A 0.519 3.902 +- 3.745
262 R 0.521 3.915 +- 3.748
263 V 0.519 3.904 +- 3.746
264 D 0.521 3.916 +- 3.748
265 Y 0.521 3.917 +- 3.748
266 A 0.519 3.902 +- 3.745
267 D 0.521 3.916 +- 3.748
268 V 0.519 3.904 +- 3.746
269 L 0.521 3.917 +- 3.748
270 Y 0.521 3.914 +- 3.747
271 V 0.520 3.912 +- 3.747
272 S 0.520 3.910 +- 3.747
273 P 0.520 3.911 +- 3.747
274 W 0.521 3.919 +- 3.748
275 L 0.521 3.918 +- 3.748
276 L 0.521 3.918 +- 3.748
277 L 0.521 3.918 +- 3.748
278 L 0.520 3.910 +- 3.747
279 G 0.520 3.909 +- 3.747
280 V 0.520 3.906 +- 3.746
281 A 0.519 3.904 +- 3.746
282 L 0.521 3.918 +- 3.748
283 A 0.519 3.902 +- 3.745
284 A 0.519 3.904 +- 3.746
285 L 0.521 3.918 +- 3.748
286 T 0.519 3.904 +- 3.746
287 G 0.521 3.915 +- 3.748
288 Y 0.521 3.914 +- 3.747
289 A 0.521 3.916 +- 3.748
290 T 0.521 3.917 +- 3.748
291 L 0.521 3.918 +- 3.748
292 R 0.521 3.914 +- 3.747
293 I 0.520 3.911 +- 3.747
294 Y 0.521 3.914 +- 3.747
295 V 0.520 3.906 +- 3.746
296 R 0.521 3.920 +- 3.749
297 R 0.521 3.915 +- 3.748
>C1
VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
>C2
VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
>C3
VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR
TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
>C4
VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR
TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
>C5
VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
>C6
VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=297
C1 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
C2 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
C3 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
C4 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
C5 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
C6 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
**************************************************
C1 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
C2 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
C3 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
C4 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
C5 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
C6 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
**************************************************
C1 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
C2 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
C3 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
C4 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
C5 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
C6 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
**************************************************
C1 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
C2 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
C3 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR
C4 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR
C5 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
C6 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
*********************************************.****
C1 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
C2 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
C3 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
C4 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
C5 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
C6 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
**************************************************
C1 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
C2 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
C3 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
C4 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
C5 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
C6 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
***********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8910]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8910]--->[8910]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.496 Mb, Max= 30.848 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
C2 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
C3 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
C4 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
C5 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
C6 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
**************************************************
C1 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
C2 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
C3 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
C4 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
C5 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
C6 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
**************************************************
C1 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
C2 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
C3 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
C4 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
C5 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
C6 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
**************************************************
C1 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
C2 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
C3 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR
C4 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR
C5 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
C6 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
*********************************************.****
C1 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
C2 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
C3 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
C4 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
C5 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
C6 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
**************************************************
C1 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
C2 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
C3 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
C4 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
C5 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
C6 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
***********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 99.66 C1 C3 99.66
TOP 2 0 99.66 C3 C1 99.66
BOT 0 3 99.66 C1 C4 99.66
TOP 3 0 99.66 C4 C1 99.66
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 99.66 C2 C3 99.66
TOP 2 1 99.66 C3 C2 99.66
BOT 1 3 99.66 C2 C4 99.66
TOP 3 1 99.66 C4 C2 99.66
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 99.66 C3 C5 99.66
TOP 4 2 99.66 C5 C3 99.66
BOT 2 5 99.66 C3 C6 99.66
TOP 5 2 99.66 C6 C3 99.66
BOT 3 4 99.66 C4 C5 99.66
TOP 4 3 99.66 C5 C4 99.66
BOT 3 5 99.66 C4 C6 99.66
TOP 5 3 99.66 C6 C4 99.66
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 99.87
AVG 1 C2 * 99.87
AVG 2 C3 * 99.73
AVG 3 C4 * 99.73
AVG 4 C5 * 99.87
AVG 5 C6 * 99.87
TOT TOT * 99.82
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA
C2 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA
C3 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA
C4 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA
C5 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA
C6 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA
**************************************************
C1 TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT
C2 TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT
C3 TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT
C4 TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT
C5 TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT
C6 TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT
**************************************************
C1 TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC
C2 TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC
C3 TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC
C4 TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC
C5 TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC
C6 TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC
**************************************************
C1 ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC
C2 ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC
C3 ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC
C4 ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC
C5 ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC
C6 ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC
**************************************************
C1 CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA
C2 CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA
C3 CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA
C4 CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA
C5 CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA
C6 CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA
**************************************************
C1 AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG
C2 AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG
C3 AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG
C4 AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG
C5 AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG
C6 AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG
**************************************************
C1 GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC
C2 GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC
C3 GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC
C4 GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC
C5 GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC
C6 GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC
**************************************************
C1 GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG
C2 GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG
C3 GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG
C4 GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG
C5 GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG
C6 GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG
**************************************************
C1 TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT
C2 TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT
C3 TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT
C4 TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT
C5 TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT
C6 TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT
**************************************************
C1 TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA
C2 TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA
C3 TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA
C4 TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA
C5 TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA
C6 TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA
**************************************************
C1 CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG
C2 CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG
C3 CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG
C4 CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG
C5 CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG
C6 CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG
**************************************************
C1 CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC
C2 CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC
C3 CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGTCTATACGCGGCGC
C4 CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGTCTATACGCGGCGC
C5 CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC
C6 CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC
************************************ *************
C1 ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA
C2 ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA
C3 ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA
C4 ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA
C5 ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA
C6 ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA
**************************************************
C1 ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA
C2 ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA
C3 ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA
C4 ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA
C5 ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA
C6 ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA
**************************************************
C1 TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA
C2 TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA
C3 TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA
C4 TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA
C5 TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA
C6 TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA
**************************************************
C1 CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA
C2 CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA
C3 CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA
C4 CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA
C5 CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA
C6 CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA
**************************************************
C1 TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG
C2 TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG
C3 TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG
C4 TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG
C5 TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG
C6 TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG
**************************************************
C1 CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG
C2 CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG
C3 CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG
C4 CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG
C5 CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG
C6 CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG
*****************************************
>C1
GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA
TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT
TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC
ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC
CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA
AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG
GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC
GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG
TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT
TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA
CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG
CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC
ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA
ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA
TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA
CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA
TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG
CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG
>C2
GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA
TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT
TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC
ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC
CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA
AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG
GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC
GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG
TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT
TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA
CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG
CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC
ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA
ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA
TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA
CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA
TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG
CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG
>C3
GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA
TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT
TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC
ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC
CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA
AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG
GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC
GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG
TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT
TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA
CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG
CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGTCTATACGCGGCGC
ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA
ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA
TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA
CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA
TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG
CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG
>C4
GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA
TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT
TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC
ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC
CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA
AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG
GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC
GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG
TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT
TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA
CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG
CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGTCTATACGCGGCGC
ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA
ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA
TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA
CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA
TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG
CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG
>C5
GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA
TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT
TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC
ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC
CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA
AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG
GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC
GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG
TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT
TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA
CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG
CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC
ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA
ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA
TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA
CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA
TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG
CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG
>C6
GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA
TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT
TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC
ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC
CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA
AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG
GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC
GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG
TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT
TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA
CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG
CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC
ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA
ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA
TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA
CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA
TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG
CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG
>C1
VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
>C2
VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
>C3
VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR
TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
>C4
VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR
TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
>C5
VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
>C6
VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 891 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789270
Setting output file names to "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1690982660
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0330019407
Seed = 600877443
Swapseed = 1579789270
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2000.807779 -- -24.965149
Chain 2 -- -2000.772505 -- -24.965149
Chain 3 -- -1997.467880 -- -24.965149
Chain 4 -- -2000.772505 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2000.134247 -- -24.965149
Chain 2 -- -1997.467880 -- -24.965149
Chain 3 -- -2000.134247 -- -24.965149
Chain 4 -- -2000.134247 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2000.808] (-2000.773) (-1997.468) (-2000.773) * [-2000.134] (-1997.468) (-2000.134) (-2000.134)
500 -- (-1251.128) (-1250.996) (-1248.897) [-1247.500] * (-1260.019) [-1242.071] (-1257.920) (-1256.979) -- 0:33:19
1000 -- (-1245.565) (-1243.656) [-1247.426] (-1244.713) * (-1245.912) [-1242.516] (-1245.133) (-1246.560) -- 0:16:39
1500 -- (-1246.291) [-1242.885] (-1243.425) (-1245.274) * (-1247.515) (-1250.270) (-1246.858) [-1243.483] -- 0:11:05
2000 -- (-1246.754) [-1247.818] (-1249.448) (-1248.276) * (-1243.783) [-1244.462] (-1255.256) (-1240.419) -- 0:08:19
2500 -- (-1245.300) (-1248.256) [-1248.126] (-1247.698) * (-1244.550) [-1244.196] (-1245.931) (-1241.600) -- 0:06:39
3000 -- (-1242.035) (-1245.569) [-1255.468] (-1245.323) * [-1246.444] (-1246.796) (-1251.490) (-1245.160) -- 0:05:32
3500 -- (-1253.376) (-1247.417) (-1253.595) [-1244.724] * (-1254.587) [-1249.895] (-1250.886) (-1248.917) -- 0:04:44
4000 -- (-1247.841) (-1251.432) [-1243.582] (-1242.028) * (-1248.060) (-1247.882) [-1249.982] (-1243.680) -- 0:04:09
4500 -- [-1246.702] (-1248.269) (-1247.047) (-1245.944) * (-1240.956) (-1251.583) (-1249.419) [-1246.866] -- 0:03:41
5000 -- (-1248.597) (-1243.282) (-1244.684) [-1245.270] * (-1250.772) (-1241.782) (-1246.887) [-1243.174] -- 0:03:19
Average standard deviation of split frequencies: 0.071425
5500 -- [-1249.355] (-1242.132) (-1244.592) (-1248.273) * (-1243.050) (-1248.054) (-1239.884) [-1247.603] -- 0:03:00
6000 -- (-1256.631) (-1242.008) [-1243.224] (-1246.867) * (-1243.281) [-1240.396] (-1242.878) (-1244.645) -- 0:02:45
6500 -- (-1253.129) (-1248.351) (-1246.901) [-1247.463] * (-1250.394) (-1247.058) [-1242.929] (-1245.075) -- 0:02:32
7000 -- [-1240.061] (-1243.347) (-1243.489) (-1247.637) * [-1242.934] (-1255.821) (-1247.044) (-1245.602) -- 0:02:21
7500 -- (-1241.690) (-1248.486) (-1245.489) [-1243.729] * (-1243.312) (-1245.520) [-1244.070] (-1246.707) -- 0:02:12
8000 -- (-1262.656) (-1248.791) [-1245.678] (-1246.935) * (-1253.895) (-1250.709) [-1248.586] (-1247.602) -- 0:02:04
8500 -- (-1244.031) [-1247.817] (-1249.938) (-1246.092) * (-1252.039) (-1258.464) (-1242.886) [-1248.977] -- 0:01:56
9000 -- (-1244.981) (-1245.214) (-1250.017) [-1245.332] * [-1245.927] (-1242.040) (-1250.954) (-1243.343) -- 0:01:50
9500 -- (-1243.832) (-1241.642) (-1249.434) [-1243.075] * (-1241.677) [-1238.362] (-1248.619) (-1253.072) -- 0:01:44
10000 -- (-1240.160) [-1241.382] (-1249.458) (-1247.790) * (-1248.205) (-1240.017) (-1246.227) [-1242.775] -- 0:01:39
Average standard deviation of split frequencies: 0.068300
10500 -- (-1252.221) (-1252.881) (-1244.735) [-1244.538] * [-1246.912] (-1248.275) (-1247.067) (-1255.505) -- 0:01:34
11000 -- (-1244.823) (-1244.100) (-1247.485) [-1245.692] * [-1245.620] (-1240.151) (-1261.494) (-1247.595) -- 0:01:29
11500 -- (-1246.724) [-1245.679] (-1244.853) (-1249.186) * (-1240.829) (-1241.892) [-1245.489] (-1243.242) -- 0:01:25
12000 -- (-1244.788) [-1241.952] (-1253.019) (-1243.796) * (-1250.522) (-1241.399) [-1245.358] (-1241.980) -- 0:01:22
12500 -- (-1245.883) [-1253.440] (-1246.652) (-1250.223) * (-1240.343) (-1241.204) [-1244.872] (-1246.720) -- 0:01:19
13000 -- (-1244.371) [-1243.492] (-1253.039) (-1247.660) * (-1243.876) (-1241.471) (-1244.327) [-1254.008] -- 0:02:31
13500 -- [-1249.598] (-1240.232) (-1250.497) (-1245.532) * (-1240.380) (-1242.375) (-1254.807) [-1242.442] -- 0:02:26
14000 -- [-1243.585] (-1246.279) (-1247.470) (-1247.387) * (-1241.428) (-1243.566) (-1252.088) [-1243.490] -- 0:02:20
14500 -- (-1248.215) (-1249.846) [-1252.429] (-1242.741) * (-1242.830) [-1246.355] (-1252.318) (-1240.506) -- 0:02:15
15000 -- (-1247.484) (-1242.631) [-1245.838] (-1248.391) * (-1241.591) [-1241.690] (-1255.515) (-1242.953) -- 0:02:11
Average standard deviation of split frequencies: 0.029463
15500 -- (-1246.473) (-1244.034) [-1245.586] (-1248.950) * [-1241.999] (-1242.318) (-1243.440) (-1243.190) -- 0:02:07
16000 -- (-1250.390) (-1251.475) (-1249.459) [-1245.098] * (-1241.581) (-1243.140) (-1241.269) [-1240.533] -- 0:02:03
16500 -- (-1246.944) (-1242.977) (-1249.538) [-1245.389] * [-1242.426] (-1245.789) (-1242.155) (-1243.297) -- 0:01:59
17000 -- [-1245.732] (-1244.606) (-1245.147) (-1252.591) * (-1239.931) (-1245.207) [-1244.704] (-1241.149) -- 0:01:55
17500 -- (-1242.439) (-1247.433) (-1255.838) [-1242.766] * [-1242.294] (-1243.509) (-1242.689) (-1244.638) -- 0:01:52
18000 -- (-1241.176) (-1240.031) (-1243.430) [-1242.529] * [-1241.831] (-1241.868) (-1241.932) (-1242.438) -- 0:01:49
18500 -- (-1241.453) [-1243.686] (-1245.655) (-1252.489) * [-1242.998] (-1242.823) (-1242.329) (-1241.247) -- 0:01:46
19000 -- (-1243.707) [-1243.033] (-1246.161) (-1243.747) * [-1245.077] (-1241.687) (-1242.925) (-1242.046) -- 0:01:43
19500 -- (-1241.131) (-1246.599) (-1244.502) [-1245.682] * [-1243.052] (-1244.630) (-1242.286) (-1242.933) -- 0:01:40
20000 -- [-1239.613] (-1243.203) (-1244.795) (-1248.767) * (-1246.877) (-1242.245) [-1244.021] (-1242.650) -- 0:01:38
Average standard deviation of split frequencies: 0.060826
20500 -- (-1242.034) (-1250.708) [-1242.270] (-1249.082) * (-1241.807) (-1241.004) (-1241.173) [-1240.425] -- 0:01:35
21000 -- (-1243.541) (-1246.264) [-1241.280] (-1244.843) * (-1242.541) [-1241.876] (-1244.357) (-1241.938) -- 0:01:33
21500 -- (-1243.059) [-1242.535] (-1248.224) (-1249.945) * [-1242.023] (-1244.956) (-1240.551) (-1241.080) -- 0:01:31
22000 -- (-1241.566) (-1246.568) (-1249.588) [-1251.891] * [-1239.806] (-1244.715) (-1240.678) (-1244.185) -- 0:01:28
22500 -- (-1248.347) (-1242.761) [-1253.542] (-1251.802) * [-1239.923] (-1241.173) (-1240.424) (-1241.053) -- 0:01:26
23000 -- (-1241.539) [-1243.900] (-1246.755) (-1249.796) * (-1245.364) (-1244.702) [-1241.337] (-1242.098) -- 0:01:24
23500 -- [-1240.974] (-1243.884) (-1245.317) (-1259.319) * (-1244.429) (-1242.411) (-1242.998) [-1244.150] -- 0:01:23
24000 -- [-1242.099] (-1246.501) (-1246.855) (-1274.125) * (-1240.595) [-1241.153] (-1240.786) (-1248.026) -- 0:01:21
24500 -- (-1243.644) (-1248.583) [-1248.227] (-1241.021) * [-1241.893] (-1241.203) (-1241.727) (-1245.660) -- 0:01:19
25000 -- (-1240.978) (-1246.650) [-1242.256] (-1240.947) * (-1243.892) [-1243.822] (-1242.592) (-1241.181) -- 0:01:18
Average standard deviation of split frequencies: 0.058577
25500 -- (-1242.142) [-1242.120] (-1245.021) (-1241.565) * (-1241.326) (-1245.417) [-1242.494] (-1241.198) -- 0:01:16
26000 -- (-1246.180) [-1243.937] (-1248.363) (-1245.099) * (-1249.048) (-1239.149) [-1240.086] (-1243.381) -- 0:01:14
26500 -- (-1240.130) (-1249.753) [-1243.909] (-1242.773) * [-1242.976] (-1240.483) (-1241.250) (-1243.260) -- 0:01:13
27000 -- [-1244.896] (-1247.997) (-1241.777) (-1241.472) * (-1243.044) [-1241.076] (-1246.949) (-1244.047) -- 0:01:12
27500 -- (-1241.278) [-1240.359] (-1249.310) (-1242.072) * (-1242.165) [-1241.125] (-1244.521) (-1241.358) -- 0:01:46
28000 -- [-1241.823] (-1252.564) (-1242.720) (-1242.371) * (-1243.913) (-1243.064) (-1244.519) [-1242.056] -- 0:01:44
28500 -- [-1242.602] (-1246.410) (-1249.949) (-1243.817) * (-1241.327) (-1243.447) (-1240.628) [-1242.879] -- 0:01:42
29000 -- [-1243.809] (-1253.924) (-1246.054) (-1242.983) * (-1243.432) (-1242.724) (-1242.199) [-1242.894] -- 0:01:40
29500 -- (-1245.825) [-1251.096] (-1241.476) (-1242.363) * (-1242.977) (-1240.027) (-1240.430) [-1242.063] -- 0:01:38
30000 -- (-1244.852) [-1242.646] (-1248.129) (-1244.675) * [-1243.888] (-1240.824) (-1239.929) (-1245.908) -- 0:01:37
Average standard deviation of split frequencies: 0.059438
30500 -- (-1241.537) (-1245.242) [-1245.163] (-1241.287) * [-1242.890] (-1241.584) (-1244.253) (-1247.988) -- 0:01:35
31000 -- (-1243.338) [-1246.483] (-1246.680) (-1240.340) * (-1243.683) (-1247.550) (-1241.053) [-1239.257] -- 0:01:33
31500 -- (-1242.545) [-1246.883] (-1251.644) (-1243.032) * (-1244.960) (-1242.659) (-1243.238) [-1241.403] -- 0:01:32
32000 -- (-1241.705) [-1240.950] (-1248.441) (-1243.188) * [-1241.868] (-1243.887) (-1241.474) (-1243.736) -- 0:01:30
32500 -- (-1241.813) [-1244.871] (-1246.185) (-1239.050) * [-1240.970] (-1241.793) (-1245.346) (-1245.000) -- 0:01:29
33000 -- (-1242.946) [-1244.449] (-1247.659) (-1241.943) * (-1245.992) (-1241.902) (-1246.151) [-1247.077] -- 0:01:27
33500 -- (-1241.845) [-1248.182] (-1241.979) (-1241.523) * (-1244.814) (-1247.428) [-1245.967] (-1243.614) -- 0:01:26
34000 -- (-1241.723) (-1245.458) (-1251.482) [-1241.951] * (-1243.338) (-1241.604) (-1241.046) [-1245.384] -- 0:01:25
34500 -- (-1240.985) (-1247.515) [-1246.447] (-1241.452) * [-1243.742] (-1245.697) (-1242.793) (-1245.453) -- 0:01:23
35000 -- [-1243.758] (-1250.165) (-1246.964) (-1241.637) * (-1244.038) [-1243.630] (-1247.306) (-1244.891) -- 0:01:22
Average standard deviation of split frequencies: 0.071085
35500 -- (-1245.024) (-1246.625) (-1242.340) [-1242.341] * (-1244.074) (-1244.808) [-1243.836] (-1243.142) -- 0:01:21
36000 -- (-1243.108) (-1251.556) (-1251.202) [-1244.302] * (-1239.705) (-1247.048) [-1242.093] (-1243.130) -- 0:01:20
36500 -- [-1243.625] (-1245.839) (-1243.808) (-1241.925) * [-1242.889] (-1244.371) (-1240.098) (-1246.831) -- 0:01:19
37000 -- (-1242.316) (-1245.692) [-1245.288] (-1241.553) * (-1242.398) [-1244.153] (-1240.936) (-1247.541) -- 0:01:18
37500 -- (-1241.696) [-1249.437] (-1242.689) (-1248.315) * (-1248.732) (-1246.797) [-1242.411] (-1245.167) -- 0:01:17
38000 -- (-1242.110) [-1248.958] (-1248.112) (-1246.946) * (-1246.278) (-1250.420) (-1240.547) [-1242.859] -- 0:01:15
38500 -- (-1244.869) (-1244.995) [-1245.758] (-1244.220) * (-1247.530) (-1243.409) (-1240.780) [-1243.209] -- 0:01:14
39000 -- [-1243.387] (-1245.901) (-1244.576) (-1242.462) * [-1245.416] (-1241.965) (-1241.665) (-1240.804) -- 0:01:13
39500 -- (-1243.452) (-1242.700) [-1247.597] (-1244.314) * [-1242.854] (-1241.618) (-1241.859) (-1241.440) -- 0:01:12
40000 -- [-1242.871] (-1251.969) (-1244.156) (-1242.814) * (-1242.252) (-1241.835) [-1242.662] (-1246.482) -- 0:01:12
Average standard deviation of split frequencies: 0.073415
40500 -- (-1241.327) (-1248.861) [-1246.129] (-1242.681) * (-1243.223) [-1242.576] (-1241.965) (-1244.077) -- 0:01:11
41000 -- (-1241.773) (-1254.302) [-1242.674] (-1243.907) * (-1244.571) [-1242.327] (-1246.245) (-1240.519) -- 0:01:10
41500 -- (-1241.628) (-1251.173) [-1246.436] (-1244.037) * (-1241.309) (-1243.851) [-1243.155] (-1241.839) -- 0:01:32
42000 -- (-1243.481) (-1249.545) [-1244.697] (-1244.109) * (-1241.910) [-1241.502] (-1242.637) (-1244.487) -- 0:01:31
42500 -- (-1241.184) (-1244.821) [-1240.966] (-1249.255) * (-1242.337) [-1244.861] (-1248.167) (-1243.016) -- 0:01:30
43000 -- (-1243.904) [-1248.553] (-1241.483) (-1246.966) * (-1241.248) (-1246.634) [-1244.944] (-1246.509) -- 0:01:29
43500 -- [-1240.422] (-1243.721) (-1243.909) (-1243.764) * [-1242.618] (-1245.941) (-1242.012) (-1244.756) -- 0:01:27
44000 -- (-1240.652) (-1245.396) [-1241.754] (-1243.145) * [-1241.141] (-1245.862) (-1241.577) (-1241.726) -- 0:01:26
44500 -- (-1244.566) [-1246.491] (-1258.253) (-1243.173) * (-1241.876) (-1245.974) [-1244.884] (-1244.756) -- 0:01:25
45000 -- (-1243.064) (-1246.974) (-1244.363) [-1243.681] * (-1240.635) [-1242.991] (-1241.481) (-1245.106) -- 0:01:24
Average standard deviation of split frequencies: 0.073354
45500 -- (-1245.160) (-1246.892) [-1254.230] (-1243.330) * (-1245.228) (-1245.365) (-1245.705) [-1240.470] -- 0:01:23
46000 -- (-1241.749) (-1245.523) [-1243.567] (-1244.216) * (-1241.315) (-1241.997) [-1242.091] (-1241.802) -- 0:01:22
46500 -- (-1239.736) (-1249.657) (-1242.138) [-1241.660] * (-1241.035) (-1242.298) (-1243.730) [-1243.060] -- 0:01:22
47000 -- (-1242.476) [-1240.368] (-1242.937) (-1244.400) * (-1240.576) (-1242.229) (-1242.732) [-1240.574] -- 0:01:21
47500 -- (-1246.340) [-1247.388] (-1243.777) (-1243.356) * [-1240.190] (-1245.706) (-1242.499) (-1243.717) -- 0:01:20
48000 -- (-1241.315) (-1240.940) (-1245.178) [-1242.272] * (-1240.704) (-1242.530) [-1243.692] (-1243.221) -- 0:01:19
48500 -- [-1243.402] (-1243.284) (-1242.958) (-1241.341) * (-1243.237) (-1242.163) (-1245.397) [-1240.590] -- 0:01:18
49000 -- (-1241.603) [-1253.188] (-1243.356) (-1242.481) * [-1240.985] (-1242.566) (-1251.773) (-1243.540) -- 0:01:17
49500 -- (-1241.790) (-1248.477) [-1243.499] (-1243.654) * (-1240.480) [-1241.027] (-1243.092) (-1240.975) -- 0:01:16
50000 -- [-1244.957] (-1248.936) (-1239.998) (-1244.822) * [-1243.045] (-1243.068) (-1247.424) (-1246.235) -- 0:01:16
Average standard deviation of split frequencies: 0.070814
50500 -- (-1241.576) (-1243.605) [-1241.278] (-1247.226) * (-1241.761) (-1241.899) (-1245.268) [-1241.371] -- 0:01:15
51000 -- (-1243.706) (-1240.746) [-1240.791] (-1242.820) * [-1241.957] (-1241.145) (-1245.383) (-1243.653) -- 0:01:14
51500 -- (-1241.753) (-1248.986) [-1243.029] (-1242.199) * (-1241.731) (-1242.264) (-1241.532) [-1242.867] -- 0:01:13
52000 -- (-1241.941) (-1252.017) [-1241.733] (-1242.414) * (-1240.751) (-1244.087) [-1241.517] (-1241.835) -- 0:01:12
52500 -- (-1240.817) [-1243.306] (-1246.366) (-1246.160) * (-1239.312) (-1245.374) [-1240.781] (-1240.774) -- 0:01:12
53000 -- (-1241.563) [-1247.349] (-1242.142) (-1245.010) * (-1242.133) (-1244.329) (-1240.552) [-1242.132] -- 0:01:11
53500 -- (-1241.601) [-1250.382] (-1242.771) (-1242.173) * (-1243.582) (-1241.936) (-1239.553) [-1242.243] -- 0:01:10
54000 -- (-1241.327) (-1253.409) (-1242.129) [-1241.744] * [-1241.482] (-1241.296) (-1242.442) (-1242.252) -- 0:01:10
54500 -- (-1241.611) [-1254.020] (-1243.562) (-1241.775) * (-1243.024) [-1243.015] (-1244.257) (-1240.997) -- 0:01:09
55000 -- (-1242.732) (-1250.309) (-1242.336) [-1241.718] * (-1241.977) [-1243.868] (-1241.168) (-1242.479) -- 0:01:25
Average standard deviation of split frequencies: 0.072605
55500 -- [-1242.099] (-1245.734) (-1242.998) (-1247.722) * (-1245.404) (-1244.355) (-1240.743) [-1241.573] -- 0:01:25
56000 -- (-1243.718) [-1243.953] (-1242.877) (-1244.255) * (-1240.151) (-1242.765) [-1241.311] (-1242.977) -- 0:01:24
56500 -- (-1240.848) [-1242.969] (-1242.225) (-1243.885) * [-1240.463] (-1241.834) (-1246.329) (-1244.713) -- 0:01:23
57000 -- (-1242.743) (-1245.438) [-1241.673] (-1243.745) * (-1240.543) [-1240.987] (-1244.722) (-1242.217) -- 0:01:22
57500 -- (-1241.190) [-1244.064] (-1242.326) (-1243.061) * (-1239.954) (-1240.923) (-1242.191) [-1242.461] -- 0:01:21
58000 -- (-1240.827) (-1250.084) [-1241.035] (-1243.637) * (-1240.948) [-1242.572] (-1244.733) (-1239.447) -- 0:01:21
58500 -- (-1240.707) [-1241.823] (-1239.495) (-1241.744) * (-1241.706) [-1241.769] (-1243.848) (-1239.805) -- 0:01:20
59000 -- (-1240.749) [-1242.148] (-1239.914) (-1241.683) * [-1241.884] (-1240.934) (-1241.367) (-1241.794) -- 0:01:19
59500 -- (-1244.745) (-1244.758) (-1242.193) [-1240.419] * [-1241.162] (-1241.381) (-1241.965) (-1244.452) -- 0:01:19
60000 -- [-1242.469] (-1244.174) (-1240.158) (-1241.073) * [-1241.084] (-1244.867) (-1241.764) (-1245.760) -- 0:01:18
Average standard deviation of split frequencies: 0.069934
60500 -- (-1243.181) [-1240.992] (-1240.320) (-1243.109) * (-1240.726) (-1241.477) (-1240.929) [-1241.381] -- 0:01:17
61000 -- [-1243.165] (-1245.984) (-1241.101) (-1242.827) * [-1241.527] (-1242.358) (-1241.784) (-1241.389) -- 0:01:16
61500 -- (-1244.471) (-1241.887) [-1238.297] (-1241.714) * (-1240.389) [-1242.474] (-1242.134) (-1243.242) -- 0:01:16
62000 -- (-1243.958) (-1245.670) [-1243.578] (-1243.496) * (-1241.916) [-1244.605] (-1243.493) (-1240.324) -- 0:01:15
62500 -- (-1242.417) [-1241.291] (-1245.944) (-1243.414) * (-1240.888) [-1241.563] (-1243.756) (-1241.073) -- 0:01:15
63000 -- (-1243.875) (-1242.441) (-1241.459) [-1242.268] * [-1240.932] (-1240.810) (-1244.776) (-1242.075) -- 0:01:14
63500 -- [-1242.957] (-1241.167) (-1240.287) (-1241.017) * [-1240.822] (-1240.237) (-1243.183) (-1246.408) -- 0:01:13
64000 -- (-1241.216) (-1244.399) [-1240.191] (-1241.112) * [-1241.380] (-1241.706) (-1243.205) (-1243.044) -- 0:01:13
64500 -- (-1242.486) (-1241.135) [-1240.516] (-1241.169) * (-1242.213) (-1242.802) (-1240.566) [-1242.800] -- 0:01:12
65000 -- (-1245.493) [-1241.486] (-1241.649) (-1240.773) * (-1243.548) [-1243.077] (-1241.665) (-1242.799) -- 0:01:11
Average standard deviation of split frequencies: 0.061902
65500 -- [-1242.193] (-1242.350) (-1239.537) (-1241.544) * (-1241.555) [-1240.957] (-1244.718) (-1246.844) -- 0:01:11
66000 -- (-1244.231) (-1241.345) (-1244.771) [-1245.026] * (-1238.236) (-1244.403) (-1243.042) [-1244.377] -- 0:01:10
66500 -- (-1243.404) (-1249.574) (-1242.774) [-1244.611] * (-1247.768) (-1246.418) [-1243.613] (-1241.947) -- 0:01:10
67000 -- (-1242.068) (-1242.109) [-1239.817] (-1241.863) * (-1247.893) (-1240.673) (-1243.212) [-1242.374] -- 0:01:09
67500 -- (-1245.372) (-1242.895) [-1240.157] (-1241.288) * (-1241.027) (-1240.827) [-1242.109] (-1242.782) -- 0:01:09
68000 -- (-1243.341) (-1242.699) [-1242.370] (-1242.929) * [-1242.469] (-1240.951) (-1241.209) (-1241.674) -- 0:01:08
68500 -- (-1240.707) (-1242.719) (-1241.103) [-1241.601] * (-1244.671) (-1241.450) [-1244.364] (-1242.370) -- 0:01:07
69000 -- [-1241.203] (-1243.610) (-1243.142) (-1242.883) * (-1242.287) [-1242.381] (-1242.303) (-1244.849) -- 0:01:07
69500 -- (-1241.939) (-1242.036) [-1244.944] (-1243.234) * (-1242.042) [-1247.055] (-1242.242) (-1239.937) -- 0:01:20
70000 -- [-1241.403] (-1241.744) (-1243.509) (-1249.247) * (-1242.210) (-1245.376) (-1242.931) [-1242.786] -- 0:01:19
Average standard deviation of split frequencies: 0.062632
70500 -- [-1243.731] (-1242.074) (-1243.300) (-1244.168) * (-1243.907) (-1243.139) (-1242.619) [-1244.014] -- 0:01:19
71000 -- (-1244.618) [-1239.419] (-1246.105) (-1242.505) * (-1243.826) [-1239.792] (-1245.215) (-1246.345) -- 0:01:18
71500 -- (-1241.879) (-1242.280) [-1246.348] (-1242.453) * [-1244.351] (-1241.005) (-1244.725) (-1241.476) -- 0:01:17
72000 -- (-1242.172) (-1241.979) [-1242.094] (-1242.266) * (-1239.580) [-1242.094] (-1243.101) (-1240.371) -- 0:01:17
72500 -- (-1243.379) [-1242.578] (-1244.173) (-1240.740) * (-1241.381) (-1242.353) [-1243.984] (-1242.061) -- 0:01:16
73000 -- (-1246.536) (-1243.350) [-1241.594] (-1240.075) * [-1241.840] (-1241.280) (-1244.349) (-1242.949) -- 0:01:16
73500 -- (-1242.546) (-1242.484) (-1242.147) [-1241.829] * [-1242.271] (-1240.993) (-1246.716) (-1243.672) -- 0:01:15
74000 -- [-1242.320] (-1242.220) (-1243.447) (-1242.292) * (-1241.188) (-1241.437) [-1243.183] (-1242.036) -- 0:01:15
74500 -- (-1244.251) (-1242.498) [-1244.210] (-1243.859) * (-1240.471) (-1246.992) (-1243.615) [-1242.272] -- 0:01:14
75000 -- (-1242.501) (-1243.207) [-1244.360] (-1240.368) * (-1241.137) (-1243.101) [-1243.166] (-1242.293) -- 0:01:14
Average standard deviation of split frequencies: 0.061338
75500 -- (-1241.003) (-1243.591) (-1242.145) [-1241.686] * (-1240.104) (-1246.854) (-1240.881) [-1241.576] -- 0:01:13
76000 -- (-1240.930) (-1241.909) (-1240.769) [-1241.667] * (-1241.567) [-1243.274] (-1244.234) (-1242.731) -- 0:01:12
76500 -- (-1239.601) [-1240.683] (-1242.208) (-1242.650) * (-1242.386) [-1240.957] (-1243.569) (-1241.178) -- 0:01:12
77000 -- (-1244.400) (-1241.074) (-1242.936) [-1241.916] * [-1240.776] (-1240.026) (-1245.596) (-1240.997) -- 0:01:11
77500 -- [-1241.163] (-1242.338) (-1240.794) (-1244.380) * (-1241.310) [-1243.552] (-1241.195) (-1244.635) -- 0:01:11
78000 -- (-1242.725) (-1241.466) (-1240.373) [-1242.040] * [-1241.146] (-1242.501) (-1243.119) (-1241.127) -- 0:01:10
78500 -- (-1239.875) (-1243.046) (-1243.150) [-1242.849] * [-1240.735] (-1240.225) (-1241.775) (-1242.808) -- 0:01:10
79000 -- [-1240.821] (-1243.673) (-1243.232) (-1241.342) * [-1243.390] (-1241.306) (-1241.101) (-1243.986) -- 0:01:09
79500 -- [-1240.806] (-1246.088) (-1242.575) (-1240.938) * [-1241.622] (-1242.145) (-1241.830) (-1241.530) -- 0:01:09
80000 -- (-1245.217) (-1245.347) [-1241.111] (-1244.360) * (-1242.738) (-1242.680) (-1241.873) [-1242.374] -- 0:01:09
Average standard deviation of split frequencies: 0.054748
80500 -- (-1244.864) (-1245.984) [-1242.678] (-1240.243) * [-1242.340] (-1247.690) (-1243.301) (-1244.220) -- 0:01:08
81000 -- (-1242.866) (-1244.557) (-1243.004) [-1240.017] * [-1241.359] (-1244.786) (-1242.443) (-1241.788) -- 0:01:08
81500 -- (-1246.592) (-1247.256) (-1241.365) [-1241.358] * (-1244.527) (-1242.035) (-1242.639) [-1242.892] -- 0:01:07
82000 -- (-1243.402) (-1241.386) (-1244.318) [-1240.689] * (-1243.225) (-1243.501) [-1244.941] (-1241.510) -- 0:01:07
82500 -- (-1241.032) [-1244.331] (-1243.286) (-1242.732) * (-1241.484) [-1245.014] (-1243.646) (-1240.522) -- 0:01:06
83000 -- (-1245.414) (-1247.640) (-1243.522) [-1240.343] * [-1240.149] (-1244.230) (-1242.842) (-1241.687) -- 0:01:06
83500 -- [-1242.193] (-1248.317) (-1242.737) (-1243.019) * [-1239.912] (-1244.597) (-1246.441) (-1244.959) -- 0:01:05
84000 -- (-1241.812) (-1246.554) (-1245.304) [-1241.427] * [-1242.522] (-1244.164) (-1243.601) (-1239.791) -- 0:01:05
84500 -- [-1241.950] (-1242.520) (-1241.336) (-1241.326) * (-1242.790) (-1245.981) (-1242.556) [-1238.872] -- 0:01:15
85000 -- (-1242.537) (-1242.003) [-1241.949] (-1241.738) * [-1241.475] (-1243.082) (-1247.347) (-1241.619) -- 0:01:15
Average standard deviation of split frequencies: 0.048468
85500 -- (-1239.666) (-1241.105) (-1240.605) [-1240.438] * (-1240.941) (-1242.708) [-1240.985] (-1244.424) -- 0:01:14
86000 -- (-1242.649) (-1246.833) (-1242.811) [-1240.170] * [-1240.863] (-1241.578) (-1241.572) (-1243.513) -- 0:01:14
86500 -- (-1241.253) (-1244.453) (-1241.808) [-1241.783] * [-1241.482] (-1244.900) (-1244.962) (-1241.702) -- 0:01:13
87000 -- (-1240.641) (-1242.380) (-1239.430) [-1240.526] * (-1241.998) (-1248.811) (-1240.411) [-1240.882] -- 0:01:13
87500 -- (-1243.681) (-1241.629) (-1241.815) [-1238.843] * (-1242.814) (-1245.164) (-1243.736) [-1238.697] -- 0:01:13
88000 -- (-1242.092) (-1242.087) [-1241.187] (-1242.574) * [-1241.085] (-1243.237) (-1242.081) (-1239.682) -- 0:01:12
88500 -- [-1241.715] (-1244.912) (-1244.173) (-1248.170) * (-1241.212) (-1241.524) (-1244.540) [-1240.758] -- 0:01:12
89000 -- (-1242.150) (-1242.678) (-1241.872) [-1242.649] * (-1239.897) (-1243.249) (-1241.512) [-1244.568] -- 0:01:11
89500 -- (-1241.371) (-1242.986) [-1243.324] (-1242.248) * (-1242.117) [-1242.469] (-1241.969) (-1244.854) -- 0:01:11
90000 -- (-1240.578) (-1242.878) (-1242.675) [-1239.475] * (-1240.950) (-1243.367) (-1241.078) [-1242.222] -- 0:01:10
Average standard deviation of split frequencies: 0.048436
90500 -- (-1241.127) (-1242.593) (-1241.151) [-1240.252] * (-1244.813) (-1243.341) (-1240.807) [-1243.833] -- 0:01:10
91000 -- (-1241.440) (-1243.107) [-1242.939] (-1242.431) * (-1248.801) [-1239.852] (-1244.305) (-1247.495) -- 0:01:09
91500 -- (-1241.442) (-1246.851) [-1242.463] (-1242.118) * (-1243.034) [-1241.695] (-1245.619) (-1237.545) -- 0:01:09
92000 -- [-1242.767] (-1245.288) (-1241.133) (-1244.329) * (-1242.444) (-1241.911) (-1241.519) [-1239.972] -- 0:01:09
92500 -- (-1241.658) (-1243.758) (-1241.230) [-1240.762] * (-1243.288) (-1239.988) [-1240.828] (-1242.416) -- 0:01:08
93000 -- [-1243.205] (-1243.973) (-1240.242) (-1241.791) * (-1241.769) (-1244.831) (-1241.263) [-1240.949] -- 0:01:08
93500 -- [-1246.497] (-1245.511) (-1244.308) (-1241.183) * (-1240.445) (-1245.528) (-1245.583) [-1242.384] -- 0:01:07
94000 -- [-1243.840] (-1242.431) (-1244.501) (-1241.677) * (-1240.990) (-1242.735) [-1242.848] (-1238.315) -- 0:01:07
94500 -- (-1239.482) (-1243.214) [-1246.963] (-1242.110) * (-1243.274) (-1242.085) (-1245.002) [-1238.872] -- 0:01:07
95000 -- (-1240.835) (-1243.984) [-1242.608] (-1242.214) * (-1241.657) [-1245.232] (-1243.736) (-1243.469) -- 0:01:06
Average standard deviation of split frequencies: 0.046895
95500 -- (-1240.807) [-1242.950] (-1240.643) (-1244.321) * [-1242.276] (-1242.269) (-1242.221) (-1243.609) -- 0:01:06
96000 -- [-1240.892] (-1240.680) (-1245.681) (-1243.739) * (-1241.755) (-1246.949) [-1243.332] (-1242.412) -- 0:01:05
96500 -- (-1241.424) [-1243.577] (-1244.468) (-1243.570) * [-1243.202] (-1245.866) (-1241.683) (-1239.343) -- 0:01:05
97000 -- (-1245.331) (-1245.066) [-1240.832] (-1249.604) * [-1242.429] (-1244.338) (-1242.151) (-1241.310) -- 0:01:05
97500 -- (-1244.500) (-1246.519) [-1241.164] (-1242.598) * [-1241.790] (-1242.246) (-1242.479) (-1240.917) -- 0:01:04
98000 -- [-1241.616] (-1242.031) (-1241.401) (-1241.974) * (-1246.614) [-1243.539] (-1243.746) (-1239.732) -- 0:01:04
98500 -- (-1242.377) (-1241.794) (-1242.540) [-1242.829] * [-1241.283] (-1243.219) (-1250.130) (-1240.986) -- 0:01:04
99000 -- (-1242.110) [-1243.255] (-1240.976) (-1242.232) * (-1241.193) [-1239.754] (-1242.390) (-1239.167) -- 0:01:03
99500 -- (-1246.397) (-1242.695) (-1241.686) [-1241.497] * (-1239.924) [-1245.685] (-1241.746) (-1240.705) -- 0:01:03
100000 -- [-1242.672] (-1245.005) (-1242.368) (-1241.449) * (-1243.536) [-1241.828] (-1240.629) (-1242.029) -- 0:01:12
Average standard deviation of split frequencies: 0.041160
100500 -- (-1242.465) (-1242.811) (-1243.776) [-1243.351] * (-1244.547) [-1242.926] (-1241.611) (-1244.024) -- 0:01:11
101000 -- (-1242.104) (-1243.717) [-1243.994] (-1241.014) * (-1243.720) (-1243.041) (-1245.064) [-1242.549] -- 0:01:11
101500 -- (-1242.025) (-1243.213) [-1240.669] (-1242.856) * (-1241.909) [-1244.069] (-1244.083) (-1246.595) -- 0:01:10
102000 -- (-1243.052) [-1244.839] (-1243.860) (-1244.430) * [-1243.819] (-1241.641) (-1242.430) (-1242.141) -- 0:01:10
102500 -- [-1241.090] (-1245.175) (-1244.059) (-1241.553) * (-1244.498) (-1242.461) (-1240.996) [-1242.289] -- 0:01:10
103000 -- (-1241.458) (-1246.667) [-1243.164] (-1241.593) * (-1241.464) [-1246.608] (-1240.939) (-1242.232) -- 0:01:09
103500 -- (-1241.272) (-1243.631) (-1240.817) [-1239.348] * [-1242.151] (-1245.654) (-1242.131) (-1240.958) -- 0:01:09
104000 -- (-1241.494) [-1242.477] (-1241.611) (-1239.918) * (-1244.671) [-1247.001] (-1243.586) (-1243.542) -- 0:01:08
104500 -- (-1241.218) (-1241.490) (-1242.915) [-1241.125] * (-1242.753) [-1241.917] (-1241.787) (-1241.783) -- 0:01:08
105000 -- (-1241.192) (-1244.496) (-1242.389) [-1243.364] * (-1247.811) (-1245.002) [-1240.767] (-1240.767) -- 0:01:08
Average standard deviation of split frequencies: 0.040025
105500 -- (-1241.392) (-1242.214) (-1242.114) [-1242.066] * (-1250.282) (-1241.747) (-1241.136) [-1242.620] -- 0:01:07
106000 -- [-1241.593] (-1244.104) (-1242.438) (-1241.668) * [-1243.792] (-1242.724) (-1241.953) (-1242.880) -- 0:01:07
106500 -- (-1247.889) (-1242.970) (-1243.194) [-1240.380] * (-1243.141) [-1242.696] (-1242.184) (-1244.264) -- 0:01:07
107000 -- (-1247.204) (-1246.287) (-1245.216) [-1242.301] * (-1244.661) [-1242.758] (-1240.730) (-1244.401) -- 0:01:06
107500 -- [-1243.628] (-1242.678) (-1244.024) (-1240.151) * [-1242.167] (-1239.972) (-1240.827) (-1241.391) -- 0:01:06
108000 -- (-1243.433) [-1239.474] (-1241.940) (-1242.474) * [-1241.933] (-1239.855) (-1243.987) (-1238.730) -- 0:01:06
108500 -- (-1244.559) (-1241.111) [-1240.848] (-1240.686) * [-1241.935] (-1241.184) (-1243.259) (-1243.279) -- 0:01:05
109000 -- (-1242.208) [-1239.085] (-1243.207) (-1241.092) * (-1240.818) (-1242.754) [-1240.181] (-1244.145) -- 0:01:05
109500 -- (-1244.039) (-1243.784) [-1242.397] (-1241.231) * [-1244.198] (-1242.216) (-1244.791) (-1244.205) -- 0:01:05
110000 -- (-1242.000) (-1243.589) (-1243.081) [-1240.657] * (-1245.207) (-1247.982) [-1244.819] (-1239.737) -- 0:01:04
Average standard deviation of split frequencies: 0.037391
110500 -- (-1247.282) (-1241.341) (-1243.477) [-1241.313] * (-1243.672) (-1241.059) [-1241.577] (-1243.803) -- 0:01:04
111000 -- [-1245.166] (-1243.485) (-1241.899) (-1239.242) * (-1240.818) (-1246.279) [-1240.050] (-1241.248) -- 0:01:04
111500 -- (-1246.885) (-1246.169) [-1242.424] (-1242.750) * (-1245.500) (-1243.582) [-1246.673] (-1243.431) -- 0:01:03
112000 -- (-1243.382) (-1244.590) (-1246.872) [-1242.245] * (-1242.128) [-1245.854] (-1242.531) (-1242.624) -- 0:01:03
112500 -- (-1243.112) (-1242.257) (-1243.538) [-1242.944] * [-1242.627] (-1242.200) (-1241.510) (-1241.102) -- 0:01:03
113000 -- (-1241.199) [-1241.874] (-1241.498) (-1242.185) * (-1245.844) (-1243.722) (-1244.369) [-1240.232] -- 0:01:02
113500 -- [-1241.715] (-1241.672) (-1240.650) (-1243.337) * (-1245.440) (-1243.370) [-1243.600] (-1239.726) -- 0:01:02
114000 -- (-1240.362) [-1241.230] (-1242.275) (-1240.794) * (-1246.252) [-1243.163] (-1241.152) (-1242.003) -- 0:01:02
114500 -- [-1243.013] (-1241.160) (-1242.079) (-1240.965) * (-1246.835) (-1243.445) [-1243.230] (-1241.752) -- 0:01:09
115000 -- (-1242.155) (-1243.550) (-1242.189) [-1242.671] * (-1240.077) [-1243.061] (-1241.057) (-1243.382) -- 0:01:09
Average standard deviation of split frequencies: 0.033188
115500 -- (-1243.778) (-1241.153) [-1242.720] (-1240.887) * (-1242.367) (-1246.364) [-1241.569] (-1242.220) -- 0:01:08
116000 -- [-1245.578] (-1241.052) (-1244.290) (-1240.530) * [-1240.999] (-1245.109) (-1241.322) (-1242.427) -- 0:01:08
116500 -- [-1244.277] (-1241.754) (-1245.781) (-1240.201) * (-1243.030) (-1240.779) [-1238.847] (-1242.993) -- 0:01:08
117000 -- (-1242.068) [-1242.950] (-1244.178) (-1242.639) * [-1241.459] (-1240.433) (-1242.448) (-1245.989) -- 0:01:07
117500 -- (-1241.471) [-1241.495] (-1241.981) (-1241.533) * [-1241.114] (-1242.708) (-1244.943) (-1246.582) -- 0:01:07
118000 -- (-1243.256) [-1241.552] (-1242.130) (-1241.112) * [-1240.768] (-1241.116) (-1243.879) (-1242.795) -- 0:01:07
118500 -- (-1244.109) [-1240.706] (-1241.952) (-1241.650) * [-1241.584] (-1241.909) (-1243.030) (-1241.953) -- 0:01:06
119000 -- [-1242.342] (-1244.393) (-1241.350) (-1243.171) * (-1241.697) (-1242.852) (-1243.803) [-1241.910] -- 0:01:06
119500 -- (-1242.627) [-1242.459] (-1246.212) (-1241.421) * [-1242.217] (-1242.644) (-1244.744) (-1240.870) -- 0:01:06
120000 -- (-1243.583) [-1241.866] (-1246.456) (-1241.718) * [-1241.355] (-1241.959) (-1241.885) (-1240.887) -- 0:01:06
Average standard deviation of split frequencies: 0.034075
120500 -- [-1242.068] (-1244.647) (-1242.883) (-1242.599) * [-1244.329] (-1242.996) (-1242.347) (-1245.163) -- 0:01:05
121000 -- (-1241.765) [-1244.731] (-1241.265) (-1242.349) * (-1242.305) (-1243.359) [-1243.955] (-1244.959) -- 0:01:05
121500 -- [-1244.022] (-1244.061) (-1241.022) (-1243.828) * [-1243.568] (-1240.084) (-1244.402) (-1243.971) -- 0:01:05
122000 -- (-1242.896) (-1240.094) [-1242.512] (-1242.321) * (-1241.349) (-1245.478) (-1243.645) [-1241.053] -- 0:01:04
122500 -- (-1243.323) (-1241.589) (-1243.167) [-1241.778] * (-1245.565) [-1241.630] (-1242.165) (-1243.491) -- 0:01:04
123000 -- (-1242.683) [-1242.206] (-1242.173) (-1243.427) * (-1243.224) (-1245.887) [-1241.050] (-1242.663) -- 0:01:04
123500 -- [-1243.105] (-1241.189) (-1243.772) (-1244.591) * [-1242.854] (-1242.026) (-1242.817) (-1243.305) -- 0:01:03
124000 -- (-1245.250) (-1245.938) [-1241.556] (-1241.903) * (-1241.203) [-1240.546] (-1249.139) (-1241.452) -- 0:01:03
124500 -- (-1246.156) (-1245.415) [-1242.749] (-1243.964) * (-1242.547) [-1243.028] (-1241.535) (-1241.042) -- 0:01:03
125000 -- (-1242.113) (-1241.543) (-1244.659) [-1243.126] * (-1244.950) (-1245.187) (-1242.424) [-1238.132] -- 0:01:03
Average standard deviation of split frequencies: 0.028946
125500 -- [-1249.098] (-1243.934) (-1241.304) (-1243.428) * [-1241.586] (-1246.320) (-1243.233) (-1239.644) -- 0:01:02
126000 -- (-1250.533) [-1244.151] (-1240.943) (-1243.169) * (-1242.905) (-1246.971) (-1242.624) [-1240.490] -- 0:01:02
126500 -- (-1242.600) [-1244.144] (-1240.471) (-1243.063) * [-1242.321] (-1241.900) (-1240.355) (-1239.114) -- 0:01:02
127000 -- (-1239.859) (-1244.049) [-1242.070] (-1242.329) * (-1242.643) (-1243.701) (-1241.122) [-1240.463] -- 0:01:01
127500 -- [-1242.440] (-1243.316) (-1241.782) (-1241.421) * (-1241.791) (-1240.516) (-1241.848) [-1240.513] -- 0:01:01
128000 -- (-1240.725) (-1247.170) (-1242.351) [-1243.810] * [-1242.093] (-1241.919) (-1239.532) (-1240.435) -- 0:01:01
128500 -- (-1241.488) [-1242.480] (-1245.391) (-1241.882) * (-1241.562) (-1241.666) (-1242.667) [-1240.345] -- 0:01:01
129000 -- (-1242.434) (-1244.114) (-1246.589) [-1241.742] * (-1241.558) (-1243.187) (-1243.280) [-1242.234] -- 0:01:00
129500 -- (-1242.103) (-1242.004) [-1242.564] (-1241.128) * (-1246.001) (-1243.388) (-1241.575) [-1242.165] -- 0:01:07
130000 -- [-1242.189] (-1242.170) (-1241.280) (-1242.528) * (-1239.497) (-1242.562) [-1241.987] (-1243.736) -- 0:01:06
Average standard deviation of split frequencies: 0.029663
130500 -- (-1242.311) [-1241.834] (-1242.930) (-1241.728) * (-1242.788) [-1241.327] (-1240.875) (-1242.677) -- 0:01:06
131000 -- [-1241.495] (-1241.148) (-1244.601) (-1242.379) * (-1241.174) (-1242.299) (-1240.408) [-1242.572] -- 0:01:06
131500 -- (-1241.594) [-1240.992] (-1243.101) (-1243.306) * (-1243.228) (-1241.189) [-1241.630] (-1242.033) -- 0:01:06
132000 -- (-1241.955) [-1243.173] (-1243.332) (-1242.448) * (-1241.118) (-1242.926) (-1241.693) [-1242.719] -- 0:01:05
132500 -- (-1241.554) (-1244.377) [-1242.049] (-1243.805) * (-1241.139) (-1240.801) [-1241.750] (-1241.845) -- 0:01:05
133000 -- [-1241.454] (-1243.155) (-1242.467) (-1242.072) * [-1240.957] (-1241.449) (-1243.845) (-1242.202) -- 0:01:05
133500 -- (-1241.086) [-1242.123] (-1242.153) (-1240.108) * (-1241.828) [-1244.047] (-1244.376) (-1241.459) -- 0:01:04
134000 -- (-1241.731) (-1238.647) (-1241.709) [-1242.770] * [-1242.393] (-1241.680) (-1242.014) (-1241.396) -- 0:01:04
134500 -- (-1243.184) (-1243.447) [-1239.673] (-1242.050) * (-1242.301) (-1243.913) [-1241.176] (-1242.080) -- 0:01:04
135000 -- (-1239.481) (-1242.688) (-1244.624) [-1241.425] * (-1242.400) (-1245.821) (-1241.847) [-1244.280] -- 0:01:04
Average standard deviation of split frequencies: 0.027365
135500 -- (-1241.422) (-1241.267) (-1241.815) [-1242.604] * [-1243.510] (-1244.184) (-1241.748) (-1244.038) -- 0:01:03
136000 -- (-1243.215) (-1242.508) [-1239.209] (-1243.938) * [-1240.736] (-1241.152) (-1244.137) (-1244.187) -- 0:01:03
136500 -- (-1242.135) (-1242.279) [-1242.899] (-1241.105) * [-1242.850] (-1241.590) (-1243.417) (-1242.804) -- 0:01:03
137000 -- [-1243.042] (-1242.855) (-1239.799) (-1241.972) * (-1243.731) (-1239.445) [-1241.865] (-1243.440) -- 0:01:02
137500 -- (-1241.421) [-1242.487] (-1242.533) (-1241.815) * (-1241.083) (-1242.109) [-1241.659] (-1243.840) -- 0:01:02
138000 -- [-1241.805] (-1243.474) (-1244.385) (-1243.290) * (-1244.422) (-1239.321) [-1240.432] (-1247.464) -- 0:01:02
138500 -- (-1242.589) (-1244.455) (-1242.682) [-1242.411] * (-1243.514) (-1240.539) [-1242.795] (-1246.368) -- 0:01:02
139000 -- [-1243.905] (-1241.772) (-1243.839) (-1243.566) * (-1241.341) [-1239.415] (-1245.292) (-1243.574) -- 0:01:01
139500 -- (-1238.452) (-1242.766) [-1240.652] (-1248.560) * (-1241.757) [-1241.116] (-1247.659) (-1243.533) -- 0:01:01
140000 -- [-1240.371] (-1243.247) (-1242.040) (-1242.864) * (-1242.001) (-1243.578) (-1244.517) [-1241.694] -- 0:01:01
Average standard deviation of split frequencies: 0.028574
140500 -- [-1251.480] (-1241.877) (-1242.080) (-1242.369) * (-1243.386) (-1243.003) [-1241.134] (-1243.978) -- 0:01:01
141000 -- (-1242.836) [-1241.437] (-1242.374) (-1245.832) * [-1242.736] (-1240.780) (-1241.777) (-1239.047) -- 0:01:00
141500 -- [-1243.307] (-1242.036) (-1241.091) (-1248.292) * [-1243.918] (-1240.680) (-1241.311) (-1240.929) -- 0:01:00
142000 -- (-1240.455) (-1242.214) [-1238.920] (-1249.244) * (-1247.099) (-1242.080) [-1242.548] (-1242.223) -- 0:01:00
142500 -- (-1243.795) (-1242.211) [-1240.138] (-1241.391) * [-1243.372] (-1244.679) (-1244.249) (-1241.927) -- 0:01:00
143000 -- (-1244.385) (-1241.645) (-1241.236) [-1239.523] * (-1242.178) (-1244.038) (-1243.432) [-1242.574] -- 0:00:59
143500 -- (-1240.207) (-1242.140) [-1242.826] (-1242.868) * (-1242.568) [-1243.397] (-1241.727) (-1242.149) -- 0:00:59
144000 -- [-1242.602] (-1244.433) (-1245.100) (-1238.753) * (-1241.971) [-1240.766] (-1243.204) (-1241.227) -- 0:00:59
144500 -- (-1245.090) (-1246.382) (-1244.074) [-1241.554] * (-1243.308) (-1242.095) (-1242.442) [-1243.134] -- 0:01:05
145000 -- (-1246.244) (-1241.904) [-1243.489] (-1242.683) * [-1239.830] (-1246.072) (-1242.809) (-1241.411) -- 0:01:04
Average standard deviation of split frequencies: 0.023961
145500 -- [-1243.232] (-1241.898) (-1246.406) (-1245.737) * (-1241.024) [-1242.871] (-1246.491) (-1243.574) -- 0:01:04
146000 -- (-1241.913) [-1242.122] (-1242.338) (-1243.421) * (-1243.132) (-1248.097) [-1241.545] (-1240.809) -- 0:01:04
146500 -- (-1243.332) (-1242.254) [-1240.564] (-1243.784) * [-1247.333] (-1240.928) (-1242.610) (-1242.697) -- 0:01:04
147000 -- (-1244.850) [-1241.344] (-1241.242) (-1241.655) * (-1239.925) (-1246.141) [-1245.319] (-1239.698) -- 0:01:03
147500 -- (-1247.250) (-1243.751) [-1242.535] (-1241.498) * (-1248.825) (-1244.667) [-1244.061] (-1243.388) -- 0:01:03
148000 -- (-1243.468) (-1242.214) [-1242.279] (-1240.928) * [-1241.004] (-1241.841) (-1242.225) (-1243.640) -- 0:01:03
148500 -- [-1249.477] (-1242.480) (-1241.262) (-1240.825) * (-1241.158) [-1239.016] (-1242.834) (-1242.904) -- 0:01:03
149000 -- (-1245.030) (-1241.802) (-1243.630) [-1239.753] * (-1241.106) (-1241.194) (-1240.962) [-1245.332] -- 0:01:02
149500 -- (-1250.022) (-1241.093) (-1247.656) [-1241.761] * (-1241.586) [-1242.327] (-1245.015) (-1247.636) -- 0:01:02
150000 -- (-1242.188) (-1243.816) [-1242.194] (-1242.907) * (-1243.197) (-1242.879) [-1242.981] (-1244.345) -- 0:01:02
Average standard deviation of split frequencies: 0.026018
150500 -- (-1243.986) (-1241.593) [-1241.881] (-1244.934) * (-1241.744) (-1242.798) (-1242.650) [-1245.357] -- 0:01:02
151000 -- (-1240.952) (-1242.732) (-1248.567) [-1245.401] * (-1241.174) [-1242.043] (-1242.145) (-1244.079) -- 0:01:01
151500 -- (-1245.118) (-1243.614) (-1244.493) [-1245.348] * (-1241.353) [-1241.611] (-1247.192) (-1241.640) -- 0:01:01
152000 -- [-1248.023] (-1243.612) (-1240.391) (-1246.594) * (-1242.041) (-1240.788) [-1242.774] (-1241.550) -- 0:01:01
152500 -- [-1239.424] (-1242.502) (-1241.905) (-1245.848) * (-1244.321) (-1244.475) [-1242.237] (-1244.068) -- 0:01:01
153000 -- (-1239.040) (-1242.108) [-1242.956] (-1241.345) * [-1244.206] (-1243.610) (-1242.744) (-1244.715) -- 0:01:00
153500 -- (-1242.662) (-1241.623) (-1239.933) [-1241.538] * (-1242.098) (-1239.981) [-1244.461] (-1241.227) -- 0:01:00
154000 -- (-1242.175) (-1241.498) [-1242.858] (-1243.166) * [-1241.777] (-1241.033) (-1245.305) (-1243.223) -- 0:01:00
154500 -- (-1246.091) [-1239.836] (-1242.434) (-1241.834) * (-1243.247) [-1240.373] (-1241.210) (-1245.614) -- 0:01:00
155000 -- (-1243.865) [-1242.485] (-1241.063) (-1243.218) * (-1239.588) (-1241.814) [-1242.169] (-1245.011) -- 0:00:59
Average standard deviation of split frequencies: 0.025837
155500 -- [-1243.580] (-1242.229) (-1241.943) (-1245.128) * (-1240.753) [-1240.888] (-1241.270) (-1242.695) -- 0:00:59
156000 -- (-1242.695) [-1242.025] (-1242.854) (-1242.891) * [-1240.651] (-1241.801) (-1241.868) (-1243.662) -- 0:00:59
156500 -- [-1241.466] (-1243.794) (-1242.549) (-1245.382) * (-1238.815) (-1243.513) [-1241.392] (-1239.778) -- 0:00:59
157000 -- (-1241.694) [-1242.118] (-1240.020) (-1241.881) * (-1239.154) (-1242.615) (-1241.243) [-1241.453] -- 0:00:59
157500 -- (-1242.484) (-1241.594) (-1241.229) [-1243.092] * (-1243.565) (-1244.503) (-1243.712) [-1242.060] -- 0:00:58
158000 -- [-1242.365] (-1240.598) (-1239.877) (-1243.472) * (-1248.006) [-1241.642] (-1241.877) (-1243.483) -- 0:00:58
158500 -- (-1243.851) (-1244.255) (-1241.415) [-1242.762] * (-1247.545) (-1242.237) [-1241.643] (-1239.938) -- 0:00:58
159000 -- (-1244.935) (-1241.490) (-1242.883) [-1243.203] * (-1239.567) (-1242.898) (-1243.251) [-1241.305] -- 0:00:58
159500 -- [-1241.711] (-1244.802) (-1239.801) (-1241.547) * (-1242.618) [-1244.858] (-1243.473) (-1237.819) -- 0:01:03
160000 -- [-1241.457] (-1242.906) (-1243.994) (-1241.566) * (-1245.138) (-1243.490) (-1245.534) [-1240.501] -- 0:01:02
Average standard deviation of split frequencies: 0.021465
160500 -- (-1240.542) [-1242.491] (-1244.911) (-1242.046) * (-1240.828) [-1242.526] (-1242.208) (-1241.831) -- 0:01:02
161000 -- (-1240.756) (-1242.840) (-1244.423) [-1243.139] * (-1240.223) (-1242.954) [-1242.324] (-1241.316) -- 0:01:02
161500 -- [-1241.670] (-1242.653) (-1243.380) (-1243.774) * (-1243.118) [-1243.749] (-1242.389) (-1243.555) -- 0:01:02
162000 -- (-1242.166) (-1242.555) [-1242.624] (-1242.470) * (-1241.360) (-1246.132) (-1243.666) [-1243.185] -- 0:01:02
162500 -- [-1244.626] (-1242.786) (-1245.155) (-1242.995) * (-1240.845) (-1241.848) (-1242.919) [-1243.252] -- 0:01:01
163000 -- (-1246.267) (-1247.334) (-1243.656) [-1240.480] * (-1241.637) (-1240.794) (-1240.958) [-1241.298] -- 0:01:01
163500 -- (-1247.230) (-1250.490) (-1244.116) [-1239.597] * [-1242.997] (-1243.100) (-1240.962) (-1247.148) -- 0:01:01
164000 -- (-1244.848) (-1242.321) (-1241.742) [-1242.502] * (-1247.165) [-1243.529] (-1241.277) (-1243.467) -- 0:01:01
164500 -- (-1240.210) [-1242.429] (-1242.735) (-1242.785) * (-1242.124) (-1243.383) (-1241.039) [-1240.592] -- 0:01:00
165000 -- (-1241.315) [-1245.027] (-1246.716) (-1241.025) * (-1241.957) (-1242.437) [-1241.846] (-1242.759) -- 0:01:00
Average standard deviation of split frequencies: 0.021523
165500 -- (-1243.233) (-1244.956) [-1242.327] (-1241.040) * (-1238.852) (-1246.241) (-1240.971) [-1242.000] -- 0:01:00
166000 -- (-1241.816) (-1241.848) (-1241.938) [-1243.005] * [-1242.635] (-1241.399) (-1243.226) (-1241.232) -- 0:01:00
166500 -- (-1240.734) (-1241.591) [-1243.055] (-1243.289) * (-1247.303) [-1239.661] (-1241.761) (-1241.472) -- 0:01:00
167000 -- (-1240.403) [-1240.944] (-1241.572) (-1243.587) * (-1242.124) (-1244.139) [-1243.112] (-1245.970) -- 0:00:59
167500 -- (-1243.194) (-1241.890) (-1242.017) [-1242.532] * (-1240.902) [-1241.702] (-1244.475) (-1244.577) -- 0:00:59
168000 -- (-1241.295) (-1241.292) (-1243.431) [-1241.881] * (-1239.912) (-1242.152) (-1244.761) [-1241.583] -- 0:00:59
168500 -- (-1243.441) (-1242.468) (-1244.124) [-1242.020] * (-1239.415) [-1241.226] (-1246.130) (-1243.236) -- 0:00:59
169000 -- (-1243.479) [-1241.880] (-1240.962) (-1240.731) * (-1240.604) [-1242.485] (-1243.172) (-1244.634) -- 0:00:59
169500 -- (-1242.799) (-1243.264) (-1240.654) [-1242.380] * [-1241.397] (-1241.769) (-1243.908) (-1244.412) -- 0:00:58
170000 -- [-1240.149] (-1244.630) (-1243.807) (-1240.777) * (-1240.788) [-1242.413] (-1244.312) (-1242.772) -- 0:00:58
Average standard deviation of split frequencies: 0.021176
170500 -- [-1241.926] (-1243.046) (-1241.410) (-1242.267) * (-1242.062) [-1241.158] (-1247.527) (-1242.855) -- 0:00:58
171000 -- (-1242.715) (-1244.352) (-1241.721) [-1242.185] * (-1238.540) (-1244.725) [-1244.825] (-1241.638) -- 0:00:58
171500 -- (-1244.140) (-1243.116) (-1241.091) [-1243.513] * [-1239.937] (-1242.290) (-1250.170) (-1242.264) -- 0:00:57
172000 -- (-1245.309) (-1244.155) (-1242.574) [-1242.830] * [-1240.557] (-1241.742) (-1243.388) (-1239.743) -- 0:00:57
172500 -- (-1246.918) [-1243.734] (-1242.563) (-1243.341) * [-1239.210] (-1244.985) (-1240.425) (-1239.900) -- 0:00:57
173000 -- (-1241.280) (-1240.691) [-1241.749] (-1243.713) * (-1241.307) [-1244.078] (-1241.007) (-1245.370) -- 0:00:57
173500 -- (-1242.424) (-1242.300) (-1241.963) [-1244.103] * (-1245.430) [-1241.011] (-1242.022) (-1241.620) -- 0:00:57
174000 -- (-1244.250) (-1248.110) (-1246.084) [-1242.940] * [-1240.441] (-1240.649) (-1241.391) (-1245.884) -- 0:00:56
174500 -- (-1245.968) (-1242.719) (-1243.847) [-1244.596] * (-1244.285) (-1243.243) (-1242.342) [-1244.922] -- 0:01:01
175000 -- (-1248.293) [-1241.600] (-1241.919) (-1241.481) * (-1243.112) (-1241.596) (-1245.381) [-1242.087] -- 0:01:01
Average standard deviation of split frequencies: 0.019454
175500 -- (-1242.894) [-1241.560] (-1242.174) (-1244.371) * (-1242.412) (-1242.617) (-1241.391) [-1245.025] -- 0:01:01
176000 -- (-1241.818) (-1241.137) [-1241.313] (-1241.822) * (-1243.577) (-1239.663) [-1241.321] (-1244.633) -- 0:01:00
176500 -- [-1242.245] (-1242.755) (-1244.925) (-1241.631) * (-1240.767) (-1239.930) (-1243.200) [-1243.751] -- 0:01:00
177000 -- [-1241.688] (-1242.843) (-1244.208) (-1242.012) * (-1241.358) [-1241.911] (-1242.348) (-1248.760) -- 0:01:00
177500 -- (-1240.652) (-1243.605) [-1240.686] (-1241.562) * (-1243.691) [-1242.796] (-1241.866) (-1244.187) -- 0:01:00
178000 -- (-1241.862) (-1243.892) [-1241.004] (-1240.822) * [-1242.554] (-1243.120) (-1241.889) (-1243.087) -- 0:01:00
178500 -- (-1242.758) [-1243.216] (-1241.390) (-1240.690) * (-1242.560) (-1245.961) [-1242.869] (-1244.894) -- 0:00:59
179000 -- (-1242.109) [-1243.203] (-1242.169) (-1241.736) * (-1242.000) (-1244.165) [-1242.757] (-1241.594) -- 0:00:59
179500 -- (-1244.957) (-1242.021) [-1239.268] (-1241.730) * (-1241.894) [-1240.932] (-1242.373) (-1241.039) -- 0:00:59
180000 -- (-1243.182) [-1240.099] (-1241.394) (-1246.937) * (-1242.360) [-1240.809] (-1241.524) (-1239.299) -- 0:00:59
Average standard deviation of split frequencies: 0.019714
180500 -- (-1240.708) [-1241.736] (-1242.447) (-1241.246) * [-1239.640] (-1240.306) (-1241.793) (-1241.539) -- 0:00:59
181000 -- [-1243.902] (-1239.953) (-1245.000) (-1243.840) * (-1238.864) [-1241.781] (-1244.486) (-1241.644) -- 0:00:58
181500 -- [-1244.412] (-1239.160) (-1241.386) (-1243.950) * (-1240.685) (-1241.835) (-1247.396) [-1241.534] -- 0:00:58
182000 -- (-1244.411) (-1243.033) (-1248.686) [-1242.374] * [-1241.507] (-1241.318) (-1244.838) (-1239.050) -- 0:00:58
182500 -- (-1244.647) [-1242.193] (-1243.930) (-1244.043) * (-1242.864) (-1242.596) [-1243.093] (-1242.278) -- 0:00:58
183000 -- (-1245.094) (-1242.505) (-1244.200) [-1242.380] * [-1241.626] (-1244.507) (-1241.667) (-1242.192) -- 0:00:58
183500 -- (-1244.776) [-1242.895] (-1242.737) (-1243.930) * [-1242.597] (-1246.148) (-1244.853) (-1243.384) -- 0:00:57
184000 -- (-1244.053) [-1241.495] (-1242.397) (-1245.174) * (-1241.197) [-1241.143] (-1244.400) (-1240.633) -- 0:00:57
184500 -- (-1240.926) [-1241.365] (-1241.663) (-1242.248) * (-1242.476) (-1240.750) (-1243.743) [-1245.300] -- 0:00:57
185000 -- (-1243.499) (-1244.437) [-1244.256] (-1240.771) * (-1241.494) [-1242.670] (-1241.546) (-1241.408) -- 0:00:57
Average standard deviation of split frequencies: 0.019431
185500 -- [-1241.661] (-1245.318) (-1239.704) (-1240.459) * (-1242.750) [-1243.844] (-1243.355) (-1240.614) -- 0:00:57
186000 -- (-1242.364) [-1240.718] (-1243.970) (-1242.616) * (-1243.340) (-1240.688) (-1241.284) [-1245.310] -- 0:00:56
186500 -- (-1243.347) (-1241.850) [-1241.661] (-1245.215) * (-1247.660) (-1242.455) (-1241.515) [-1241.891] -- 0:00:56
187000 -- [-1241.718] (-1241.196) (-1244.292) (-1242.320) * (-1241.713) (-1242.390) [-1241.314] (-1245.275) -- 0:00:56
187500 -- (-1244.564) [-1240.193] (-1244.091) (-1244.304) * (-1244.417) [-1241.538] (-1242.907) (-1246.999) -- 0:00:56
188000 -- (-1244.129) (-1240.811) (-1241.602) [-1244.789] * (-1239.577) (-1242.774) (-1242.899) [-1242.681] -- 0:00:56
188500 -- (-1243.106) (-1243.302) (-1243.003) [-1246.143] * [-1242.560] (-1241.401) (-1242.205) (-1242.317) -- 0:00:55
189000 -- (-1240.527) [-1240.953] (-1243.106) (-1243.837) * [-1242.974] (-1241.219) (-1241.280) (-1242.974) -- 0:00:55
189500 -- (-1243.862) (-1241.344) [-1249.510] (-1244.095) * [-1242.949] (-1242.415) (-1242.878) (-1244.074) -- 0:00:55
190000 -- (-1242.357) [-1241.121] (-1241.578) (-1245.098) * (-1243.326) (-1240.735) [-1242.191] (-1243.321) -- 0:00:59
Average standard deviation of split frequencies: 0.017444
190500 -- (-1242.678) [-1242.370] (-1243.199) (-1245.028) * (-1238.203) (-1241.562) [-1242.031] (-1246.891) -- 0:00:59
191000 -- (-1242.333) [-1241.672] (-1240.987) (-1243.998) * (-1238.408) (-1240.807) [-1242.122] (-1243.146) -- 0:00:59
191500 -- [-1242.547] (-1243.553) (-1245.141) (-1243.355) * (-1242.152) [-1243.369] (-1241.581) (-1242.407) -- 0:00:59
192000 -- (-1245.112) [-1241.241] (-1245.824) (-1242.430) * [-1242.804] (-1243.181) (-1244.950) (-1243.089) -- 0:00:58
192500 -- (-1242.812) (-1243.215) (-1245.544) [-1243.004] * (-1244.011) (-1244.755) [-1246.302] (-1243.014) -- 0:00:58
193000 -- (-1243.166) [-1241.194] (-1245.543) (-1243.048) * (-1243.244) [-1243.298] (-1242.913) (-1243.078) -- 0:00:58
193500 -- (-1241.624) (-1242.442) (-1245.352) [-1242.594] * [-1239.327] (-1241.897) (-1241.683) (-1245.140) -- 0:00:58
194000 -- [-1240.525] (-1242.670) (-1244.995) (-1243.280) * (-1240.862) (-1240.599) [-1242.414] (-1242.637) -- 0:00:58
194500 -- (-1243.891) [-1241.628] (-1244.217) (-1243.602) * (-1241.724) [-1241.146] (-1242.142) (-1241.323) -- 0:00:57
195000 -- (-1241.479) (-1242.071) [-1239.907] (-1243.257) * (-1242.158) (-1243.571) (-1241.809) [-1243.160] -- 0:00:57
Average standard deviation of split frequencies: 0.018861
195500 -- [-1241.304] (-1246.288) (-1241.951) (-1242.887) * (-1249.245) (-1242.736) (-1243.080) [-1242.507] -- 0:00:57
196000 -- (-1243.262) [-1241.427] (-1242.847) (-1241.497) * (-1240.451) [-1242.732] (-1241.175) (-1242.799) -- 0:00:57
196500 -- [-1242.108] (-1240.087) (-1244.020) (-1243.637) * (-1240.961) (-1243.864) (-1244.118) [-1242.682] -- 0:00:57
197000 -- (-1242.811) [-1238.781] (-1243.256) (-1241.024) * (-1242.384) (-1246.409) [-1240.804] (-1243.130) -- 0:00:57
197500 -- [-1242.538] (-1242.691) (-1240.435) (-1241.560) * (-1239.359) (-1241.983) [-1241.999] (-1240.963) -- 0:00:56
198000 -- (-1241.955) (-1244.851) [-1242.600] (-1241.097) * (-1241.549) (-1245.739) [-1240.431] (-1243.092) -- 0:00:56
198500 -- (-1242.411) [-1241.679] (-1244.938) (-1241.142) * [-1241.550] (-1242.914) (-1243.003) (-1240.623) -- 0:00:56
199000 -- (-1240.778) (-1241.977) (-1242.296) [-1247.715] * (-1240.827) [-1243.134] (-1240.358) (-1241.699) -- 0:00:56
199500 -- [-1241.216] (-1241.474) (-1237.894) (-1244.185) * [-1242.656] (-1243.229) (-1241.356) (-1244.285) -- 0:00:56
200000 -- (-1246.635) (-1244.204) [-1241.475] (-1244.377) * (-1243.532) [-1239.739] (-1244.731) (-1242.216) -- 0:00:55
Average standard deviation of split frequencies: 0.018141
200500 -- (-1244.133) [-1241.636] (-1242.789) (-1246.100) * (-1243.332) [-1240.169] (-1243.802) (-1241.770) -- 0:00:55
201000 -- (-1241.406) (-1245.110) [-1241.103] (-1247.389) * (-1243.921) (-1239.293) [-1244.796] (-1241.483) -- 0:00:55
201500 -- (-1242.769) [-1243.004] (-1242.668) (-1248.822) * (-1243.473) (-1242.958) [-1239.913] (-1241.263) -- 0:00:55
202000 -- (-1241.237) (-1242.292) [-1240.942] (-1245.457) * (-1244.188) [-1242.187] (-1241.726) (-1242.185) -- 0:00:55
202500 -- (-1243.742) [-1241.640] (-1239.374) (-1243.616) * (-1244.767) (-1241.899) (-1241.390) [-1243.221] -- 0:00:55
203000 -- (-1241.299) (-1241.129) (-1241.202) [-1241.058] * (-1242.255) (-1244.885) [-1242.090] (-1243.829) -- 0:00:54
203500 -- (-1242.272) (-1240.788) [-1243.709] (-1244.036) * (-1243.178) (-1243.865) [-1242.184] (-1240.995) -- 0:00:54
204000 -- (-1243.493) (-1242.318) [-1241.459] (-1242.107) * [-1243.757] (-1240.088) (-1241.290) (-1241.691) -- 0:00:54
204500 -- (-1244.528) (-1243.149) [-1241.089] (-1240.161) * (-1247.448) (-1242.367) [-1243.496] (-1244.641) -- 0:00:54
205000 -- (-1244.103) (-1245.614) (-1240.325) [-1241.576] * (-1247.879) [-1241.498] (-1242.935) (-1243.539) -- 0:00:58
Average standard deviation of split frequencies: 0.019030
205500 -- (-1243.193) [-1240.653] (-1242.097) (-1240.121) * (-1248.522) [-1243.592] (-1244.472) (-1244.781) -- 0:00:57
206000 -- [-1243.172] (-1238.470) (-1244.631) (-1240.505) * (-1244.559) [-1240.286] (-1246.273) (-1246.622) -- 0:00:57
206500 -- [-1243.560] (-1245.439) (-1240.891) (-1240.537) * [-1240.795] (-1240.932) (-1244.508) (-1242.024) -- 0:00:57
207000 -- (-1242.834) (-1241.969) (-1241.947) [-1240.288] * (-1243.010) [-1241.643] (-1242.404) (-1245.158) -- 0:00:57
207500 -- [-1243.200] (-1241.580) (-1242.478) (-1241.368) * (-1246.082) (-1241.248) (-1240.033) [-1246.880] -- 0:00:57
208000 -- (-1246.984) (-1246.285) [-1242.219] (-1239.665) * (-1242.501) [-1240.640] (-1239.317) (-1241.985) -- 0:00:57
208500 -- (-1238.951) [-1242.131] (-1240.958) (-1243.493) * (-1242.096) (-1240.697) [-1241.264] (-1241.923) -- 0:00:56
209000 -- (-1241.265) (-1247.788) [-1242.873] (-1244.882) * (-1240.009) (-1241.387) [-1240.403] (-1242.553) -- 0:00:56
209500 -- (-1241.655) [-1241.028] (-1240.591) (-1243.173) * (-1240.985) [-1242.766] (-1241.241) (-1241.159) -- 0:00:56
210000 -- (-1244.216) (-1244.908) (-1244.637) [-1240.370] * [-1239.362] (-1243.122) (-1240.676) (-1241.892) -- 0:00:56
Average standard deviation of split frequencies: 0.018137
210500 -- (-1243.918) [-1242.595] (-1243.061) (-1240.811) * (-1239.323) (-1244.870) [-1243.016] (-1242.183) -- 0:00:56
211000 -- (-1246.644) (-1242.241) (-1243.233) [-1240.927] * (-1244.177) (-1243.218) (-1241.094) [-1242.262] -- 0:00:56
211500 -- [-1241.264] (-1241.787) (-1243.663) (-1241.814) * (-1241.793) [-1252.031] (-1242.783) (-1246.007) -- 0:00:55
212000 -- (-1250.189) [-1242.078] (-1244.798) (-1241.355) * [-1239.342] (-1241.560) (-1240.682) (-1241.612) -- 0:00:55
212500 -- [-1243.867] (-1248.203) (-1241.212) (-1242.586) * (-1244.952) (-1242.877) [-1240.100] (-1246.969) -- 0:00:55
213000 -- (-1244.048) (-1243.481) [-1243.392] (-1240.892) * (-1244.443) (-1241.632) [-1242.020] (-1244.167) -- 0:00:55
213500 -- (-1244.886) (-1241.730) [-1240.865] (-1240.728) * [-1241.853] (-1242.911) (-1241.730) (-1244.446) -- 0:00:55
214000 -- [-1243.124] (-1244.970) (-1241.945) (-1240.624) * (-1241.739) (-1242.516) (-1242.519) [-1244.536] -- 0:00:55
214500 -- (-1245.100) [-1244.772] (-1241.282) (-1244.131) * (-1241.933) (-1241.910) [-1245.820] (-1240.434) -- 0:00:54
215000 -- [-1242.659] (-1243.209) (-1241.798) (-1242.947) * (-1242.312) (-1241.457) (-1241.053) [-1241.890] -- 0:00:54
Average standard deviation of split frequencies: 0.016689
215500 -- (-1242.988) [-1241.255] (-1242.974) (-1243.314) * (-1242.218) [-1241.638] (-1240.225) (-1241.374) -- 0:00:54
216000 -- (-1241.584) (-1245.588) (-1243.355) [-1242.023] * [-1241.397] (-1243.414) (-1242.696) (-1243.106) -- 0:00:54
216500 -- [-1243.038] (-1242.936) (-1243.496) (-1242.261) * (-1242.251) (-1241.773) [-1243.016] (-1246.165) -- 0:00:54
217000 -- (-1242.578) (-1239.777) (-1241.338) [-1241.467] * (-1242.438) (-1243.121) [-1244.798] (-1241.251) -- 0:00:54
217500 -- (-1242.657) (-1241.426) (-1241.835) [-1239.549] * [-1241.826] (-1243.420) (-1239.961) (-1242.631) -- 0:00:53
218000 -- (-1242.011) (-1240.969) [-1244.262] (-1241.919) * (-1240.247) (-1242.199) [-1240.765] (-1245.041) -- 0:00:53
218500 -- (-1241.574) [-1238.191] (-1243.554) (-1240.898) * [-1238.945] (-1241.860) (-1240.689) (-1241.449) -- 0:00:53
219000 -- [-1243.066] (-1241.777) (-1242.616) (-1242.878) * (-1239.810) (-1241.408) [-1241.348] (-1241.550) -- 0:00:53
219500 -- (-1244.453) [-1243.200] (-1249.422) (-1242.746) * (-1239.640) (-1243.427) [-1238.470] (-1242.554) -- 0:00:53
220000 -- (-1244.246) (-1241.614) (-1243.442) [-1241.766] * [-1242.947] (-1241.411) (-1241.658) (-1243.486) -- 0:00:56
Average standard deviation of split frequencies: 0.017719
220500 -- (-1241.709) (-1242.283) (-1244.533) [-1243.404] * (-1239.586) (-1242.524) (-1239.866) [-1241.643] -- 0:00:56
221000 -- (-1242.273) (-1245.227) [-1242.077] (-1246.115) * (-1240.086) (-1242.256) [-1238.952] (-1241.943) -- 0:00:56
221500 -- (-1241.786) (-1245.237) (-1245.066) [-1244.737] * (-1240.857) (-1244.825) (-1241.658) [-1239.418] -- 0:00:56
222000 -- (-1241.062) [-1242.756] (-1242.565) (-1244.991) * (-1241.392) (-1242.598) (-1240.760) [-1240.771] -- 0:00:56
222500 -- (-1245.133) [-1241.734] (-1243.772) (-1242.192) * (-1242.450) (-1241.476) [-1241.128] (-1241.211) -- 0:00:55
223000 -- (-1246.084) (-1241.436) (-1243.504) [-1243.268] * (-1241.884) (-1241.409) (-1240.629) [-1241.010] -- 0:00:55
223500 -- [-1241.984] (-1250.312) (-1242.370) (-1241.702) * (-1241.994) (-1240.115) [-1244.747] (-1241.701) -- 0:00:55
224000 -- (-1241.138) (-1242.096) (-1241.051) [-1239.566] * [-1241.595] (-1242.483) (-1241.758) (-1242.729) -- 0:00:55
224500 -- [-1241.109] (-1241.543) (-1241.528) (-1243.327) * (-1241.963) (-1242.985) [-1241.630] (-1241.483) -- 0:00:55
225000 -- (-1241.942) (-1242.342) [-1241.827] (-1241.692) * (-1245.038) (-1240.929) (-1242.276) [-1242.769] -- 0:00:55
Average standard deviation of split frequencies: 0.016932
225500 -- (-1242.108) [-1244.715] (-1242.499) (-1245.258) * (-1240.429) [-1241.222] (-1241.652) (-1242.868) -- 0:00:54
226000 -- (-1239.680) (-1240.207) [-1243.041] (-1242.234) * (-1246.608) (-1241.142) [-1240.810] (-1242.021) -- 0:00:54
226500 -- (-1242.639) (-1240.953) [-1243.409] (-1243.158) * [-1240.721] (-1241.931) (-1242.642) (-1244.165) -- 0:00:54
227000 -- [-1243.473] (-1242.690) (-1241.458) (-1241.457) * [-1241.492] (-1242.511) (-1244.347) (-1244.235) -- 0:00:54
227500 -- (-1244.410) (-1239.627) [-1240.691] (-1243.846) * (-1241.154) (-1241.995) [-1240.703] (-1244.674) -- 0:00:54
228000 -- (-1243.122) [-1241.332] (-1242.274) (-1243.188) * (-1240.748) (-1246.748) [-1243.552] (-1241.078) -- 0:00:54
228500 -- (-1243.386) (-1242.041) [-1242.100] (-1241.857) * (-1242.060) (-1241.104) (-1241.534) [-1241.845] -- 0:00:54
229000 -- (-1242.585) [-1240.699] (-1243.753) (-1245.139) * (-1242.497) (-1242.819) [-1240.015] (-1243.213) -- 0:00:53
229500 -- (-1242.738) (-1243.180) (-1242.312) [-1245.163] * (-1242.819) [-1241.885] (-1241.714) (-1244.853) -- 0:00:53
230000 -- (-1239.593) [-1243.204] (-1244.878) (-1241.149) * [-1243.619] (-1240.767) (-1243.950) (-1241.011) -- 0:00:53
Average standard deviation of split frequencies: 0.017598
230500 -- (-1245.937) [-1244.721] (-1242.194) (-1242.903) * (-1242.537) (-1244.060) (-1242.781) [-1241.887] -- 0:00:53
231000 -- (-1241.102) [-1240.847] (-1242.184) (-1240.964) * (-1245.187) (-1242.602) (-1242.877) [-1241.406] -- 0:00:53
231500 -- (-1244.272) (-1242.126) (-1241.561) [-1244.014] * [-1241.476] (-1240.897) (-1240.510) (-1239.867) -- 0:00:53
232000 -- [-1243.460] (-1243.400) (-1240.824) (-1242.946) * (-1241.561) [-1243.687] (-1240.815) (-1244.495) -- 0:00:52
232500 -- [-1242.273] (-1242.486) (-1242.078) (-1244.366) * (-1239.429) (-1244.732) [-1240.997] (-1246.666) -- 0:00:52
233000 -- [-1245.519] (-1238.663) (-1240.100) (-1241.472) * [-1241.282] (-1245.489) (-1242.554) (-1243.522) -- 0:00:52
233500 -- (-1245.107) (-1242.511) (-1241.854) [-1241.003] * [-1241.160] (-1240.911) (-1241.738) (-1245.875) -- 0:00:52
234000 -- (-1241.243) (-1241.287) (-1242.970) [-1238.335] * [-1242.415] (-1242.667) (-1242.020) (-1241.650) -- 0:00:52
234500 -- [-1242.652] (-1239.958) (-1243.062) (-1240.987) * [-1238.432] (-1242.225) (-1242.264) (-1244.046) -- 0:00:52
235000 -- (-1243.291) (-1243.322) [-1244.562] (-1243.801) * (-1242.254) [-1243.506] (-1241.589) (-1244.509) -- 0:00:55
Average standard deviation of split frequencies: 0.017557
235500 -- (-1243.054) (-1240.494) (-1244.336) [-1240.613] * (-1244.334) (-1242.257) (-1241.994) [-1242.419] -- 0:00:55
236000 -- [-1242.324] (-1242.835) (-1243.046) (-1241.153) * (-1242.366) (-1243.723) [-1241.011] (-1242.345) -- 0:00:55
236500 -- (-1242.060) (-1242.371) (-1242.408) [-1241.080] * [-1246.754] (-1240.502) (-1241.349) (-1243.735) -- 0:00:54
237000 -- (-1241.186) (-1239.629) (-1242.626) [-1240.306] * [-1244.932] (-1243.841) (-1241.905) (-1242.880) -- 0:00:54
237500 -- (-1243.016) (-1239.732) [-1240.869] (-1239.962) * [-1241.865] (-1242.641) (-1240.627) (-1240.884) -- 0:00:54
238000 -- (-1239.604) (-1245.390) (-1242.605) [-1240.859] * (-1241.830) (-1241.569) (-1240.856) [-1246.144] -- 0:00:54
238500 -- [-1244.386] (-1245.204) (-1243.193) (-1240.622) * [-1241.185] (-1241.467) (-1240.667) (-1241.757) -- 0:00:54
239000 -- (-1244.710) [-1243.324] (-1243.956) (-1240.648) * (-1243.356) (-1242.890) [-1242.525] (-1242.434) -- 0:00:54
239500 -- (-1242.630) [-1244.631] (-1242.785) (-1243.286) * [-1242.329] (-1242.985) (-1241.659) (-1241.619) -- 0:00:53
240000 -- [-1242.662] (-1243.350) (-1241.292) (-1243.203) * [-1243.643] (-1241.020) (-1248.412) (-1241.052) -- 0:00:53
Average standard deviation of split frequencies: 0.018282
240500 -- (-1239.853) [-1245.028] (-1243.150) (-1242.113) * (-1239.934) (-1243.029) [-1242.354] (-1241.224) -- 0:00:53
241000 -- (-1242.330) (-1247.836) (-1241.773) [-1240.450] * [-1242.634] (-1240.647) (-1242.576) (-1239.537) -- 0:00:53
241500 -- (-1241.707) [-1242.062] (-1243.024) (-1245.069) * (-1242.892) (-1240.592) (-1241.105) [-1239.814] -- 0:00:53
242000 -- (-1241.191) (-1246.432) [-1242.508] (-1242.530) * (-1243.431) (-1241.313) [-1241.538] (-1241.758) -- 0:00:53
242500 -- (-1245.628) (-1248.865) (-1241.600) [-1240.029] * [-1241.560] (-1245.308) (-1242.687) (-1243.819) -- 0:00:53
243000 -- (-1243.955) (-1246.288) [-1242.730] (-1243.001) * (-1245.738) (-1243.027) (-1244.239) [-1244.973] -- 0:00:52
243500 -- (-1242.530) (-1241.813) (-1241.658) [-1244.585] * [-1240.930] (-1241.102) (-1243.685) (-1244.928) -- 0:00:52
244000 -- (-1244.487) [-1242.524] (-1242.151) (-1243.581) * (-1242.597) (-1245.011) [-1241.044] (-1244.322) -- 0:00:52
244500 -- (-1241.484) [-1241.221] (-1242.524) (-1242.513) * (-1248.183) (-1241.455) [-1240.662] (-1243.544) -- 0:00:52
245000 -- (-1246.182) [-1242.770] (-1244.899) (-1244.781) * (-1245.436) (-1241.138) (-1240.714) [-1243.337] -- 0:00:52
Average standard deviation of split frequencies: 0.018053
245500 -- (-1244.885) [-1246.667] (-1244.997) (-1241.504) * [-1242.535] (-1243.268) (-1241.055) (-1240.768) -- 0:00:52
246000 -- (-1243.399) (-1242.325) [-1242.266] (-1241.637) * (-1240.667) [-1242.411] (-1240.335) (-1241.688) -- 0:00:52
246500 -- (-1241.677) (-1242.121) (-1245.386) [-1241.665] * (-1242.420) (-1241.819) [-1241.421] (-1242.879) -- 0:00:51
247000 -- (-1240.468) [-1240.184] (-1243.367) (-1241.812) * (-1242.511) [-1239.864] (-1246.846) (-1245.018) -- 0:00:51
247500 -- (-1243.573) [-1240.413] (-1241.479) (-1242.079) * (-1242.776) [-1239.602] (-1241.221) (-1241.885) -- 0:00:51
248000 -- (-1242.939) [-1241.433] (-1242.602) (-1242.208) * (-1245.611) (-1244.470) [-1242.564] (-1243.099) -- 0:00:51
248500 -- (-1241.662) (-1242.242) [-1245.953] (-1240.553) * (-1243.735) (-1243.367) [-1240.697] (-1243.597) -- 0:00:51
249000 -- (-1247.491) (-1240.428) (-1243.317) [-1238.977] * (-1248.603) (-1241.191) (-1244.123) [-1245.463] -- 0:00:51
249500 -- (-1246.536) [-1241.305] (-1242.367) (-1243.719) * (-1248.190) [-1246.366] (-1244.434) (-1241.285) -- 0:00:51
250000 -- (-1239.582) (-1244.360) (-1246.846) [-1242.304] * [-1246.740] (-1247.452) (-1250.894) (-1245.463) -- 0:00:54
Average standard deviation of split frequencies: 0.017618
250500 -- (-1242.746) [-1239.697] (-1242.801) (-1241.791) * [-1243.414] (-1241.654) (-1242.445) (-1242.335) -- 0:00:53
251000 -- (-1242.932) (-1242.344) [-1241.899] (-1244.184) * (-1241.965) (-1242.016) [-1240.183] (-1241.965) -- 0:00:53
251500 -- (-1241.536) (-1244.205) (-1242.160) [-1240.856] * (-1241.255) (-1242.603) [-1244.031] (-1242.912) -- 0:00:53
252000 -- (-1240.974) [-1244.745] (-1241.017) (-1240.907) * (-1242.307) [-1243.757] (-1240.558) (-1243.242) -- 0:00:53
252500 -- (-1238.445) [-1242.787] (-1242.745) (-1245.850) * (-1242.322) (-1242.285) (-1243.379) [-1240.446] -- 0:00:53
253000 -- [-1240.931] (-1241.708) (-1242.223) (-1243.224) * (-1244.613) (-1241.110) (-1243.553) [-1240.549] -- 0:00:53
253500 -- [-1242.914] (-1242.250) (-1243.155) (-1241.106) * (-1243.708) (-1246.849) (-1242.304) [-1240.798] -- 0:00:53
254000 -- (-1239.479) (-1241.520) [-1242.483] (-1240.827) * (-1243.997) (-1243.513) (-1242.685) [-1243.399] -- 0:00:52
254500 -- (-1244.703) (-1242.669) [-1241.743] (-1241.206) * (-1243.141) [-1243.495] (-1240.431) (-1240.507) -- 0:00:52
255000 -- [-1241.330] (-1240.880) (-1241.498) (-1242.900) * (-1241.350) (-1245.174) (-1244.267) [-1242.207] -- 0:00:52
Average standard deviation of split frequencies: 0.017154
255500 -- (-1240.208) (-1241.535) (-1242.727) [-1241.376] * (-1242.703) (-1241.971) (-1244.194) [-1242.323] -- 0:00:52
256000 -- (-1241.822) [-1241.071] (-1241.218) (-1241.477) * (-1244.317) (-1241.864) [-1244.976] (-1245.062) -- 0:00:52
256500 -- (-1244.804) (-1245.697) (-1241.964) [-1241.412] * (-1243.418) (-1242.262) [-1242.618] (-1243.565) -- 0:00:52
257000 -- (-1243.633) (-1239.827) [-1241.759] (-1241.088) * (-1242.674) [-1242.178] (-1240.470) (-1247.938) -- 0:00:52
257500 -- (-1240.571) (-1241.678) (-1242.847) [-1241.829] * [-1243.238] (-1239.963) (-1241.298) (-1241.128) -- 0:00:51
258000 -- (-1243.809) (-1241.675) (-1244.512) [-1241.483] * (-1240.883) (-1238.789) (-1240.994) [-1243.198] -- 0:00:51
258500 -- (-1242.907) [-1241.072] (-1240.092) (-1241.856) * [-1241.285] (-1240.787) (-1241.190) (-1241.038) -- 0:00:51
259000 -- (-1248.907) (-1243.224) (-1242.636) [-1242.428] * (-1241.162) (-1247.459) (-1242.263) [-1243.106] -- 0:00:51
259500 -- (-1242.832) (-1242.922) (-1241.916) [-1240.802] * (-1243.344) (-1242.045) (-1244.316) [-1241.117] -- 0:00:51
260000 -- (-1243.252) [-1242.103] (-1242.918) (-1240.937) * (-1241.708) (-1241.016) (-1248.022) [-1240.350] -- 0:00:51
Average standard deviation of split frequencies: 0.016371
260500 -- (-1243.569) (-1241.052) [-1244.397] (-1241.092) * (-1244.212) (-1245.661) (-1243.311) [-1243.061] -- 0:00:51
261000 -- (-1242.193) (-1241.466) [-1242.850] (-1242.078) * (-1243.661) (-1241.450) (-1242.725) [-1244.961] -- 0:00:50
261500 -- (-1242.837) [-1241.616] (-1241.064) (-1241.434) * (-1244.521) (-1242.347) [-1243.239] (-1241.664) -- 0:00:50
262000 -- [-1242.028] (-1244.613) (-1245.842) (-1244.273) * [-1246.647] (-1244.518) (-1241.995) (-1244.109) -- 0:00:50
262500 -- (-1241.581) [-1242.219] (-1244.385) (-1240.115) * [-1243.604] (-1243.698) (-1241.600) (-1241.284) -- 0:00:50
263000 -- (-1240.895) (-1243.615) (-1242.606) [-1242.799] * [-1242.646] (-1238.482) (-1241.945) (-1246.147) -- 0:00:50
263500 -- (-1240.393) [-1241.193] (-1244.820) (-1243.631) * [-1240.282] (-1240.320) (-1242.951) (-1241.099) -- 0:00:50
264000 -- (-1241.119) (-1241.161) (-1240.875) [-1239.892] * (-1241.830) (-1241.874) (-1241.377) [-1242.544] -- 0:00:50
264500 -- [-1240.899] (-1241.187) (-1241.059) (-1240.263) * [-1242.524] (-1241.335) (-1244.075) (-1241.854) -- 0:00:50
265000 -- (-1243.769) [-1243.468] (-1241.189) (-1241.366) * [-1242.460] (-1242.827) (-1240.975) (-1242.298) -- 0:00:52
Average standard deviation of split frequencies: 0.016230
265500 -- (-1246.304) (-1245.799) [-1240.080] (-1242.355) * [-1239.857] (-1243.655) (-1240.845) (-1241.479) -- 0:00:52
266000 -- (-1243.658) [-1248.329] (-1246.760) (-1242.543) * [-1241.804] (-1241.518) (-1241.776) (-1242.553) -- 0:00:52
266500 -- (-1242.076) (-1242.279) (-1244.004) [-1243.275] * [-1242.548] (-1241.783) (-1240.571) (-1244.367) -- 0:00:52
267000 -- (-1242.644) [-1243.032] (-1243.398) (-1242.000) * (-1243.139) [-1244.515] (-1239.283) (-1242.974) -- 0:00:52
267500 -- (-1241.255) (-1241.289) (-1242.374) [-1241.135] * (-1242.413) (-1243.701) [-1242.402] (-1244.860) -- 0:00:52
268000 -- [-1242.096] (-1244.072) (-1244.326) (-1241.898) * (-1242.757) [-1240.870] (-1240.872) (-1243.277) -- 0:00:51
268500 -- (-1243.450) (-1244.151) (-1241.621) [-1243.032] * (-1244.985) [-1241.075] (-1246.282) (-1242.039) -- 0:00:51
269000 -- (-1242.766) (-1241.013) (-1242.511) [-1240.762] * (-1242.921) (-1241.339) (-1245.679) [-1245.201] -- 0:00:51
269500 -- (-1240.634) [-1240.497] (-1241.820) (-1246.850) * (-1243.021) (-1241.306) [-1242.269] (-1243.871) -- 0:00:51
270000 -- [-1242.678] (-1240.481) (-1242.933) (-1244.349) * (-1242.718) (-1239.578) [-1242.682] (-1242.528) -- 0:00:51
Average standard deviation of split frequencies: 0.014575
270500 -- (-1246.775) (-1240.568) (-1244.223) [-1241.624] * (-1241.986) (-1241.565) (-1241.980) [-1242.259] -- 0:00:51
271000 -- [-1242.026] (-1243.688) (-1245.057) (-1243.136) * (-1241.575) [-1242.134] (-1242.928) (-1242.019) -- 0:00:51
271500 -- (-1241.533) (-1243.368) (-1245.889) [-1241.764] * [-1241.341] (-1242.175) (-1251.636) (-1242.670) -- 0:00:50
272000 -- (-1245.026) [-1240.382] (-1244.158) (-1242.942) * [-1242.396] (-1244.084) (-1241.867) (-1241.880) -- 0:00:50
272500 -- (-1244.950) (-1245.546) [-1246.612] (-1244.757) * (-1242.949) (-1244.107) [-1240.774] (-1243.027) -- 0:00:50
273000 -- (-1246.055) (-1241.240) [-1244.777] (-1240.135) * (-1241.358) (-1240.980) [-1243.565] (-1243.257) -- 0:00:50
273500 -- (-1242.954) (-1241.938) (-1242.992) [-1242.095] * [-1243.392] (-1240.990) (-1248.987) (-1243.977) -- 0:00:50
274000 -- (-1241.547) (-1242.955) (-1242.394) [-1240.971] * (-1242.081) (-1245.601) [-1241.635] (-1243.800) -- 0:00:50
274500 -- (-1240.646) (-1240.178) (-1242.951) [-1244.696] * [-1241.971] (-1240.767) (-1241.261) (-1243.713) -- 0:00:50
275000 -- (-1242.634) (-1244.881) (-1243.457) [-1242.758] * (-1243.274) [-1239.997] (-1241.465) (-1238.979) -- 0:00:50
Average standard deviation of split frequencies: 0.013394
275500 -- (-1243.910) (-1242.743) [-1241.195] (-1243.188) * (-1246.588) (-1240.250) (-1241.285) [-1242.627] -- 0:00:49
276000 -- [-1241.035] (-1239.801) (-1242.334) (-1242.881) * (-1245.767) [-1240.369] (-1243.055) (-1241.665) -- 0:00:49
276500 -- (-1241.074) (-1243.665) (-1244.000) [-1243.138] * (-1243.950) (-1241.072) [-1243.839] (-1241.869) -- 0:00:49
277000 -- (-1241.941) (-1239.331) (-1245.312) [-1241.837] * [-1241.565] (-1246.466) (-1245.762) (-1245.152) -- 0:00:49
277500 -- [-1242.949] (-1239.659) (-1245.133) (-1241.499) * [-1243.373] (-1245.494) (-1242.278) (-1243.483) -- 0:00:49
278000 -- [-1242.273] (-1238.560) (-1243.865) (-1242.724) * (-1244.095) (-1243.449) (-1244.100) [-1241.807] -- 0:00:49
278500 -- (-1242.984) (-1240.795) (-1242.694) [-1241.752] * [-1239.578] (-1242.875) (-1245.487) (-1241.904) -- 0:00:49
279000 -- (-1241.668) (-1241.425) [-1245.953] (-1243.160) * [-1241.441] (-1242.541) (-1244.315) (-1242.530) -- 0:00:49
279500 -- [-1240.874] (-1240.742) (-1240.666) (-1240.120) * (-1244.745) (-1241.615) [-1243.317] (-1245.006) -- 0:00:48
280000 -- (-1243.640) [-1239.330] (-1245.486) (-1240.621) * [-1243.061] (-1241.075) (-1242.381) (-1242.519) -- 0:00:51
Average standard deviation of split frequencies: 0.012995
280500 -- (-1241.974) (-1241.017) (-1245.173) [-1243.133] * [-1242.521] (-1241.911) (-1243.605) (-1244.305) -- 0:00:51
281000 -- (-1242.190) [-1242.168] (-1243.332) (-1242.642) * (-1241.163) (-1241.829) [-1241.989] (-1243.378) -- 0:00:51
281500 -- [-1241.417] (-1242.385) (-1242.921) (-1242.612) * (-1242.143) [-1241.174] (-1242.758) (-1241.657) -- 0:00:51
282000 -- (-1245.528) (-1242.797) [-1242.716] (-1244.099) * (-1242.107) (-1241.146) [-1241.619] (-1239.505) -- 0:00:50
282500 -- [-1241.796] (-1244.442) (-1247.723) (-1242.324) * (-1242.153) (-1241.638) [-1242.322] (-1242.121) -- 0:00:50
283000 -- (-1242.159) (-1243.417) (-1243.362) [-1242.988] * (-1243.389) (-1246.155) (-1241.912) [-1240.426] -- 0:00:50
283500 -- (-1242.482) [-1241.302] (-1242.670) (-1243.577) * [-1241.890] (-1243.943) (-1243.901) (-1240.761) -- 0:00:50
284000 -- (-1242.188) (-1243.085) (-1242.983) [-1240.603] * (-1241.102) [-1241.856] (-1243.967) (-1246.791) -- 0:00:50
284500 -- (-1241.928) (-1242.014) [-1240.963] (-1242.342) * (-1240.695) [-1241.571] (-1242.365) (-1246.025) -- 0:00:50
285000 -- [-1242.571] (-1242.105) (-1241.331) (-1242.240) * (-1243.834) (-1244.950) [-1243.473] (-1241.758) -- 0:00:50
Average standard deviation of split frequencies: 0.012405
285500 -- [-1241.545] (-1241.207) (-1241.257) (-1243.041) * (-1242.353) (-1240.963) [-1241.685] (-1241.964) -- 0:00:50
286000 -- (-1243.249) (-1241.672) [-1240.141] (-1241.852) * (-1244.532) (-1242.591) (-1242.987) [-1241.861] -- 0:00:49
286500 -- [-1241.248] (-1244.493) (-1240.990) (-1238.909) * (-1243.238) (-1241.647) (-1244.820) [-1242.571] -- 0:00:49
287000 -- [-1240.802] (-1242.774) (-1241.403) (-1244.390) * (-1243.052) (-1241.722) (-1247.922) [-1241.714] -- 0:00:49
287500 -- (-1241.208) [-1244.444] (-1241.809) (-1242.259) * (-1240.586) (-1241.759) (-1242.344) [-1240.945] -- 0:00:49
288000 -- [-1243.206] (-1245.670) (-1240.759) (-1243.794) * (-1245.863) [-1241.067] (-1243.130) (-1243.154) -- 0:00:49
288500 -- (-1242.005) [-1241.347] (-1239.618) (-1243.415) * [-1240.997] (-1245.150) (-1242.949) (-1246.269) -- 0:00:49
289000 -- (-1241.274) (-1244.600) [-1240.613] (-1245.581) * (-1243.508) [-1244.861] (-1242.097) (-1240.901) -- 0:00:49
289500 -- (-1243.613) (-1243.681) [-1242.539] (-1242.032) * (-1243.282) [-1241.209] (-1243.797) (-1243.026) -- 0:00:49
290000 -- (-1241.976) (-1242.113) (-1240.040) [-1242.604] * (-1245.782) (-1241.524) [-1241.950] (-1243.029) -- 0:00:48
Average standard deviation of split frequencies: 0.012974
290500 -- (-1241.963) (-1241.962) [-1242.203] (-1243.657) * (-1244.580) [-1242.986] (-1243.485) (-1245.370) -- 0:00:48
291000 -- (-1244.002) (-1241.878) [-1241.990] (-1245.840) * [-1242.244] (-1248.009) (-1244.515) (-1242.613) -- 0:00:48
291500 -- (-1248.311) (-1242.311) (-1244.053) [-1242.373] * (-1243.036) [-1246.677] (-1241.414) (-1243.872) -- 0:00:48
292000 -- (-1242.907) [-1241.923] (-1244.672) (-1242.437) * (-1241.602) [-1246.046] (-1241.944) (-1241.488) -- 0:00:48
292500 -- (-1243.320) (-1245.579) (-1241.518) [-1244.976] * (-1245.518) (-1243.229) (-1241.352) [-1241.967] -- 0:00:48
293000 -- [-1242.246] (-1245.388) (-1242.762) (-1242.305) * (-1243.518) (-1241.938) (-1240.867) [-1244.137] -- 0:00:48
293500 -- [-1245.207] (-1247.590) (-1240.931) (-1242.501) * (-1241.898) (-1244.009) [-1242.450] (-1244.731) -- 0:00:48
294000 -- (-1243.802) (-1239.576) (-1243.303) [-1242.588] * (-1243.963) (-1242.668) (-1244.239) [-1243.661] -- 0:00:48
294500 -- (-1241.536) (-1242.077) (-1243.275) [-1240.791] * [-1243.838] (-1245.885) (-1243.235) (-1242.492) -- 0:00:47
295000 -- (-1239.161) (-1243.784) (-1240.199) [-1242.732] * (-1248.404) (-1243.823) (-1242.228) [-1246.104] -- 0:00:50
Average standard deviation of split frequencies: 0.013998
295500 -- (-1243.373) (-1242.695) (-1241.505) [-1242.665] * (-1243.919) [-1241.859] (-1241.328) (-1243.426) -- 0:00:50
296000 -- (-1241.948) (-1242.862) (-1242.015) [-1240.846] * [-1245.023] (-1246.661) (-1242.328) (-1243.226) -- 0:00:49
296500 -- (-1242.516) (-1241.363) [-1240.924] (-1237.994) * [-1240.616] (-1242.814) (-1242.902) (-1242.487) -- 0:00:49
297000 -- (-1240.429) (-1243.169) (-1244.273) [-1241.612] * [-1242.427] (-1241.613) (-1244.018) (-1241.354) -- 0:00:49
297500 -- (-1241.314) (-1243.850) (-1242.880) [-1241.484] * (-1241.285) (-1241.723) (-1241.788) [-1240.173] -- 0:00:49
298000 -- (-1242.833) (-1244.931) (-1246.180) [-1241.556] * (-1243.550) (-1242.829) (-1241.377) [-1239.300] -- 0:00:49
298500 -- (-1244.579) (-1244.919) (-1243.494) [-1240.530] * [-1241.877] (-1242.485) (-1242.156) (-1240.617) -- 0:00:49
299000 -- (-1241.119) (-1243.172) [-1241.371] (-1241.487) * (-1245.331) (-1241.786) [-1244.829] (-1243.812) -- 0:00:49
299500 -- (-1241.246) (-1242.794) (-1244.907) [-1241.978] * (-1244.721) [-1243.207] (-1244.540) (-1243.889) -- 0:00:49
300000 -- (-1241.433) (-1241.537) (-1241.876) [-1241.902] * [-1242.455] (-1245.227) (-1245.090) (-1244.030) -- 0:00:48
Average standard deviation of split frequencies: 0.013781
300500 -- (-1241.313) (-1243.023) [-1242.149] (-1243.926) * (-1244.785) (-1243.422) (-1242.517) [-1243.794] -- 0:00:48
301000 -- [-1239.948] (-1243.881) (-1243.271) (-1245.828) * [-1242.158] (-1243.013) (-1245.099) (-1249.132) -- 0:00:48
301500 -- (-1241.259) (-1244.470) [-1239.830] (-1240.575) * (-1241.206) (-1243.188) [-1244.251] (-1241.742) -- 0:00:48
302000 -- (-1250.485) [-1240.787] (-1243.128) (-1241.872) * (-1244.297) (-1241.122) (-1242.410) [-1240.000] -- 0:00:48
302500 -- [-1240.746] (-1241.272) (-1242.196) (-1241.902) * (-1241.692) [-1243.186] (-1241.263) (-1245.659) -- 0:00:48
303000 -- (-1247.439) (-1243.116) [-1240.441] (-1244.325) * [-1244.449] (-1241.185) (-1240.726) (-1241.055) -- 0:00:48
303500 -- (-1245.228) (-1241.152) (-1241.057) [-1242.655] * (-1241.676) (-1242.118) (-1241.460) [-1239.418] -- 0:00:48
304000 -- (-1248.736) (-1243.866) (-1241.066) [-1243.972] * (-1242.617) (-1241.775) (-1241.896) [-1241.371] -- 0:00:48
304500 -- [-1241.541] (-1246.361) (-1241.380) (-1243.439) * (-1242.048) [-1241.338] (-1241.357) (-1242.048) -- 0:00:47
305000 -- (-1243.653) (-1243.120) (-1243.387) [-1245.010] * (-1240.756) [-1242.389] (-1242.514) (-1242.262) -- 0:00:47
Average standard deviation of split frequencies: 0.014108
305500 -- [-1241.694] (-1243.897) (-1244.386) (-1241.305) * (-1241.997) [-1243.858] (-1244.605) (-1246.295) -- 0:00:47
306000 -- [-1242.724] (-1244.043) (-1243.077) (-1244.755) * (-1243.623) (-1241.980) (-1242.169) [-1240.705] -- 0:00:47
306500 -- (-1245.332) (-1249.659) [-1241.812] (-1243.206) * (-1241.136) [-1240.847] (-1241.716) (-1243.190) -- 0:00:47
307000 -- (-1241.666) (-1245.588) (-1243.611) [-1242.050] * (-1242.159) (-1242.420) (-1241.495) [-1240.525] -- 0:00:47
307500 -- (-1241.697) [-1243.078] (-1243.538) (-1243.219) * [-1242.559] (-1243.561) (-1242.705) (-1242.331) -- 0:00:47
308000 -- [-1241.193] (-1243.388) (-1242.210) (-1242.137) * (-1245.889) (-1245.316) (-1241.201) [-1240.265] -- 0:00:47
308500 -- (-1241.444) (-1242.614) [-1241.618] (-1241.211) * [-1244.245] (-1244.146) (-1240.299) (-1243.364) -- 0:00:47
309000 -- (-1243.378) (-1242.623) [-1245.480] (-1240.570) * (-1241.304) (-1246.545) [-1241.588] (-1242.923) -- 0:00:46
309500 -- [-1241.132] (-1243.014) (-1241.315) (-1244.392) * (-1244.535) (-1246.797) (-1239.556) [-1240.950] -- 0:00:46
310000 -- (-1241.903) (-1244.133) (-1241.535) [-1243.187] * [-1244.836] (-1243.079) (-1240.948) (-1241.656) -- 0:00:48
Average standard deviation of split frequencies: 0.014056
310500 -- (-1241.347) (-1243.928) [-1244.724] (-1240.314) * (-1244.062) [-1244.498] (-1242.098) (-1241.003) -- 0:00:48
311000 -- (-1243.005) [-1240.267] (-1241.931) (-1241.302) * [-1245.854] (-1242.941) (-1240.517) (-1241.876) -- 0:00:48
311500 -- (-1240.591) (-1240.837) (-1246.458) [-1240.035] * (-1247.371) (-1240.786) (-1243.659) [-1238.326] -- 0:00:48
312000 -- (-1241.347) (-1244.072) [-1244.386] (-1241.644) * (-1241.818) [-1243.309] (-1241.750) (-1241.050) -- 0:00:48
312500 -- (-1242.187) [-1241.293] (-1243.474) (-1244.106) * [-1243.609] (-1240.815) (-1245.635) (-1242.376) -- 0:00:48
313000 -- (-1245.742) [-1241.632] (-1241.764) (-1245.742) * (-1244.400) (-1242.696) [-1245.049] (-1244.076) -- 0:00:48
313500 -- [-1239.688] (-1241.121) (-1245.011) (-1241.884) * (-1243.701) [-1242.283] (-1242.609) (-1241.399) -- 0:00:48
314000 -- [-1241.990] (-1245.655) (-1242.130) (-1241.966) * (-1242.439) (-1245.706) (-1241.690) [-1243.839] -- 0:00:48
314500 -- (-1242.287) (-1244.000) (-1241.736) [-1244.415] * (-1241.658) (-1243.084) (-1242.322) [-1244.262] -- 0:00:47
315000 -- [-1242.097] (-1242.434) (-1240.663) (-1243.901) * [-1244.064] (-1244.288) (-1242.795) (-1248.221) -- 0:00:47
Average standard deviation of split frequencies: 0.013583
315500 -- [-1240.592] (-1243.198) (-1242.290) (-1245.232) * (-1241.039) [-1241.549] (-1243.907) (-1245.588) -- 0:00:47
316000 -- (-1242.808) [-1243.873] (-1242.923) (-1242.708) * [-1242.783] (-1242.734) (-1243.583) (-1240.331) -- 0:00:47
316500 -- (-1241.563) [-1242.248] (-1243.987) (-1242.276) * [-1241.331] (-1242.683) (-1240.514) (-1238.283) -- 0:00:47
317000 -- (-1244.533) [-1241.433] (-1242.768) (-1241.711) * (-1239.764) (-1244.829) (-1241.306) [-1242.395] -- 0:00:47
317500 -- (-1243.905) [-1241.718] (-1241.685) (-1242.903) * (-1239.825) (-1242.548) [-1242.492] (-1243.073) -- 0:00:47
318000 -- (-1241.616) [-1243.181] (-1241.152) (-1241.735) * (-1241.854) (-1240.928) (-1243.369) [-1244.852] -- 0:00:47
318500 -- (-1243.791) [-1244.307] (-1242.887) (-1244.243) * (-1241.558) (-1242.190) (-1243.864) [-1242.948] -- 0:00:47
319000 -- [-1244.445] (-1244.833) (-1241.086) (-1242.827) * (-1244.209) (-1242.368) (-1242.122) [-1242.017] -- 0:00:46
319500 -- (-1241.778) (-1243.741) [-1243.588] (-1241.032) * (-1240.757) (-1243.787) (-1241.656) [-1241.575] -- 0:00:46
320000 -- (-1243.933) [-1243.333] (-1243.914) (-1243.263) * (-1243.964) (-1243.438) (-1243.168) [-1242.404] -- 0:00:46
Average standard deviation of split frequencies: 0.013618
320500 -- (-1242.094) [-1241.537] (-1243.510) (-1242.895) * (-1240.871) (-1240.752) (-1241.767) [-1243.785] -- 0:00:46
321000 -- (-1243.275) (-1242.556) (-1243.790) [-1242.043] * [-1241.909] (-1241.062) (-1242.670) (-1241.613) -- 0:00:46
321500 -- (-1243.211) (-1242.887) (-1241.059) [-1241.012] * (-1243.035) (-1241.669) (-1241.950) [-1242.166] -- 0:00:46
322000 -- (-1241.830) [-1241.551] (-1241.004) (-1241.386) * (-1243.802) (-1240.170) [-1243.986] (-1243.986) -- 0:00:46
322500 -- (-1241.847) (-1241.151) (-1241.138) [-1242.151] * (-1241.652) [-1242.212] (-1243.148) (-1243.544) -- 0:00:46
323000 -- (-1241.719) (-1245.313) (-1242.231) [-1240.480] * (-1240.173) (-1243.938) (-1243.304) [-1241.327] -- 0:00:46
323500 -- (-1243.357) (-1248.293) (-1244.642) [-1241.087] * (-1241.005) (-1242.359) [-1241.922] (-1240.481) -- 0:00:46
324000 -- [-1241.521] (-1242.399) (-1243.238) (-1243.506) * (-1245.816) [-1242.297] (-1243.566) (-1244.729) -- 0:00:45
324500 -- [-1241.166] (-1243.850) (-1241.977) (-1241.316) * (-1244.290) (-1242.079) [-1244.384] (-1243.755) -- 0:00:45
325000 -- (-1241.856) (-1241.140) (-1244.829) [-1241.568] * (-1244.298) (-1241.142) [-1241.430] (-1240.049) -- 0:00:47
Average standard deviation of split frequencies: 0.013775
325500 -- [-1242.256] (-1244.302) (-1243.610) (-1241.256) * (-1242.927) (-1241.133) [-1242.126] (-1244.685) -- 0:00:47
326000 -- (-1243.608) (-1240.804) (-1241.409) [-1240.654] * (-1240.838) (-1242.807) (-1240.963) [-1240.074] -- 0:00:47
326500 -- (-1242.668) (-1241.443) (-1248.590) [-1238.609] * [-1240.555] (-1240.928) (-1241.590) (-1238.795) -- 0:00:47
327000 -- (-1242.968) [-1242.855] (-1247.436) (-1240.751) * [-1240.840] (-1241.531) (-1241.920) (-1241.085) -- 0:00:47
327500 -- (-1241.811) [-1240.561] (-1245.752) (-1241.588) * [-1244.148] (-1241.500) (-1243.692) (-1241.297) -- 0:00:47
328000 -- (-1243.615) [-1239.517] (-1241.168) (-1240.409) * (-1242.034) [-1240.401] (-1243.811) (-1240.775) -- 0:00:47
328500 -- (-1243.577) [-1239.715] (-1240.971) (-1239.259) * (-1240.167) (-1245.074) (-1247.203) [-1240.507] -- 0:00:47
329000 -- (-1241.396) (-1245.347) (-1242.582) [-1240.327] * (-1241.011) (-1246.019) [-1241.218] (-1243.637) -- 0:00:46
329500 -- [-1242.854] (-1245.901) (-1241.283) (-1243.265) * (-1238.462) (-1244.243) (-1244.490) [-1240.669] -- 0:00:46
330000 -- (-1242.946) (-1242.607) [-1241.291] (-1242.291) * (-1241.556) [-1244.458] (-1241.600) (-1241.468) -- 0:00:46
Average standard deviation of split frequencies: 0.013056
330500 -- (-1242.451) [-1244.821] (-1243.016) (-1241.950) * (-1243.572) [-1243.857] (-1241.415) (-1240.711) -- 0:00:46
331000 -- [-1241.258] (-1240.515) (-1243.052) (-1241.034) * (-1241.236) (-1243.277) (-1240.919) [-1241.508] -- 0:00:46
331500 -- (-1241.171) [-1242.104] (-1245.135) (-1241.010) * [-1245.077] (-1240.761) (-1243.807) (-1240.737) -- 0:00:46
332000 -- (-1246.828) (-1242.763) [-1241.050] (-1240.137) * (-1245.656) [-1243.754] (-1242.388) (-1240.817) -- 0:00:46
332500 -- (-1240.873) (-1242.881) (-1241.171) [-1241.909] * (-1244.048) (-1240.776) (-1242.849) [-1240.708] -- 0:00:46
333000 -- (-1241.601) [-1242.445] (-1241.538) (-1240.125) * (-1241.815) (-1241.359) [-1249.196] (-1240.485) -- 0:00:46
333500 -- (-1245.258) (-1239.986) (-1241.538) [-1239.763] * (-1242.931) [-1240.791] (-1240.328) (-1240.889) -- 0:00:45
334000 -- [-1242.905] (-1242.818) (-1241.556) (-1242.923) * (-1241.599) [-1240.850] (-1241.836) (-1237.386) -- 0:00:45
334500 -- [-1244.068] (-1243.582) (-1242.491) (-1242.318) * (-1239.308) [-1240.369] (-1242.018) (-1241.252) -- 0:00:45
335000 -- (-1241.984) (-1244.452) (-1243.618) [-1239.985] * (-1242.221) (-1241.075) [-1242.267] (-1246.324) -- 0:00:45
Average standard deviation of split frequencies: 0.012479
335500 -- [-1241.025] (-1245.485) (-1243.176) (-1241.698) * [-1242.018] (-1239.570) (-1243.795) (-1243.871) -- 0:00:45
336000 -- (-1243.207) (-1242.523) [-1241.466] (-1239.511) * (-1243.921) (-1244.460) [-1245.087] (-1244.071) -- 0:00:45
336500 -- (-1243.767) (-1245.842) [-1241.374] (-1239.140) * (-1244.548) [-1242.876] (-1243.827) (-1242.199) -- 0:00:45
337000 -- (-1247.274) (-1242.936) (-1244.473) [-1240.461] * (-1242.144) (-1244.069) [-1241.290] (-1242.092) -- 0:00:45
337500 -- (-1243.598) [-1241.771] (-1246.642) (-1243.981) * [-1244.287] (-1243.845) (-1241.731) (-1241.864) -- 0:00:45
338000 -- (-1242.679) [-1242.627] (-1242.565) (-1240.268) * (-1244.592) [-1238.854] (-1240.346) (-1241.082) -- 0:00:45
338500 -- (-1241.774) [-1242.772] (-1242.434) (-1240.394) * (-1242.482) (-1242.385) [-1245.623] (-1241.556) -- 0:00:44
339000 -- [-1240.154] (-1240.589) (-1239.347) (-1243.539) * (-1242.078) [-1242.594] (-1240.655) (-1241.812) -- 0:00:44
339500 -- [-1240.155] (-1240.507) (-1243.698) (-1248.265) * (-1241.889) (-1238.750) (-1242.422) [-1241.357] -- 0:00:44
340000 -- (-1243.473) (-1240.737) [-1240.391] (-1241.595) * (-1243.401) [-1241.468] (-1242.242) (-1241.962) -- 0:00:46
Average standard deviation of split frequencies: 0.013915
340500 -- (-1241.995) (-1241.636) (-1242.964) [-1241.544] * [-1243.827] (-1240.865) (-1242.168) (-1241.407) -- 0:00:46
341000 -- (-1244.124) (-1243.797) (-1242.289) [-1240.410] * (-1242.947) (-1241.135) (-1241.296) [-1240.326] -- 0:00:46
341500 -- [-1245.988] (-1244.546) (-1243.202) (-1242.901) * [-1241.715] (-1242.697) (-1245.629) (-1241.841) -- 0:00:46
342000 -- (-1244.750) [-1243.064] (-1245.421) (-1244.733) * (-1244.509) [-1241.126] (-1241.434) (-1242.741) -- 0:00:46
342500 -- (-1242.342) (-1239.762) (-1241.755) [-1239.876] * (-1242.390) [-1240.129] (-1244.455) (-1240.714) -- 0:00:46
343000 -- (-1242.770) [-1242.335] (-1243.155) (-1243.704) * (-1241.461) (-1244.165) [-1241.368] (-1249.802) -- 0:00:45
343500 -- (-1242.847) (-1243.543) [-1242.971] (-1243.864) * [-1242.834] (-1241.032) (-1241.778) (-1244.030) -- 0:00:45
344000 -- (-1247.916) (-1244.296) (-1241.245) [-1240.677] * [-1240.733] (-1240.927) (-1245.436) (-1241.476) -- 0:00:45
344500 -- (-1244.648) (-1245.581) [-1243.363] (-1241.873) * [-1241.028] (-1243.300) (-1242.041) (-1240.766) -- 0:00:45
345000 -- (-1244.364) (-1243.933) (-1243.566) [-1242.334] * (-1240.175) [-1241.858] (-1241.307) (-1239.034) -- 0:00:45
Average standard deviation of split frequencies: 0.012692
345500 -- (-1240.073) (-1240.516) [-1242.522] (-1240.961) * (-1245.557) (-1242.014) (-1241.699) [-1238.294] -- 0:00:45
346000 -- [-1241.143] (-1241.779) (-1241.906) (-1238.294) * (-1243.092) (-1241.637) [-1241.211] (-1240.160) -- 0:00:45
346500 -- [-1242.202] (-1246.694) (-1242.526) (-1241.095) * (-1240.970) [-1242.562] (-1243.548) (-1241.093) -- 0:00:45
347000 -- [-1240.011] (-1248.922) (-1244.267) (-1241.527) * [-1244.682] (-1243.342) (-1241.066) (-1243.814) -- 0:00:45
347500 -- (-1241.463) (-1242.447) [-1242.869] (-1244.949) * (-1245.292) (-1246.344) (-1241.619) [-1241.705] -- 0:00:45
348000 -- (-1244.204) [-1242.145] (-1245.437) (-1240.963) * [-1241.800] (-1247.943) (-1242.144) (-1241.274) -- 0:00:44
348500 -- (-1239.118) (-1246.536) (-1245.472) [-1241.274] * [-1242.042] (-1242.335) (-1242.861) (-1246.527) -- 0:00:44
349000 -- (-1240.903) (-1243.856) [-1243.605] (-1242.072) * [-1241.800] (-1241.953) (-1243.335) (-1241.160) -- 0:00:44
349500 -- (-1242.125) (-1239.485) (-1246.363) [-1241.820] * (-1241.503) (-1243.405) [-1241.457] (-1241.994) -- 0:00:44
350000 -- (-1242.995) [-1241.401] (-1243.066) (-1241.500) * (-1241.492) [-1243.890] (-1241.786) (-1242.837) -- 0:00:44
Average standard deviation of split frequencies: 0.012594
350500 -- (-1245.730) (-1242.579) (-1242.368) [-1240.992] * (-1241.590) (-1242.907) [-1240.690] (-1245.459) -- 0:00:44
351000 -- (-1242.828) [-1239.945] (-1243.070) (-1241.719) * (-1240.646) (-1242.415) (-1242.646) [-1245.052] -- 0:00:44
351500 -- (-1241.722) (-1241.371) [-1240.836] (-1243.040) * (-1240.541) (-1242.537) [-1240.530] (-1239.537) -- 0:00:44
352000 -- (-1241.852) (-1240.941) (-1243.231) [-1246.047] * (-1243.133) [-1244.696] (-1241.091) (-1240.018) -- 0:00:44
352500 -- (-1241.343) (-1245.554) (-1245.166) [-1241.206] * (-1239.411) (-1242.706) [-1243.106] (-1240.934) -- 0:00:44
353000 -- [-1243.798] (-1242.522) (-1242.097) (-1240.079) * (-1246.795) (-1242.862) (-1242.886) [-1241.674] -- 0:00:43
353500 -- (-1245.734) (-1242.606) [-1244.133] (-1241.245) * (-1241.100) (-1242.859) (-1239.078) [-1240.817] -- 0:00:43
354000 -- (-1244.417) (-1241.267) (-1242.118) [-1241.919] * (-1245.615) [-1242.710] (-1244.495) (-1243.270) -- 0:00:43
354500 -- (-1242.564) [-1242.160] (-1242.423) (-1241.980) * (-1241.527) (-1245.199) [-1240.796] (-1243.954) -- 0:00:43
355000 -- (-1241.420) [-1241.565] (-1241.412) (-1243.923) * [-1242.247] (-1243.041) (-1241.011) (-1241.754) -- 0:00:45
Average standard deviation of split frequencies: 0.012432
355500 -- (-1241.722) [-1240.611] (-1240.576) (-1243.528) * (-1241.261) (-1242.840) [-1240.913] (-1243.573) -- 0:00:45
356000 -- (-1241.266) (-1241.869) [-1241.601] (-1241.319) * [-1241.027] (-1242.879) (-1243.015) (-1243.514) -- 0:00:45
356500 -- (-1242.778) (-1244.993) [-1239.576] (-1244.233) * [-1245.127] (-1241.192) (-1242.215) (-1243.257) -- 0:00:45
357000 -- (-1244.167) [-1239.824] (-1245.526) (-1241.966) * (-1250.312) (-1243.805) (-1242.116) [-1248.444] -- 0:00:45
357500 -- (-1250.147) [-1241.193] (-1240.777) (-1243.068) * [-1243.957] (-1241.204) (-1242.494) (-1246.603) -- 0:00:44
358000 -- (-1246.225) [-1241.560] (-1247.929) (-1241.896) * (-1242.237) (-1241.210) [-1242.334] (-1241.361) -- 0:00:44
358500 -- (-1241.952) (-1240.653) [-1241.403] (-1243.088) * (-1243.630) (-1243.226) [-1241.816] (-1242.057) -- 0:00:44
359000 -- (-1243.382) (-1241.376) [-1239.412] (-1246.827) * (-1242.861) [-1245.725] (-1241.769) (-1240.982) -- 0:00:44
359500 -- (-1244.738) (-1241.675) (-1242.643) [-1244.457] * (-1241.934) (-1242.834) (-1240.716) [-1240.673] -- 0:00:44
360000 -- (-1240.358) (-1241.034) (-1241.547) [-1242.354] * (-1242.004) (-1241.910) [-1241.902] (-1238.960) -- 0:00:44
Average standard deviation of split frequencies: 0.012864
360500 -- (-1241.167) [-1240.035] (-1244.712) (-1242.738) * (-1241.845) [-1242.687] (-1243.962) (-1240.818) -- 0:00:44
361000 -- (-1241.706) (-1242.538) [-1241.389] (-1241.065) * (-1241.938) (-1242.697) (-1243.345) [-1243.725] -- 0:00:44
361500 -- (-1241.127) (-1246.665) (-1249.176) [-1245.417] * (-1241.734) [-1242.475] (-1245.097) (-1240.880) -- 0:00:44
362000 -- (-1242.539) [-1242.032] (-1243.141) (-1242.020) * [-1241.117] (-1241.746) (-1244.337) (-1245.941) -- 0:00:44
362500 -- (-1242.039) (-1243.258) (-1244.629) [-1244.677] * (-1241.999) (-1240.195) (-1244.236) [-1242.480] -- 0:00:43
363000 -- [-1241.615] (-1246.346) (-1241.699) (-1247.393) * (-1240.831) (-1242.484) (-1244.514) [-1242.463] -- 0:00:43
363500 -- [-1239.407] (-1241.848) (-1242.767) (-1240.501) * (-1241.187) [-1241.854] (-1245.240) (-1241.138) -- 0:00:43
364000 -- (-1238.831) (-1248.025) (-1244.295) [-1242.089] * (-1241.405) [-1242.115] (-1247.201) (-1245.727) -- 0:00:43
364500 -- [-1241.682] (-1242.839) (-1244.342) (-1243.325) * (-1241.736) [-1243.500] (-1247.129) (-1242.563) -- 0:00:43
365000 -- (-1243.686) [-1241.956] (-1242.164) (-1244.948) * (-1244.006) (-1242.942) [-1245.155] (-1243.399) -- 0:00:43
Average standard deviation of split frequencies: 0.013287
365500 -- (-1242.248) [-1244.194] (-1242.646) (-1239.301) * [-1241.415] (-1241.295) (-1241.710) (-1243.120) -- 0:00:43
366000 -- [-1244.013] (-1242.756) (-1239.831) (-1242.605) * (-1242.957) [-1241.814] (-1240.682) (-1242.945) -- 0:00:43
366500 -- (-1242.481) (-1239.663) (-1241.107) [-1238.469] * (-1245.157) (-1243.066) (-1241.531) [-1239.404] -- 0:00:43
367000 -- (-1241.583) [-1241.558] (-1239.932) (-1242.652) * (-1241.475) (-1243.118) [-1241.618] (-1242.283) -- 0:00:43
367500 -- (-1244.807) (-1244.101) [-1244.349] (-1242.569) * (-1242.391) [-1241.687] (-1245.669) (-1238.861) -- 0:00:43
368000 -- (-1242.142) [-1242.332] (-1243.349) (-1248.094) * (-1240.840) (-1243.489) [-1241.308] (-1241.291) -- 0:00:42
368500 -- (-1239.895) (-1243.856) [-1243.113] (-1241.533) * (-1240.642) (-1240.552) (-1241.329) [-1238.918] -- 0:00:42
369000 -- [-1241.643] (-1241.395) (-1241.071) (-1243.974) * (-1242.209) (-1242.560) (-1242.930) [-1245.122] -- 0:00:42
369500 -- (-1241.435) (-1243.502) [-1241.753] (-1243.613) * (-1241.485) (-1240.962) (-1241.779) [-1241.359] -- 0:00:42
370000 -- (-1249.794) (-1244.913) (-1242.018) [-1242.644] * (-1241.821) (-1238.631) [-1242.986] (-1238.616) -- 0:00:44
Average standard deviation of split frequencies: 0.013521
370500 -- (-1241.563) [-1244.391] (-1241.900) (-1241.810) * (-1243.404) [-1240.965] (-1243.722) (-1244.991) -- 0:00:44
371000 -- (-1240.062) [-1241.216] (-1242.114) (-1242.900) * (-1242.022) [-1243.016] (-1239.339) (-1243.888) -- 0:00:44
371500 -- (-1243.904) (-1241.718) (-1241.068) [-1241.491] * [-1240.788] (-1240.832) (-1240.032) (-1243.056) -- 0:00:43
372000 -- (-1243.534) (-1243.282) [-1246.214] (-1244.591) * (-1240.847) [-1241.946] (-1242.100) (-1240.578) -- 0:00:43
372500 -- [-1241.537] (-1241.488) (-1245.751) (-1241.961) * (-1242.118) (-1241.813) [-1243.219] (-1241.694) -- 0:00:43
373000 -- (-1244.885) (-1241.213) [-1241.442] (-1241.749) * (-1245.139) [-1241.209] (-1241.528) (-1242.396) -- 0:00:43
373500 -- (-1246.558) (-1241.354) [-1241.935] (-1241.965) * (-1247.507) [-1241.182] (-1242.219) (-1242.568) -- 0:00:43
374000 -- (-1241.883) (-1241.865) (-1240.807) [-1243.430] * [-1241.867] (-1243.028) (-1243.620) (-1242.979) -- 0:00:43
374500 -- (-1247.232) [-1242.427] (-1240.607) (-1242.814) * [-1242.236] (-1244.196) (-1243.083) (-1243.421) -- 0:00:43
375000 -- [-1243.996] (-1245.114) (-1244.109) (-1242.455) * (-1246.088) [-1241.406] (-1242.853) (-1240.680) -- 0:00:43
Average standard deviation of split frequencies: 0.013593
375500 -- (-1241.721) [-1242.660] (-1242.450) (-1242.044) * (-1242.104) (-1241.225) (-1244.181) [-1240.437] -- 0:00:43
376000 -- (-1242.436) [-1243.232] (-1244.369) (-1239.179) * (-1242.063) (-1241.071) (-1243.624) [-1239.430] -- 0:00:43
376500 -- [-1242.558] (-1242.602) (-1241.662) (-1242.134) * (-1243.167) [-1241.970] (-1241.735) (-1242.140) -- 0:00:43
377000 -- (-1242.372) (-1243.516) (-1242.997) [-1243.915] * [-1249.695] (-1246.855) (-1243.690) (-1242.806) -- 0:00:42
377500 -- [-1241.351] (-1241.525) (-1243.871) (-1240.847) * (-1246.227) (-1247.213) [-1243.581] (-1240.349) -- 0:00:42
378000 -- (-1245.034) (-1242.649) (-1241.206) [-1240.841] * (-1241.607) [-1244.365] (-1241.729) (-1243.457) -- 0:00:42
378500 -- (-1245.324) (-1243.878) [-1240.242] (-1240.479) * (-1240.179) (-1243.789) (-1241.719) [-1242.510] -- 0:00:42
379000 -- (-1241.338) (-1241.556) (-1243.214) [-1242.107] * [-1239.600] (-1242.510) (-1242.830) (-1242.530) -- 0:00:42
379500 -- [-1240.890] (-1241.570) (-1242.032) (-1239.493) * (-1243.910) (-1243.071) (-1245.542) [-1242.820] -- 0:00:42
380000 -- [-1240.186] (-1245.740) (-1241.674) (-1238.735) * [-1243.595] (-1242.157) (-1246.629) (-1241.762) -- 0:00:42
Average standard deviation of split frequencies: 0.013231
380500 -- [-1242.843] (-1243.466) (-1245.097) (-1245.316) * (-1241.951) [-1244.050] (-1242.806) (-1240.635) -- 0:00:42
381000 -- [-1240.968] (-1243.151) (-1248.575) (-1240.732) * (-1241.510) (-1243.967) (-1242.669) [-1241.777] -- 0:00:42
381500 -- (-1241.845) (-1242.819) (-1242.546) [-1242.013] * (-1243.055) [-1242.281] (-1244.682) (-1247.617) -- 0:00:42
382000 -- [-1243.513] (-1244.366) (-1245.227) (-1240.713) * (-1240.699) (-1245.129) [-1242.737] (-1242.312) -- 0:00:42
382500 -- (-1244.519) (-1242.584) (-1242.304) [-1242.316] * (-1243.509) (-1241.193) (-1242.847) [-1240.331] -- 0:00:41
383000 -- (-1244.016) (-1242.572) (-1243.753) [-1243.115] * (-1243.909) (-1241.893) [-1241.510] (-1241.716) -- 0:00:41
383500 -- (-1242.456) (-1243.333) (-1244.293) [-1244.574] * (-1243.380) (-1244.620) (-1240.889) [-1243.036] -- 0:00:41
384000 -- (-1242.225) (-1243.023) [-1242.637] (-1242.535) * [-1241.051] (-1242.007) (-1241.188) (-1239.678) -- 0:00:41
384500 -- (-1240.216) (-1241.593) (-1242.088) [-1241.240] * (-1240.581) (-1243.201) (-1242.791) [-1241.072] -- 0:00:41
385000 -- (-1244.316) (-1241.097) (-1241.656) [-1240.141] * (-1244.145) [-1241.853] (-1242.349) (-1241.975) -- 0:00:41
Average standard deviation of split frequencies: 0.013562
385500 -- [-1243.856] (-1242.492) (-1243.085) (-1240.662) * (-1241.257) (-1241.109) [-1240.124] (-1241.467) -- 0:00:43
386000 -- (-1246.165) (-1241.679) (-1244.467) [-1241.726] * [-1243.158] (-1241.768) (-1241.983) (-1239.878) -- 0:00:42
386500 -- (-1242.162) (-1239.912) (-1242.474) [-1241.331] * (-1245.414) (-1241.804) [-1242.211] (-1242.918) -- 0:00:42
387000 -- (-1237.222) (-1248.605) [-1242.281] (-1244.973) * (-1244.722) [-1244.281] (-1241.897) (-1242.365) -- 0:00:42
387500 -- [-1244.806] (-1244.651) (-1241.763) (-1240.820) * (-1242.122) [-1245.283] (-1241.325) (-1242.450) -- 0:00:42
388000 -- (-1241.359) [-1243.497] (-1241.783) (-1243.718) * (-1241.938) (-1241.612) [-1243.656] (-1242.570) -- 0:00:42
388500 -- (-1240.978) (-1240.440) (-1243.761) [-1240.664] * (-1241.358) [-1241.926] (-1243.305) (-1246.346) -- 0:00:42
389000 -- (-1241.257) [-1241.245] (-1244.442) (-1240.928) * (-1244.334) [-1241.698] (-1242.832) (-1241.009) -- 0:00:42
389500 -- (-1241.601) (-1242.554) (-1247.338) [-1241.777] * (-1242.308) (-1242.205) [-1243.618] (-1243.776) -- 0:00:42
390000 -- (-1244.468) (-1243.030) [-1241.518] (-1241.287) * (-1242.668) [-1242.057] (-1244.582) (-1243.028) -- 0:00:42
Average standard deviation of split frequencies: 0.013908
390500 -- (-1242.615) (-1243.114) [-1241.743] (-1241.120) * (-1244.950) (-1241.840) (-1241.905) [-1241.710] -- 0:00:42
391000 -- (-1241.956) (-1245.009) (-1240.978) [-1240.698] * [-1241.396] (-1242.585) (-1241.864) (-1241.500) -- 0:00:42
391500 -- (-1241.169) (-1242.929) [-1241.451] (-1241.236) * [-1240.686] (-1241.324) (-1244.214) (-1238.895) -- 0:00:41
392000 -- (-1242.762) (-1242.352) [-1242.528] (-1242.536) * (-1240.782) (-1246.708) [-1242.322] (-1242.077) -- 0:00:41
392500 -- (-1241.707) (-1244.299) [-1242.503] (-1243.180) * (-1241.092) (-1242.746) (-1241.437) [-1240.535] -- 0:00:41
393000 -- [-1241.460] (-1241.256) (-1242.415) (-1245.209) * (-1241.513) (-1241.518) (-1244.464) [-1241.472] -- 0:00:41
393500 -- [-1241.531] (-1244.753) (-1244.084) (-1242.994) * (-1243.249) (-1240.463) [-1243.327] (-1242.026) -- 0:00:41
394000 -- (-1242.193) (-1241.699) [-1242.018] (-1240.975) * [-1240.873] (-1242.467) (-1244.057) (-1241.523) -- 0:00:41
394500 -- (-1241.145) (-1243.983) (-1243.515) [-1241.259] * (-1240.610) (-1241.922) [-1247.275] (-1242.666) -- 0:00:41
395000 -- (-1241.177) [-1238.702] (-1245.234) (-1242.437) * (-1243.777) [-1242.180] (-1242.354) (-1243.987) -- 0:00:41
Average standard deviation of split frequencies: 0.013533
395500 -- (-1241.673) [-1242.928] (-1242.437) (-1241.961) * (-1241.928) (-1240.926) (-1243.469) [-1241.006] -- 0:00:41
396000 -- (-1245.485) (-1242.335) (-1243.586) [-1240.777] * (-1242.677) [-1240.121] (-1243.824) (-1240.360) -- 0:00:41
396500 -- (-1245.215) (-1245.015) [-1242.392] (-1241.293) * (-1245.681) (-1241.008) (-1244.816) [-1243.238] -- 0:00:41
397000 -- (-1242.683) (-1242.732) [-1243.659] (-1241.277) * (-1245.001) [-1241.499] (-1244.456) (-1241.481) -- 0:00:41
397500 -- (-1241.752) (-1243.679) [-1241.734] (-1241.008) * (-1240.821) (-1241.366) (-1242.293) [-1242.303] -- 0:00:40
398000 -- (-1246.060) (-1244.657) [-1241.803] (-1240.904) * (-1243.267) (-1242.279) [-1241.117] (-1241.532) -- 0:00:40
398500 -- (-1246.498) (-1243.949) [-1242.354] (-1242.039) * (-1247.067) [-1240.963] (-1241.149) (-1240.920) -- 0:00:40
399000 -- (-1242.129) (-1245.423) (-1244.059) [-1240.981] * (-1242.113) (-1241.621) (-1242.829) [-1246.948] -- 0:00:40
399500 -- (-1243.420) (-1241.952) (-1242.937) [-1242.770] * (-1243.114) [-1242.100] (-1244.494) (-1242.876) -- 0:00:40
400000 -- (-1241.742) (-1239.887) [-1242.866] (-1240.543) * (-1244.779) (-1243.287) (-1244.803) [-1240.459] -- 0:00:40
Average standard deviation of split frequencies: 0.013007
400500 -- (-1248.223) (-1241.690) (-1242.183) [-1241.676] * (-1243.700) (-1245.185) (-1244.911) [-1241.710] -- 0:00:41
401000 -- (-1243.193) (-1242.552) [-1242.332] (-1245.883) * (-1244.197) (-1241.418) (-1246.196) [-1241.299] -- 0:00:41
401500 -- [-1245.419] (-1246.564) (-1244.655) (-1244.599) * (-1242.297) (-1242.279) (-1242.124) [-1242.699] -- 0:00:41
402000 -- [-1242.547] (-1242.836) (-1243.485) (-1242.177) * (-1242.423) (-1243.053) [-1240.926] (-1243.014) -- 0:00:41
402500 -- (-1242.259) [-1243.275] (-1242.378) (-1241.474) * (-1249.722) (-1242.189) [-1242.380] (-1242.377) -- 0:00:41
403000 -- (-1243.025) (-1241.438) [-1241.857] (-1243.100) * (-1246.943) [-1242.734] (-1244.280) (-1245.549) -- 0:00:41
403500 -- (-1241.245) (-1242.242) [-1241.722] (-1243.857) * (-1242.776) (-1240.974) (-1241.099) [-1241.805] -- 0:00:41
404000 -- [-1242.360] (-1244.903) (-1243.686) (-1244.787) * (-1242.823) (-1241.403) [-1243.124] (-1242.131) -- 0:00:41
404500 -- (-1243.117) (-1246.319) [-1242.218] (-1242.250) * (-1248.600) (-1243.428) (-1243.105) [-1246.019] -- 0:00:41
405000 -- (-1242.124) (-1241.763) [-1241.299] (-1242.435) * [-1243.335] (-1243.144) (-1243.400) (-1243.734) -- 0:00:41
Average standard deviation of split frequencies: 0.012955
405500 -- (-1241.247) [-1240.737] (-1240.600) (-1244.301) * (-1241.235) (-1242.106) [-1242.778] (-1242.508) -- 0:00:41
406000 -- (-1246.097) (-1241.830) [-1242.194] (-1241.378) * (-1242.198) (-1241.673) [-1243.844] (-1242.663) -- 0:00:40
406500 -- (-1242.556) [-1241.227] (-1249.338) (-1242.809) * (-1241.272) [-1242.722] (-1250.879) (-1243.596) -- 0:00:40
407000 -- (-1244.183) [-1242.656] (-1244.305) (-1241.609) * [-1241.104] (-1244.406) (-1251.249) (-1244.279) -- 0:00:40
407500 -- (-1242.611) (-1242.722) [-1246.428] (-1241.230) * (-1242.903) (-1243.091) [-1241.695] (-1243.425) -- 0:00:40
408000 -- [-1242.444] (-1245.621) (-1244.192) (-1241.443) * (-1240.182) (-1243.090) (-1240.784) [-1241.232] -- 0:00:40
408500 -- (-1242.768) (-1243.930) [-1242.925] (-1241.699) * [-1242.463] (-1247.158) (-1241.484) (-1242.313) -- 0:00:40
409000 -- [-1241.102] (-1242.733) (-1245.452) (-1242.714) * (-1242.669) (-1242.083) [-1244.054] (-1247.015) -- 0:00:40
409500 -- (-1240.849) (-1248.671) (-1239.003) [-1240.911] * (-1242.454) (-1241.437) (-1239.084) [-1242.978] -- 0:00:40
410000 -- (-1241.655) [-1239.068] (-1241.159) (-1242.272) * (-1242.022) (-1244.159) [-1241.486] (-1242.717) -- 0:00:40
Average standard deviation of split frequencies: 0.012436
410500 -- (-1242.111) [-1241.066] (-1241.135) (-1245.318) * (-1244.485) (-1241.402) [-1240.680] (-1245.332) -- 0:00:40
411000 -- (-1240.512) [-1242.761] (-1244.480) (-1245.977) * (-1241.238) (-1241.572) [-1241.541] (-1246.232) -- 0:00:40
411500 -- (-1241.768) [-1242.323] (-1243.773) (-1244.428) * (-1242.246) (-1242.329) (-1242.704) [-1242.598] -- 0:00:40
412000 -- (-1239.743) (-1246.395) [-1241.337] (-1244.184) * (-1241.468) [-1242.400] (-1244.342) (-1245.883) -- 0:00:39
412500 -- (-1239.851) (-1240.887) (-1241.156) [-1243.121] * [-1241.590] (-1241.778) (-1240.262) (-1244.129) -- 0:00:39
413000 -- (-1241.136) (-1240.008) (-1242.950) [-1242.477] * (-1242.852) (-1244.439) [-1241.147] (-1243.151) -- 0:00:39
413500 -- (-1241.648) [-1243.249] (-1242.874) (-1242.049) * [-1241.639] (-1241.697) (-1243.785) (-1242.774) -- 0:00:39
414000 -- [-1240.292] (-1244.333) (-1244.144) (-1240.817) * [-1245.423] (-1242.046) (-1242.198) (-1246.685) -- 0:00:39
414500 -- (-1241.401) (-1242.740) (-1241.621) [-1241.449] * (-1240.900) (-1240.404) (-1243.359) [-1243.417] -- 0:00:39
415000 -- (-1241.883) (-1242.373) [-1241.131] (-1240.863) * (-1240.912) (-1245.246) [-1241.324] (-1242.815) -- 0:00:39
Average standard deviation of split frequencies: 0.012276
415500 -- (-1248.616) (-1240.723) (-1240.984) [-1241.432] * [-1241.799] (-1246.239) (-1239.549) (-1243.489) -- 0:00:40
416000 -- [-1246.622] (-1243.535) (-1243.422) (-1241.193) * [-1241.272] (-1254.357) (-1240.849) (-1242.312) -- 0:00:40
416500 -- [-1246.841] (-1240.336) (-1243.892) (-1242.358) * (-1242.877) (-1242.936) [-1241.152] (-1241.635) -- 0:00:40
417000 -- (-1241.707) (-1240.690) [-1241.502] (-1240.689) * (-1244.393) (-1243.209) [-1241.287] (-1248.788) -- 0:00:40
417500 -- [-1240.360] (-1242.646) (-1242.221) (-1240.958) * (-1242.209) (-1243.583) [-1244.634] (-1243.313) -- 0:00:40
418000 -- [-1241.340] (-1243.282) (-1241.644) (-1240.947) * (-1242.513) (-1241.032) [-1242.760] (-1241.629) -- 0:00:40
418500 -- (-1239.884) [-1241.318] (-1241.645) (-1240.883) * (-1245.138) [-1243.647] (-1241.223) (-1244.684) -- 0:00:40
419000 -- (-1241.219) [-1243.006] (-1244.005) (-1244.670) * (-1242.445) (-1244.816) (-1246.394) [-1239.855] -- 0:00:40
419500 -- (-1238.966) (-1242.560) [-1242.795] (-1242.092) * [-1241.270] (-1242.538) (-1240.820) (-1245.143) -- 0:00:40
420000 -- (-1240.016) [-1241.885] (-1244.481) (-1247.108) * [-1241.398] (-1242.507) (-1239.534) (-1243.069) -- 0:00:40
Average standard deviation of split frequencies: 0.011973
420500 -- [-1245.387] (-1245.258) (-1242.672) (-1244.095) * (-1243.321) [-1243.642] (-1240.652) (-1242.052) -- 0:00:39
421000 -- (-1243.645) (-1241.296) [-1243.174] (-1241.539) * (-1244.951) [-1243.402] (-1242.467) (-1244.199) -- 0:00:39
421500 -- (-1242.511) (-1239.862) [-1241.866] (-1241.488) * (-1242.031) (-1244.607) (-1241.198) [-1240.636] -- 0:00:39
422000 -- [-1245.180] (-1243.732) (-1240.979) (-1241.428) * (-1242.062) (-1241.601) [-1243.470] (-1244.736) -- 0:00:39
422500 -- [-1242.210] (-1244.172) (-1240.087) (-1241.974) * (-1242.749) (-1241.753) [-1243.599] (-1243.442) -- 0:00:39
423000 -- (-1244.490) (-1247.129) (-1241.531) [-1240.717] * (-1243.841) [-1241.520] (-1240.741) (-1243.596) -- 0:00:39
423500 -- (-1242.939) (-1240.926) (-1244.858) [-1243.093] * (-1242.208) (-1242.033) [-1241.791] (-1250.259) -- 0:00:39
424000 -- [-1239.138] (-1245.811) (-1240.207) (-1243.416) * (-1243.031) (-1242.108) [-1239.702] (-1246.045) -- 0:00:39
424500 -- (-1240.395) [-1240.669] (-1240.756) (-1242.617) * [-1240.658] (-1241.215) (-1239.383) (-1241.313) -- 0:00:39
425000 -- (-1241.597) [-1238.697] (-1241.718) (-1242.626) * (-1244.687) (-1242.529) (-1241.493) [-1239.482] -- 0:00:39
Average standard deviation of split frequencies: 0.010891
425500 -- [-1241.815] (-1242.441) (-1241.021) (-1241.192) * (-1243.665) (-1241.852) [-1247.481] (-1243.187) -- 0:00:39
426000 -- [-1240.185] (-1241.216) (-1241.775) (-1243.321) * (-1244.277) [-1242.232] (-1240.202) (-1241.603) -- 0:00:39
426500 -- [-1240.443] (-1241.314) (-1241.553) (-1243.544) * (-1247.345) [-1247.904] (-1242.081) (-1244.371) -- 0:00:38
427000 -- (-1242.266) (-1240.367) [-1243.449] (-1243.919) * [-1242.510] (-1245.808) (-1241.668) (-1243.221) -- 0:00:38
427500 -- (-1239.389) (-1242.960) [-1243.730] (-1244.079) * (-1244.009) (-1247.572) [-1242.631] (-1246.444) -- 0:00:38
428000 -- (-1244.423) (-1243.048) [-1242.491] (-1250.031) * (-1241.961) (-1241.294) (-1241.050) [-1242.568] -- 0:00:38
428500 -- (-1241.315) [-1243.278] (-1242.583) (-1245.938) * (-1242.664) [-1242.718] (-1242.738) (-1247.063) -- 0:00:38
429000 -- (-1239.028) (-1243.474) [-1241.280] (-1242.986) * [-1241.899] (-1245.567) (-1240.630) (-1242.795) -- 0:00:38
429500 -- (-1241.506) [-1243.543] (-1247.088) (-1242.584) * (-1246.112) (-1246.996) [-1243.982] (-1241.595) -- 0:00:38
430000 -- (-1242.004) [-1242.360] (-1242.845) (-1242.057) * [-1244.076] (-1243.866) (-1245.586) (-1241.521) -- 0:00:38
Average standard deviation of split frequencies: 0.010831
430500 -- (-1242.484) [-1242.162] (-1242.008) (-1241.101) * (-1242.646) [-1243.762] (-1244.924) (-1244.296) -- 0:00:39
431000 -- (-1242.196) (-1244.025) [-1241.240] (-1243.702) * [-1246.470] (-1241.971) (-1244.062) (-1241.542) -- 0:00:39
431500 -- (-1246.195) (-1242.515) [-1241.261] (-1243.071) * (-1242.960) (-1239.986) (-1241.078) [-1242.736] -- 0:00:39
432000 -- (-1243.977) (-1245.778) [-1242.206] (-1242.977) * (-1242.965) (-1244.212) [-1240.421] (-1241.377) -- 0:00:39
432500 -- (-1243.407) (-1244.468) (-1243.785) [-1243.126] * [-1241.749] (-1242.679) (-1241.723) (-1243.201) -- 0:00:39
433000 -- (-1245.409) (-1242.557) (-1242.711) [-1239.387] * [-1239.351] (-1242.393) (-1241.371) (-1242.850) -- 0:00:39
433500 -- (-1243.664) (-1244.171) (-1246.404) [-1241.659] * (-1246.654) (-1239.641) (-1242.492) [-1243.095] -- 0:00:39
434000 -- [-1243.726] (-1239.570) (-1246.446) (-1242.500) * [-1242.405] (-1245.584) (-1242.699) (-1242.883) -- 0:00:39
434500 -- (-1242.676) (-1240.726) (-1244.734) [-1244.893] * [-1242.785] (-1242.394) (-1241.322) (-1243.869) -- 0:00:39
435000 -- (-1242.485) (-1241.325) [-1241.788] (-1242.197) * [-1242.864] (-1244.487) (-1241.553) (-1241.797) -- 0:00:38
Average standard deviation of split frequencies: 0.010243
435500 -- (-1241.299) (-1241.056) (-1247.998) [-1240.106] * (-1243.290) [-1241.682] (-1245.765) (-1240.762) -- 0:00:38
436000 -- (-1239.795) [-1240.794] (-1245.127) (-1240.613) * (-1237.507) [-1241.522] (-1242.608) (-1241.432) -- 0:00:38
436500 -- [-1240.396] (-1243.430) (-1242.273) (-1242.131) * (-1243.291) (-1241.829) [-1242.811] (-1243.427) -- 0:00:38
437000 -- (-1242.399) (-1242.003) (-1241.587) [-1241.504] * (-1243.397) (-1241.723) (-1242.434) [-1243.448] -- 0:00:38
437500 -- (-1242.949) (-1242.246) (-1242.096) [-1241.411] * (-1243.412) (-1243.159) (-1243.293) [-1242.756] -- 0:00:38
438000 -- (-1246.706) [-1242.967] (-1241.577) (-1243.084) * (-1241.239) (-1241.201) [-1244.793] (-1240.971) -- 0:00:38
438500 -- (-1242.963) [-1245.941] (-1244.548) (-1242.811) * (-1245.325) (-1243.290) (-1241.486) [-1244.294] -- 0:00:38
439000 -- [-1242.717] (-1244.946) (-1244.200) (-1242.444) * [-1240.578] (-1242.495) (-1242.831) (-1241.700) -- 0:00:38
439500 -- (-1248.607) (-1240.900) [-1247.044] (-1243.905) * [-1239.040] (-1242.452) (-1242.243) (-1241.215) -- 0:00:38
440000 -- [-1239.552] (-1244.180) (-1242.545) (-1241.950) * (-1239.926) (-1238.935) [-1241.694] (-1241.069) -- 0:00:38
Average standard deviation of split frequencies: 0.010866
440500 -- (-1240.884) (-1246.553) (-1242.400) [-1238.974] * (-1239.920) (-1243.332) (-1240.848) [-1241.955] -- 0:00:38
441000 -- (-1239.340) (-1247.366) [-1241.501] (-1240.596) * (-1242.330) [-1241.491] (-1241.176) (-1243.010) -- 0:00:38
441500 -- [-1240.664] (-1243.500) (-1242.831) (-1241.650) * (-1241.027) (-1241.103) [-1240.726] (-1242.542) -- 0:00:37
442000 -- (-1241.323) [-1243.600] (-1243.683) (-1244.400) * (-1241.380) [-1241.056] (-1241.589) (-1242.390) -- 0:00:37
442500 -- [-1241.445] (-1243.294) (-1242.581) (-1243.915) * [-1244.634] (-1242.158) (-1243.778) (-1243.464) -- 0:00:37
443000 -- [-1240.740] (-1240.977) (-1246.326) (-1242.555) * (-1242.853) (-1244.528) (-1242.925) [-1242.531] -- 0:00:37
443500 -- (-1241.664) (-1239.953) [-1243.198] (-1240.197) * [-1241.224] (-1241.721) (-1242.730) (-1241.402) -- 0:00:37
444000 -- (-1245.887) (-1243.351) [-1242.749] (-1243.857) * (-1241.870) (-1244.779) (-1239.741) [-1243.598] -- 0:00:37
444500 -- (-1240.799) [-1240.652] (-1241.025) (-1241.046) * (-1240.587) [-1240.879] (-1240.956) (-1241.671) -- 0:00:37
445000 -- (-1242.610) (-1242.620) (-1242.401) [-1240.852] * (-1241.318) [-1242.773] (-1241.186) (-1245.760) -- 0:00:37
Average standard deviation of split frequencies: 0.011793
445500 -- [-1243.522] (-1241.963) (-1240.931) (-1241.085) * [-1239.456] (-1245.362) (-1242.191) (-1244.238) -- 0:00:38
446000 -- (-1240.718) (-1246.052) (-1243.302) [-1242.479] * (-1242.326) (-1241.073) (-1243.175) [-1243.457] -- 0:00:38
446500 -- (-1241.807) (-1241.042) [-1241.720] (-1240.530) * (-1244.788) (-1241.309) [-1242.536] (-1242.403) -- 0:00:38
447000 -- (-1242.198) (-1242.046) (-1242.827) [-1240.517] * (-1241.143) (-1242.467) [-1239.994] (-1241.627) -- 0:00:38
447500 -- (-1240.330) [-1241.951] (-1242.382) (-1240.868) * (-1245.693) (-1241.912) [-1241.853] (-1242.467) -- 0:00:38
448000 -- (-1241.022) (-1246.903) [-1242.957] (-1240.847) * (-1242.115) [-1242.742] (-1241.465) (-1242.385) -- 0:00:38
448500 -- (-1244.152) (-1245.637) (-1241.819) [-1240.568] * (-1239.648) (-1239.367) (-1244.480) [-1242.153] -- 0:00:38
449000 -- [-1239.363] (-1244.151) (-1242.807) (-1242.531) * (-1241.647) (-1241.909) [-1242.753] (-1243.519) -- 0:00:38
449500 -- [-1238.896] (-1243.050) (-1243.402) (-1240.871) * [-1241.313] (-1244.471) (-1243.655) (-1243.468) -- 0:00:37
450000 -- (-1241.845) [-1241.816] (-1242.489) (-1241.700) * (-1245.523) (-1242.695) [-1241.154] (-1244.116) -- 0:00:37
Average standard deviation of split frequencies: 0.012057
450500 -- (-1241.626) [-1241.581] (-1245.103) (-1244.055) * (-1241.999) [-1244.079] (-1240.403) (-1242.334) -- 0:00:37
451000 -- [-1241.834] (-1243.004) (-1241.791) (-1243.326) * (-1241.801) (-1243.008) [-1241.093] (-1242.802) -- 0:00:37
451500 -- (-1242.401) [-1242.200] (-1240.780) (-1239.701) * [-1239.725] (-1240.431) (-1241.411) (-1242.515) -- 0:00:37
452000 -- (-1241.915) (-1242.004) (-1242.262) [-1242.879] * (-1242.793) [-1242.558] (-1241.291) (-1242.278) -- 0:00:37
452500 -- [-1239.335] (-1243.259) (-1241.817) (-1241.714) * (-1247.472) [-1241.963] (-1245.502) (-1243.069) -- 0:00:37
453000 -- (-1243.226) (-1244.349) (-1248.312) [-1243.607] * (-1242.638) (-1241.652) [-1243.345] (-1241.770) -- 0:00:37
453500 -- (-1241.358) [-1241.957] (-1246.719) (-1248.672) * (-1242.126) (-1241.027) [-1243.763] (-1242.563) -- 0:00:37
454000 -- (-1244.758) [-1242.431] (-1242.433) (-1242.755) * (-1243.822) [-1241.485] (-1245.152) (-1241.750) -- 0:00:37
454500 -- (-1241.967) (-1244.407) [-1241.299] (-1243.035) * (-1243.366) (-1242.508) (-1250.432) [-1242.830] -- 0:00:37
455000 -- [-1240.318] (-1247.165) (-1241.593) (-1241.771) * [-1241.500] (-1242.623) (-1244.092) (-1243.935) -- 0:00:37
Average standard deviation of split frequencies: 0.012351
455500 -- (-1242.819) (-1244.226) [-1242.592] (-1242.839) * (-1242.538) (-1241.876) [-1241.531] (-1242.520) -- 0:00:37
456000 -- (-1244.212) (-1244.180) (-1243.854) [-1239.013] * [-1242.860] (-1241.902) (-1242.905) (-1244.316) -- 0:00:36
456500 -- (-1241.118) (-1241.291) (-1242.091) [-1242.026] * (-1244.924) (-1242.083) (-1242.321) [-1242.266] -- 0:00:36
457000 -- [-1238.998] (-1241.432) (-1243.909) (-1241.479) * (-1241.349) (-1241.519) (-1244.335) [-1240.760] -- 0:00:36
457500 -- [-1241.869] (-1241.977) (-1241.963) (-1240.647) * (-1241.422) [-1243.074] (-1243.730) (-1241.608) -- 0:00:36
458000 -- (-1238.985) [-1244.510] (-1244.514) (-1244.235) * [-1242.030] (-1251.795) (-1244.771) (-1241.723) -- 0:00:36
458500 -- (-1241.590) [-1243.957] (-1243.361) (-1242.228) * (-1244.559) (-1246.485) [-1242.783] (-1242.997) -- 0:00:36
459000 -- (-1242.651) [-1242.620] (-1243.473) (-1241.714) * (-1239.050) (-1242.616) [-1242.520] (-1242.485) -- 0:00:36
459500 -- (-1243.784) (-1241.811) [-1247.220] (-1241.645) * (-1242.238) (-1241.907) [-1243.341] (-1246.352) -- 0:00:36
460000 -- (-1244.111) (-1241.791) [-1242.600] (-1248.533) * (-1240.757) [-1241.706] (-1241.376) (-1243.308) -- 0:00:36
Average standard deviation of split frequencies: 0.012711
460500 -- (-1241.632) (-1241.303) (-1243.243) [-1241.915] * (-1243.430) (-1241.185) [-1242.726] (-1242.641) -- 0:00:37
461000 -- (-1244.408) [-1243.370] (-1244.648) (-1242.250) * (-1242.947) (-1243.637) [-1243.384] (-1243.049) -- 0:00:37
461500 -- (-1245.243) (-1247.990) [-1242.372] (-1242.446) * (-1241.581) (-1243.151) [-1243.424] (-1240.996) -- 0:00:37
462000 -- (-1239.056) (-1239.598) [-1241.184] (-1242.286) * (-1244.090) (-1241.953) (-1243.414) [-1243.032] -- 0:00:37
462500 -- [-1238.646] (-1245.539) (-1242.106) (-1243.243) * (-1241.023) [-1243.168] (-1246.937) (-1241.638) -- 0:00:37
463000 -- (-1241.156) (-1242.608) [-1244.562] (-1243.407) * (-1243.443) (-1243.860) [-1241.637] (-1242.226) -- 0:00:37
463500 -- (-1243.476) (-1243.286) [-1246.705] (-1243.063) * (-1243.390) [-1242.610] (-1242.327) (-1242.892) -- 0:00:37
464000 -- [-1243.169] (-1241.913) (-1249.656) (-1242.684) * (-1246.497) (-1241.096) [-1242.317] (-1242.134) -- 0:00:36
464500 -- (-1245.302) (-1246.306) (-1247.379) [-1240.726] * (-1244.226) [-1243.948] (-1242.433) (-1241.868) -- 0:00:36
465000 -- (-1242.211) (-1242.484) [-1243.612] (-1240.800) * (-1244.754) (-1240.889) (-1242.559) [-1244.786] -- 0:00:36
Average standard deviation of split frequencies: 0.012831
465500 -- [-1242.121] (-1241.366) (-1245.009) (-1243.850) * (-1246.328) (-1241.514) [-1243.770] (-1243.466) -- 0:00:36
466000 -- (-1241.657) (-1241.494) [-1243.513] (-1241.844) * (-1245.797) (-1241.405) (-1241.893) [-1242.704] -- 0:00:36
466500 -- (-1238.502) (-1245.637) (-1242.990) [-1246.585] * (-1245.593) (-1242.387) [-1240.941] (-1248.497) -- 0:00:36
467000 -- (-1241.205) (-1247.148) [-1240.974] (-1248.399) * (-1243.631) (-1241.737) (-1243.675) [-1243.114] -- 0:00:36
467500 -- [-1243.119] (-1246.073) (-1243.683) (-1243.670) * (-1248.120) (-1242.626) (-1242.361) [-1240.253] -- 0:00:36
468000 -- [-1243.879] (-1245.673) (-1246.271) (-1243.221) * (-1243.433) (-1246.522) [-1241.456] (-1246.573) -- 0:00:36
468500 -- (-1241.024) [-1244.832] (-1241.736) (-1245.153) * [-1243.994] (-1241.490) (-1242.304) (-1241.340) -- 0:00:36
469000 -- [-1240.813] (-1242.303) (-1241.631) (-1241.057) * (-1241.976) (-1242.383) (-1240.495) [-1238.171] -- 0:00:36
469500 -- (-1240.772) (-1241.159) [-1243.302] (-1243.573) * (-1239.410) (-1242.231) (-1239.561) [-1240.431] -- 0:00:36
470000 -- [-1240.863] (-1240.793) (-1244.884) (-1242.761) * (-1241.449) (-1244.114) (-1244.683) [-1241.050] -- 0:00:36
Average standard deviation of split frequencies: 0.012810
470500 -- (-1240.287) (-1247.314) (-1243.187) [-1243.409] * [-1242.187] (-1247.483) (-1245.189) (-1244.722) -- 0:00:36
471000 -- (-1240.564) [-1240.765] (-1243.170) (-1243.257) * (-1240.915) (-1246.031) (-1241.956) [-1241.500] -- 0:00:35
471500 -- [-1240.603] (-1242.289) (-1242.237) (-1246.740) * (-1241.370) (-1244.908) (-1242.721) [-1239.615] -- 0:00:35
472000 -- (-1240.280) (-1241.480) (-1241.634) [-1242.656] * [-1241.967] (-1242.910) (-1241.479) (-1239.490) -- 0:00:35
472500 -- (-1241.468) (-1240.987) (-1243.245) [-1241.480] * (-1244.353) (-1240.897) (-1241.143) [-1239.020] -- 0:00:35
473000 -- (-1240.474) (-1242.228) [-1242.445] (-1243.563) * (-1243.978) (-1241.194) [-1242.685] (-1240.631) -- 0:00:35
473500 -- [-1244.826] (-1240.900) (-1241.250) (-1242.236) * (-1241.530) [-1241.150] (-1242.285) (-1241.930) -- 0:00:35
474000 -- [-1240.415] (-1242.398) (-1245.333) (-1245.136) * (-1242.298) (-1241.894) (-1242.406) [-1244.038] -- 0:00:35
474500 -- (-1241.894) [-1243.182] (-1242.280) (-1244.929) * (-1241.001) (-1241.683) (-1243.198) [-1242.008] -- 0:00:35
475000 -- [-1242.669] (-1244.562) (-1241.384) (-1244.407) * (-1240.257) (-1241.167) [-1243.639] (-1241.429) -- 0:00:35
Average standard deviation of split frequencies: 0.012249
475500 -- [-1241.200] (-1242.797) (-1242.720) (-1244.678) * (-1242.813) [-1240.811] (-1243.089) (-1243.679) -- 0:00:36
476000 -- (-1241.923) [-1241.911] (-1240.387) (-1242.855) * (-1244.917) [-1241.478] (-1242.668) (-1241.763) -- 0:00:36
476500 -- [-1242.566] (-1240.987) (-1241.908) (-1244.549) * [-1240.100] (-1242.264) (-1239.473) (-1244.340) -- 0:00:36
477000 -- (-1245.837) [-1241.835] (-1243.030) (-1245.976) * (-1242.643) [-1242.725] (-1244.165) (-1243.002) -- 0:00:36
477500 -- [-1242.567] (-1243.064) (-1240.551) (-1244.518) * [-1240.828] (-1242.511) (-1245.900) (-1241.742) -- 0:00:36
478000 -- (-1241.494) [-1240.857] (-1240.592) (-1242.255) * (-1243.253) (-1246.346) (-1242.655) [-1241.283] -- 0:00:36
478500 -- (-1241.211) (-1241.743) [-1242.283] (-1243.186) * (-1242.157) (-1244.710) [-1239.390] (-1244.747) -- 0:00:35
479000 -- [-1241.914] (-1243.200) (-1241.340) (-1242.290) * (-1241.908) [-1243.256] (-1240.738) (-1240.983) -- 0:00:35
479500 -- (-1241.690) [-1245.840] (-1240.515) (-1243.322) * (-1240.897) (-1242.810) (-1242.461) [-1241.099] -- 0:00:35
480000 -- (-1241.179) (-1240.985) (-1241.134) [-1243.223] * (-1239.806) (-1241.483) (-1242.189) [-1242.766] -- 0:00:35
Average standard deviation of split frequencies: 0.012285
480500 -- (-1241.388) [-1242.307] (-1244.516) (-1243.052) * (-1241.261) [-1242.523] (-1242.104) (-1242.200) -- 0:00:35
481000 -- (-1241.484) (-1247.840) (-1243.252) [-1243.557] * (-1244.833) [-1242.781] (-1242.073) (-1241.532) -- 0:00:35
481500 -- (-1241.648) [-1246.555] (-1241.840) (-1242.108) * (-1241.297) [-1245.875] (-1242.200) (-1243.442) -- 0:00:35
482000 -- [-1240.784] (-1245.258) (-1243.272) (-1241.795) * (-1243.182) (-1247.087) [-1242.434] (-1241.746) -- 0:00:35
482500 -- [-1242.511] (-1240.976) (-1245.001) (-1244.075) * (-1240.636) (-1244.637) (-1244.959) [-1244.216] -- 0:00:35
483000 -- [-1241.164] (-1243.492) (-1241.366) (-1240.551) * (-1240.054) (-1242.380) (-1244.021) [-1242.228] -- 0:00:35
483500 -- [-1243.728] (-1243.608) (-1242.833) (-1244.111) * [-1241.359] (-1242.385) (-1240.473) (-1244.393) -- 0:00:35
484000 -- [-1242.106] (-1244.989) (-1240.676) (-1243.991) * (-1242.031) (-1243.910) [-1241.246] (-1245.053) -- 0:00:35
484500 -- (-1244.441) [-1241.559] (-1240.143) (-1243.599) * (-1240.955) (-1241.419) [-1241.380] (-1241.838) -- 0:00:35
485000 -- (-1244.996) (-1241.398) [-1245.212] (-1244.946) * (-1241.446) [-1242.068] (-1242.490) (-1242.215) -- 0:00:35
Average standard deviation of split frequencies: 0.012610
485500 -- (-1245.985) (-1243.070) (-1241.922) [-1241.841] * (-1244.549) (-1243.639) (-1239.219) [-1242.945] -- 0:00:34
486000 -- (-1242.241) (-1242.362) (-1241.867) [-1240.785] * (-1243.078) (-1242.635) (-1238.938) [-1240.394] -- 0:00:34
486500 -- (-1241.877) (-1242.538) [-1244.973] (-1241.415) * (-1241.427) (-1249.932) (-1242.737) [-1241.104] -- 0:00:34
487000 -- (-1242.298) (-1242.996) (-1242.780) [-1240.807] * (-1241.416) (-1250.031) [-1240.601] (-1241.505) -- 0:00:34
487500 -- [-1246.288] (-1245.582) (-1243.048) (-1242.194) * (-1248.569) (-1245.167) [-1239.704] (-1242.221) -- 0:00:34
488000 -- (-1245.706) (-1242.805) [-1243.943] (-1243.271) * [-1244.888] (-1245.663) (-1240.298) (-1245.104) -- 0:00:34
488500 -- (-1245.737) (-1240.992) [-1241.707] (-1241.235) * (-1241.600) (-1246.234) [-1237.929] (-1242.888) -- 0:00:34
489000 -- (-1244.040) (-1241.261) [-1245.500] (-1243.451) * (-1239.675) (-1243.030) (-1239.649) [-1243.675] -- 0:00:34
489500 -- [-1240.832] (-1242.140) (-1241.259) (-1244.075) * [-1240.569] (-1242.687) (-1246.718) (-1247.457) -- 0:00:34
490000 -- (-1243.020) (-1241.183) (-1240.202) [-1240.811] * [-1242.705] (-1244.038) (-1242.769) (-1242.537) -- 0:00:34
Average standard deviation of split frequencies: 0.012035
490500 -- [-1241.965] (-1240.995) (-1242.355) (-1242.494) * (-1241.723) (-1241.133) [-1242.217] (-1243.177) -- 0:00:35
491000 -- (-1241.707) (-1241.064) (-1243.563) [-1245.898] * (-1241.100) (-1245.411) (-1240.640) [-1242.597] -- 0:00:35
491500 -- [-1242.018] (-1241.360) (-1241.620) (-1242.985) * (-1242.941) (-1241.449) (-1242.870) [-1245.859] -- 0:00:35
492000 -- [-1243.920] (-1242.808) (-1244.769) (-1239.714) * (-1244.420) (-1240.424) (-1241.756) [-1241.391] -- 0:00:35
492500 -- (-1245.639) (-1240.933) [-1241.240] (-1241.226) * (-1244.912) (-1242.696) [-1239.811] (-1242.545) -- 0:00:35
493000 -- (-1239.549) (-1241.916) (-1243.424) [-1241.443] * (-1240.626) (-1244.189) (-1241.838) [-1243.361] -- 0:00:34
493500 -- [-1243.591] (-1241.440) (-1244.441) (-1242.685) * (-1241.500) (-1246.090) (-1239.943) [-1243.689] -- 0:00:34
494000 -- (-1242.538) (-1242.858) [-1241.337] (-1245.155) * (-1240.147) [-1243.508] (-1239.123) (-1241.967) -- 0:00:34
494500 -- (-1240.852) (-1241.546) [-1242.735] (-1241.930) * (-1248.170) (-1246.596) (-1240.515) [-1239.601] -- 0:00:34
495000 -- [-1243.319] (-1240.702) (-1241.286) (-1243.794) * (-1240.423) (-1243.384) (-1247.691) [-1241.609] -- 0:00:34
Average standard deviation of split frequencies: 0.012455
495500 -- (-1241.669) (-1245.806) (-1241.393) [-1242.286] * (-1243.202) (-1242.825) [-1242.630] (-1240.813) -- 0:00:34
496000 -- (-1240.426) (-1241.757) (-1240.649) [-1241.210] * [-1241.778] (-1241.526) (-1242.174) (-1240.503) -- 0:00:34
496500 -- (-1239.580) (-1244.067) (-1242.978) [-1242.393] * (-1240.796) (-1242.281) [-1241.073] (-1242.323) -- 0:00:34
497000 -- [-1241.513] (-1244.615) (-1240.838) (-1242.364) * [-1243.005] (-1243.207) (-1239.662) (-1241.434) -- 0:00:34
497500 -- [-1245.509] (-1243.291) (-1243.006) (-1241.410) * (-1243.050) (-1243.297) (-1238.227) [-1242.177] -- 0:00:34
498000 -- (-1243.423) (-1242.556) [-1241.603] (-1242.880) * (-1242.032) [-1240.848] (-1244.347) (-1249.232) -- 0:00:34
498500 -- (-1240.916) (-1240.887) (-1242.894) [-1242.564] * [-1240.494] (-1244.575) (-1242.338) (-1245.977) -- 0:00:34
499000 -- (-1248.696) (-1240.769) (-1241.498) [-1242.080] * (-1242.821) (-1242.424) (-1241.509) [-1244.248] -- 0:00:34
499500 -- (-1243.545) (-1245.334) [-1241.125] (-1243.546) * (-1242.216) (-1240.675) [-1241.944] (-1242.961) -- 0:00:34
500000 -- (-1240.799) (-1241.309) [-1241.103] (-1242.248) * [-1246.333] (-1240.768) (-1243.533) (-1242.185) -- 0:00:34
Average standard deviation of split frequencies: 0.012092
500500 -- [-1243.050] (-1242.772) (-1243.588) (-1244.326) * (-1242.787) [-1240.696] (-1244.234) (-1244.850) -- 0:00:33
501000 -- [-1242.318] (-1241.913) (-1246.122) (-1241.588) * (-1242.131) (-1242.349) (-1245.054) [-1243.436] -- 0:00:33
501500 -- (-1245.536) [-1242.101] (-1246.583) (-1242.447) * (-1242.000) (-1240.357) [-1243.587] (-1241.748) -- 0:00:33
502000 -- (-1241.475) (-1241.630) (-1243.294) [-1242.739] * (-1244.045) [-1242.401] (-1241.329) (-1241.465) -- 0:00:33
502500 -- (-1241.321) [-1243.383] (-1242.512) (-1245.838) * (-1241.347) (-1239.086) [-1242.816] (-1241.286) -- 0:00:33
503000 -- (-1240.926) (-1243.071) (-1243.619) [-1245.084] * (-1246.165) (-1238.744) (-1244.276) [-1242.162] -- 0:00:33
503500 -- [-1241.830] (-1242.955) (-1242.812) (-1244.293) * (-1241.176) [-1243.396] (-1240.358) (-1241.272) -- 0:00:33
504000 -- (-1241.089) (-1242.429) (-1243.333) [-1242.770] * (-1250.302) (-1241.041) [-1241.222] (-1242.574) -- 0:00:33
504500 -- [-1238.806] (-1242.514) (-1241.372) (-1242.960) * [-1241.403] (-1245.133) (-1243.938) (-1241.608) -- 0:00:33
505000 -- (-1243.470) [-1241.592] (-1243.822) (-1245.049) * (-1245.852) (-1242.107) (-1246.359) [-1241.638] -- 0:00:33
Average standard deviation of split frequencies: 0.011768
505500 -- (-1244.124) (-1245.846) (-1243.579) [-1243.079] * (-1244.171) [-1241.041] (-1240.923) (-1243.611) -- 0:00:34
506000 -- (-1241.516) (-1243.107) [-1243.522] (-1246.766) * (-1243.973) (-1240.983) (-1242.942) [-1241.708] -- 0:00:34
506500 -- (-1241.247) (-1240.148) [-1241.883] (-1242.700) * (-1244.565) (-1241.490) [-1243.123] (-1241.086) -- 0:00:34
507000 -- (-1241.797) (-1241.868) (-1241.381) [-1241.334] * (-1241.958) [-1242.285] (-1240.807) (-1240.919) -- 0:00:34
507500 -- (-1241.825) (-1243.504) [-1244.002] (-1241.914) * [-1241.841] (-1242.286) (-1240.529) (-1242.698) -- 0:00:33
508000 -- [-1243.202] (-1244.736) (-1243.376) (-1247.217) * (-1241.876) (-1242.444) (-1239.971) [-1242.576] -- 0:00:33
508500 -- (-1241.800) (-1240.941) (-1241.799) [-1244.911] * (-1242.152) [-1242.053] (-1241.242) (-1242.157) -- 0:00:33
509000 -- (-1245.033) [-1240.552] (-1241.904) (-1245.636) * [-1242.236] (-1241.660) (-1243.162) (-1245.288) -- 0:00:33
509500 -- (-1243.169) (-1240.794) [-1243.265] (-1243.380) * (-1241.773) (-1239.546) [-1241.887] (-1243.445) -- 0:00:33
510000 -- (-1244.981) [-1240.949] (-1241.350) (-1241.763) * (-1240.908) [-1241.298] (-1248.060) (-1239.918) -- 0:00:33
Average standard deviation of split frequencies: 0.011903
510500 -- (-1241.719) [-1241.608] (-1245.475) (-1240.799) * (-1241.026) (-1241.483) (-1243.969) [-1241.898] -- 0:00:33
511000 -- [-1239.205] (-1241.426) (-1241.995) (-1242.431) * (-1243.328) (-1243.192) [-1241.232] (-1242.982) -- 0:00:33
511500 -- (-1244.720) (-1243.023) [-1242.623] (-1243.536) * [-1241.781] (-1240.817) (-1241.203) (-1241.955) -- 0:00:33
512000 -- [-1241.219] (-1242.720) (-1241.290) (-1248.226) * (-1241.402) [-1240.916] (-1241.304) (-1243.561) -- 0:00:33
512500 -- (-1243.370) (-1243.867) (-1241.809) [-1241.991] * [-1238.693] (-1242.297) (-1243.939) (-1240.994) -- 0:00:33
513000 -- (-1241.077) [-1242.589] (-1242.445) (-1241.842) * [-1243.037] (-1243.561) (-1241.523) (-1241.218) -- 0:00:33
513500 -- (-1241.973) (-1248.216) [-1241.258] (-1241.697) * [-1242.043] (-1243.718) (-1242.435) (-1242.673) -- 0:00:33
514000 -- (-1241.098) (-1245.506) [-1243.998] (-1244.622) * (-1243.137) (-1243.553) [-1240.311] (-1241.036) -- 0:00:33
514500 -- (-1244.176) [-1243.331] (-1242.217) (-1241.889) * (-1242.403) [-1241.213] (-1240.011) (-1242.499) -- 0:00:33
515000 -- (-1241.281) (-1241.916) (-1243.274) [-1241.436] * (-1244.351) [-1244.724] (-1239.797) (-1242.597) -- 0:00:32
Average standard deviation of split frequencies: 0.011876
515500 -- (-1242.712) (-1245.556) (-1245.442) [-1244.702] * [-1243.416] (-1244.877) (-1241.404) (-1242.841) -- 0:00:32
516000 -- [-1242.669] (-1242.593) (-1243.290) (-1242.456) * (-1242.300) [-1246.495] (-1243.283) (-1242.021) -- 0:00:32
516500 -- [-1240.175] (-1242.411) (-1241.927) (-1247.873) * (-1244.101) [-1241.110] (-1241.653) (-1243.472) -- 0:00:32
517000 -- (-1240.140) (-1241.840) [-1241.193] (-1244.491) * (-1244.139) (-1243.701) (-1241.171) [-1239.269] -- 0:00:32
517500 -- (-1243.430) (-1241.599) [-1241.695] (-1242.191) * (-1243.607) [-1240.919] (-1241.897) (-1240.955) -- 0:00:32
518000 -- (-1242.578) [-1241.245] (-1241.341) (-1241.577) * (-1242.626) (-1244.699) [-1242.177] (-1241.011) -- 0:00:32
518500 -- (-1242.705) (-1243.165) [-1247.479] (-1241.785) * (-1243.747) [-1242.166] (-1241.313) (-1244.564) -- 0:00:32
519000 -- (-1243.235) [-1241.864] (-1242.478) (-1240.789) * (-1244.019) (-1243.800) (-1242.174) [-1241.810] -- 0:00:32
519500 -- (-1242.245) [-1242.605] (-1243.663) (-1241.345) * (-1241.801) (-1242.288) (-1240.556) [-1240.618] -- 0:00:32
520000 -- [-1242.256] (-1240.761) (-1240.795) (-1246.612) * (-1241.330) (-1247.251) [-1240.887] (-1244.856) -- 0:00:32
Average standard deviation of split frequencies: 0.011722
520500 -- (-1241.762) [-1242.015] (-1241.270) (-1242.395) * (-1239.140) (-1244.252) [-1243.758] (-1245.145) -- 0:00:33
521000 -- (-1241.053) (-1238.733) (-1241.617) [-1242.635] * (-1241.853) [-1243.904] (-1242.164) (-1241.700) -- 0:00:33
521500 -- (-1242.700) [-1243.504] (-1242.241) (-1242.046) * (-1242.768) (-1243.447) (-1243.593) [-1241.011] -- 0:00:33
522000 -- [-1241.322] (-1242.296) (-1241.546) (-1246.031) * (-1243.411) (-1246.849) [-1240.724] (-1241.807) -- 0:00:32
522500 -- (-1242.518) (-1247.166) [-1240.839] (-1242.150) * (-1241.471) [-1245.168] (-1241.046) (-1242.144) -- 0:00:32
523000 -- (-1243.188) (-1245.298) [-1243.170] (-1243.909) * (-1242.373) (-1243.317) (-1242.950) [-1241.949] -- 0:00:32
523500 -- (-1242.776) [-1240.125] (-1239.077) (-1244.171) * (-1246.342) (-1242.712) [-1242.207] (-1241.419) -- 0:00:32
524000 -- (-1242.509) (-1239.617) (-1241.812) [-1240.746] * (-1241.389) (-1241.215) (-1239.598) [-1241.512] -- 0:00:32
524500 -- (-1249.586) [-1240.824] (-1245.308) (-1241.127) * (-1241.299) (-1242.325) [-1240.685] (-1243.339) -- 0:00:32
525000 -- (-1247.144) (-1241.309) (-1242.497) [-1241.179] * (-1246.763) (-1242.741) [-1240.108] (-1240.339) -- 0:00:32
Average standard deviation of split frequencies: 0.010990
525500 -- (-1246.128) (-1243.997) [-1242.370] (-1244.231) * [-1242.997] (-1238.996) (-1244.896) (-1240.501) -- 0:00:32
526000 -- (-1246.448) (-1242.244) (-1244.982) [-1243.501] * (-1243.085) [-1240.376] (-1243.862) (-1241.141) -- 0:00:32
526500 -- [-1241.592] (-1241.505) (-1244.203) (-1242.293) * (-1243.475) (-1242.117) [-1242.668] (-1242.878) -- 0:00:32
527000 -- [-1243.225] (-1243.510) (-1242.761) (-1242.164) * (-1240.898) (-1241.307) [-1243.862] (-1242.567) -- 0:00:32
527500 -- (-1243.825) [-1242.660] (-1242.864) (-1244.811) * (-1242.859) [-1243.199] (-1239.573) (-1242.777) -- 0:00:32
528000 -- [-1243.699] (-1241.716) (-1244.463) (-1244.597) * (-1242.160) (-1242.444) [-1242.548] (-1242.076) -- 0:00:32
528500 -- (-1240.902) (-1241.537) (-1244.251) [-1242.021] * (-1241.147) (-1243.368) (-1242.654) [-1241.820] -- 0:00:32
529000 -- (-1244.927) [-1242.742] (-1243.486) (-1241.451) * (-1241.723) (-1242.285) [-1241.251] (-1242.063) -- 0:00:32
529500 -- (-1242.208) (-1243.815) [-1241.446] (-1241.185) * (-1244.898) (-1242.084) [-1244.353] (-1243.120) -- 0:00:31
530000 -- (-1242.921) (-1244.077) [-1244.437] (-1242.651) * (-1244.501) [-1241.736] (-1244.162) (-1242.973) -- 0:00:31
Average standard deviation of split frequencies: 0.010379
530500 -- (-1242.792) [-1244.568] (-1241.563) (-1241.665) * (-1243.058) (-1245.446) [-1240.254] (-1242.572) -- 0:00:31
531000 -- [-1239.861] (-1244.232) (-1243.729) (-1242.104) * (-1242.722) [-1241.708] (-1242.242) (-1243.949) -- 0:00:31
531500 -- [-1242.462] (-1242.037) (-1240.257) (-1247.104) * (-1244.742) [-1240.741] (-1243.551) (-1245.264) -- 0:00:31
532000 -- (-1241.828) (-1244.117) (-1244.088) [-1244.271] * (-1241.943) (-1241.415) (-1242.502) [-1243.034] -- 0:00:31
532500 -- [-1240.219] (-1243.431) (-1242.869) (-1243.400) * (-1242.288) [-1241.094] (-1241.551) (-1242.356) -- 0:00:31
533000 -- (-1241.488) [-1242.129] (-1243.920) (-1241.428) * (-1243.685) (-1243.025) [-1242.654] (-1241.267) -- 0:00:31
533500 -- (-1242.557) (-1244.007) [-1242.798] (-1242.483) * (-1244.599) (-1243.303) (-1242.233) [-1241.280] -- 0:00:31
534000 -- (-1244.203) (-1242.656) (-1244.631) [-1241.987] * (-1243.924) [-1242.385] (-1244.996) (-1241.844) -- 0:00:31
534500 -- (-1243.304) (-1241.491) (-1242.832) [-1243.568] * (-1242.340) (-1241.999) (-1241.976) [-1238.806] -- 0:00:31
535000 -- [-1239.614] (-1241.541) (-1241.350) (-1240.122) * (-1242.755) (-1241.358) (-1241.038) [-1243.384] -- 0:00:31
Average standard deviation of split frequencies: 0.010739
535500 -- [-1245.074] (-1244.452) (-1241.389) (-1242.030) * (-1243.661) (-1243.781) (-1241.865) [-1242.083] -- 0:00:32
536000 -- (-1242.076) (-1245.347) (-1241.443) [-1242.544] * [-1241.290] (-1240.989) (-1240.350) (-1243.882) -- 0:00:32
536500 -- (-1241.067) (-1244.732) (-1241.133) [-1243.917] * [-1243.186] (-1243.619) (-1242.636) (-1242.625) -- 0:00:31
537000 -- (-1243.687) [-1242.809] (-1241.996) (-1242.781) * (-1241.722) (-1240.350) (-1244.775) [-1243.114] -- 0:00:31
537500 -- (-1242.481) (-1240.830) (-1241.100) [-1242.497] * (-1241.186) (-1247.635) (-1241.574) [-1242.757] -- 0:00:31
538000 -- (-1242.033) (-1242.226) [-1242.992] (-1243.264) * (-1246.766) [-1243.744] (-1241.537) (-1241.740) -- 0:00:31
538500 -- (-1241.412) (-1244.606) (-1241.491) [-1240.307] * (-1241.154) (-1242.291) [-1241.813] (-1240.763) -- 0:00:31
539000 -- (-1240.838) (-1242.053) [-1241.051] (-1241.295) * (-1242.554) (-1241.335) (-1243.364) [-1240.500] -- 0:00:31
539500 -- (-1241.890) [-1242.415] (-1242.489) (-1239.396) * (-1240.946) (-1246.518) (-1244.979) [-1241.249] -- 0:00:31
540000 -- (-1242.882) (-1241.505) [-1242.140] (-1244.054) * (-1243.191) (-1242.127) (-1243.872) [-1241.210] -- 0:00:31
Average standard deviation of split frequencies: 0.010279
540500 -- (-1241.390) [-1241.043] (-1241.655) (-1244.378) * (-1244.366) (-1242.239) [-1243.989] (-1243.715) -- 0:00:31
541000 -- (-1241.709) (-1241.442) (-1241.065) [-1241.250] * (-1245.051) (-1243.399) (-1244.787) [-1243.064] -- 0:00:31
541500 -- (-1241.248) [-1244.366] (-1239.977) (-1241.687) * [-1241.507] (-1240.806) (-1243.289) (-1240.649) -- 0:00:31
542000 -- (-1245.267) [-1244.818] (-1241.599) (-1242.211) * (-1244.182) (-1240.878) [-1237.107] (-1239.506) -- 0:00:31
542500 -- [-1241.052] (-1245.305) (-1244.536) (-1241.970) * (-1245.714) (-1242.415) [-1239.383] (-1242.977) -- 0:00:31
543000 -- (-1241.888) (-1242.082) [-1243.581] (-1242.221) * (-1241.911) (-1241.535) (-1240.872) [-1242.829] -- 0:00:31
543500 -- [-1239.784] (-1243.774) (-1241.911) (-1240.845) * [-1240.924] (-1240.313) (-1241.423) (-1241.970) -- 0:00:31
544000 -- (-1243.819) (-1243.911) [-1242.930] (-1241.954) * (-1239.851) (-1241.666) (-1241.230) [-1241.428] -- 0:00:31
544500 -- (-1246.649) (-1244.138) [-1242.070] (-1241.917) * (-1241.245) (-1241.429) (-1242.321) [-1241.206] -- 0:00:30
545000 -- [-1243.342] (-1245.538) (-1242.414) (-1246.627) * (-1243.686) (-1242.117) (-1244.399) [-1242.443] -- 0:00:30
Average standard deviation of split frequencies: 0.009225
545500 -- [-1241.918] (-1241.544) (-1242.859) (-1243.605) * (-1241.379) (-1245.523) [-1242.528] (-1245.190) -- 0:00:30
546000 -- [-1243.463] (-1242.488) (-1241.833) (-1242.453) * (-1244.300) (-1244.312) (-1243.367) [-1243.775] -- 0:00:30
546500 -- (-1243.707) [-1243.497] (-1241.270) (-1244.595) * (-1243.134) (-1241.196) (-1242.961) [-1243.101] -- 0:00:30
547000 -- (-1246.700) [-1241.138] (-1239.513) (-1242.687) * [-1243.118] (-1241.595) (-1245.133) (-1240.970) -- 0:00:30
547500 -- (-1247.282) (-1241.396) [-1241.089] (-1241.664) * (-1243.501) [-1242.682] (-1245.934) (-1245.266) -- 0:00:30
548000 -- [-1245.486] (-1246.585) (-1242.050) (-1243.574) * [-1243.728] (-1242.542) (-1243.040) (-1243.470) -- 0:00:30
548500 -- (-1241.835) [-1246.822] (-1243.181) (-1240.476) * [-1242.551] (-1241.192) (-1243.763) (-1243.828) -- 0:00:30
549000 -- (-1242.844) (-1243.666) (-1243.496) [-1243.004] * (-1244.114) (-1242.110) [-1242.101] (-1243.413) -- 0:00:30
549500 -- (-1241.912) (-1243.679) [-1242.170] (-1241.364) * [-1241.271] (-1246.358) (-1242.813) (-1240.881) -- 0:00:30
550000 -- (-1251.235) [-1240.900] (-1240.912) (-1242.682) * (-1242.381) (-1240.950) [-1243.207] (-1241.184) -- 0:00:30
Average standard deviation of split frequencies: 0.009146
550500 -- (-1246.917) [-1242.868] (-1242.142) (-1244.218) * (-1244.464) (-1240.630) [-1242.641] (-1243.838) -- 0:00:31
551000 -- (-1244.331) (-1239.441) (-1242.299) [-1242.129] * (-1241.439) [-1242.086] (-1243.387) (-1242.764) -- 0:00:30
551500 -- (-1241.405) (-1249.116) [-1242.848] (-1245.325) * (-1242.757) [-1242.626] (-1241.775) (-1243.364) -- 0:00:30
552000 -- (-1241.434) (-1242.449) [-1240.271] (-1245.693) * [-1241.512] (-1242.443) (-1244.455) (-1240.986) -- 0:00:30
552500 -- [-1242.588] (-1241.966) (-1240.958) (-1244.153) * (-1244.933) [-1240.805] (-1246.093) (-1240.825) -- 0:00:30
553000 -- [-1242.216] (-1244.898) (-1240.253) (-1241.279) * (-1242.473) (-1242.321) (-1248.380) [-1240.307] -- 0:00:30
553500 -- (-1241.010) (-1240.933) (-1240.021) [-1247.521] * (-1242.465) [-1239.667] (-1239.349) (-1238.257) -- 0:00:30
554000 -- (-1243.206) [-1241.260] (-1241.016) (-1239.265) * (-1244.723) (-1241.425) [-1238.822] (-1242.496) -- 0:00:30
554500 -- (-1241.817) (-1242.315) (-1240.781) [-1240.840] * [-1241.251] (-1241.539) (-1240.608) (-1242.648) -- 0:00:30
555000 -- (-1244.729) [-1241.921] (-1238.467) (-1244.358) * [-1244.143] (-1242.821) (-1242.306) (-1242.773) -- 0:00:30
Average standard deviation of split frequencies: 0.009014
555500 -- [-1242.245] (-1241.145) (-1240.609) (-1241.101) * (-1242.753) [-1241.656] (-1242.742) (-1239.544) -- 0:00:30
556000 -- (-1241.864) (-1243.658) [-1239.561] (-1241.420) * (-1243.225) (-1241.377) (-1242.394) [-1242.473] -- 0:00:30
556500 -- (-1243.657) (-1245.219) [-1241.536] (-1244.686) * (-1243.215) (-1242.415) [-1245.504] (-1241.219) -- 0:00:30
557000 -- (-1243.345) (-1242.949) (-1242.408) [-1243.238] * (-1243.433) (-1242.184) (-1246.059) [-1240.081] -- 0:00:30
557500 -- (-1240.356) [-1241.797] (-1241.215) (-1243.586) * (-1240.562) [-1241.862] (-1240.213) (-1240.403) -- 0:00:30
558000 -- (-1241.422) (-1242.062) (-1241.748) [-1241.573] * [-1240.803] (-1243.001) (-1243.473) (-1243.108) -- 0:00:30
558500 -- (-1242.947) (-1245.135) (-1241.592) [-1241.489] * (-1242.163) [-1241.474] (-1241.178) (-1241.834) -- 0:00:30
559000 -- (-1246.085) (-1244.117) [-1240.237] (-1242.012) * [-1246.627] (-1241.552) (-1242.408) (-1240.829) -- 0:00:29
559500 -- (-1249.410) [-1240.761] (-1242.597) (-1242.499) * (-1246.511) [-1240.367] (-1240.263) (-1240.827) -- 0:00:29
560000 -- (-1242.836) [-1240.714] (-1241.583) (-1244.046) * (-1243.672) (-1250.925) (-1242.778) [-1239.967] -- 0:00:29
Average standard deviation of split frequencies: 0.009470
560500 -- (-1243.944) (-1240.843) [-1241.467] (-1244.265) * (-1244.000) (-1243.209) [-1242.339] (-1241.190) -- 0:00:29
561000 -- (-1242.329) [-1245.708] (-1244.828) (-1241.403) * (-1242.500) (-1242.688) [-1240.628] (-1244.511) -- 0:00:29
561500 -- (-1242.083) [-1242.138] (-1239.363) (-1243.105) * (-1242.270) [-1242.382] (-1241.256) (-1243.762) -- 0:00:29
562000 -- [-1241.170] (-1244.028) (-1241.918) (-1241.128) * [-1243.441] (-1240.321) (-1249.609) (-1241.891) -- 0:00:29
562500 -- [-1242.321] (-1239.851) (-1242.056) (-1241.053) * (-1241.056) [-1240.454] (-1240.866) (-1239.948) -- 0:00:29
563000 -- (-1241.590) (-1243.035) [-1239.757] (-1241.848) * (-1241.346) [-1242.607] (-1240.449) (-1244.740) -- 0:00:29
563500 -- (-1241.723) (-1244.094) [-1242.535] (-1241.424) * (-1241.523) (-1240.958) [-1239.831] (-1246.043) -- 0:00:29
564000 -- [-1241.473] (-1242.361) (-1242.013) (-1241.541) * (-1243.565) (-1240.955) [-1243.442] (-1246.866) -- 0:00:29
564500 -- (-1247.398) (-1242.376) [-1240.594] (-1245.074) * (-1241.604) [-1242.471] (-1241.762) (-1245.349) -- 0:00:29
565000 -- [-1240.793] (-1241.692) (-1242.301) (-1243.705) * [-1239.824] (-1241.114) (-1241.279) (-1248.739) -- 0:00:29
Average standard deviation of split frequencies: 0.009994
565500 -- (-1239.444) [-1242.097] (-1244.054) (-1242.242) * (-1241.255) [-1239.614] (-1242.023) (-1242.039) -- 0:00:29
566000 -- (-1246.245) (-1241.736) (-1239.815) [-1242.741] * (-1243.854) (-1241.640) [-1241.382] (-1243.274) -- 0:00:29
566500 -- [-1242.452] (-1244.419) (-1243.744) (-1244.091) * (-1245.269) (-1244.737) (-1242.852) [-1243.122] -- 0:00:29
567000 -- (-1241.414) [-1241.578] (-1242.622) (-1241.094) * (-1240.001) (-1240.860) (-1249.359) [-1240.998] -- 0:00:29
567500 -- (-1242.148) [-1240.963] (-1246.153) (-1242.186) * (-1242.484) (-1241.117) [-1240.131] (-1242.208) -- 0:00:29
568000 -- (-1244.640) (-1240.956) (-1243.211) [-1245.746] * (-1244.156) [-1241.041] (-1247.401) (-1240.986) -- 0:00:29
568500 -- (-1241.700) [-1240.947] (-1242.444) (-1242.314) * [-1243.497] (-1241.609) (-1247.175) (-1240.162) -- 0:00:29
569000 -- [-1240.690] (-1241.063) (-1244.470) (-1247.876) * (-1241.510) (-1238.714) [-1240.996] (-1242.506) -- 0:00:29
569500 -- (-1243.627) (-1251.015) (-1245.460) [-1244.861] * [-1241.319] (-1242.906) (-1242.943) (-1241.771) -- 0:00:29
570000 -- (-1243.106) (-1241.508) (-1243.254) [-1243.578] * (-1244.012) [-1242.667] (-1243.896) (-1241.136) -- 0:00:29
Average standard deviation of split frequencies: 0.010434
570500 -- (-1242.655) [-1246.142] (-1241.273) (-1244.979) * (-1241.227) (-1242.127) [-1241.229] (-1241.510) -- 0:00:29
571000 -- (-1239.330) [-1241.508] (-1244.434) (-1244.369) * (-1242.760) (-1240.493) [-1239.466] (-1240.784) -- 0:00:29
571500 -- (-1241.169) [-1241.657] (-1243.140) (-1243.477) * (-1243.814) (-1242.790) [-1242.107] (-1245.496) -- 0:00:29
572000 -- (-1237.666) (-1242.909) [-1239.489] (-1238.617) * (-1243.156) (-1241.161) (-1239.999) [-1245.145] -- 0:00:29
572500 -- (-1241.743) (-1241.529) [-1242.282] (-1242.019) * (-1240.571) (-1241.587) [-1239.971] (-1241.540) -- 0:00:29
573000 -- (-1246.987) [-1241.906] (-1241.713) (-1243.695) * (-1243.334) (-1241.941) [-1239.931] (-1242.139) -- 0:00:29
573500 -- (-1243.917) [-1240.972] (-1245.122) (-1242.719) * (-1244.358) (-1241.717) (-1241.294) [-1245.971] -- 0:00:29
574000 -- [-1241.721] (-1241.918) (-1241.235) (-1241.102) * [-1243.632] (-1243.628) (-1245.334) (-1243.167) -- 0:00:28
574500 -- (-1240.028) (-1247.922) (-1242.165) [-1241.905] * (-1246.882) (-1241.561) [-1241.103] (-1241.834) -- 0:00:28
575000 -- (-1241.706) (-1244.673) [-1241.712] (-1242.141) * (-1246.493) [-1241.414] (-1239.340) (-1241.646) -- 0:00:28
Average standard deviation of split frequencies: 0.010295
575500 -- (-1244.599) (-1244.638) [-1241.624] (-1241.316) * (-1242.530) [-1240.798] (-1241.986) (-1242.156) -- 0:00:28
576000 -- (-1243.049) (-1238.501) [-1240.977] (-1241.626) * (-1241.799) (-1241.266) (-1241.428) [-1244.025] -- 0:00:28
576500 -- [-1243.091] (-1242.117) (-1241.397) (-1240.735) * (-1242.568) (-1242.343) [-1242.242] (-1244.169) -- 0:00:28
577000 -- (-1243.455) (-1241.732) (-1240.663) [-1239.853] * (-1245.290) (-1242.021) (-1240.926) [-1242.715] -- 0:00:28
577500 -- (-1241.573) [-1240.969] (-1242.481) (-1242.000) * [-1242.529] (-1242.094) (-1241.069) (-1240.748) -- 0:00:28
578000 -- [-1242.228] (-1242.163) (-1241.170) (-1242.700) * (-1241.276) [-1243.061] (-1241.778) (-1246.470) -- 0:00:28
578500 -- (-1243.363) (-1244.033) (-1242.915) [-1241.234] * (-1242.321) (-1242.483) [-1241.920] (-1245.041) -- 0:00:28
579000 -- (-1241.194) (-1245.833) (-1245.784) [-1243.474] * (-1240.997) (-1242.720) [-1241.793] (-1242.125) -- 0:00:28
579500 -- (-1241.707) (-1243.321) (-1240.187) [-1243.794] * [-1241.880] (-1243.749) (-1243.536) (-1240.519) -- 0:00:28
580000 -- (-1241.040) (-1245.307) [-1239.686] (-1242.712) * [-1241.228] (-1243.891) (-1241.758) (-1244.584) -- 0:00:28
Average standard deviation of split frequencies: 0.010127
580500 -- (-1243.452) (-1244.562) [-1241.376] (-1242.154) * (-1247.919) (-1242.231) [-1242.369] (-1241.697) -- 0:00:28
581000 -- (-1242.690) (-1244.378) [-1240.944] (-1242.026) * (-1243.017) (-1243.826) [-1242.527] (-1242.347) -- 0:00:28
581500 -- (-1243.560) (-1245.571) (-1241.437) [-1244.804] * (-1242.790) [-1245.689] (-1243.526) (-1242.773) -- 0:00:28
582000 -- (-1245.680) [-1241.418] (-1244.246) (-1243.530) * [-1244.291] (-1244.653) (-1242.116) (-1241.884) -- 0:00:28
582500 -- (-1242.246) (-1242.712) (-1242.266) [-1240.557] * (-1242.982) [-1244.174] (-1242.949) (-1241.591) -- 0:00:28
583000 -- (-1242.115) (-1241.045) (-1243.472) [-1243.286] * [-1241.350] (-1246.029) (-1240.416) (-1242.351) -- 0:00:28
583500 -- (-1240.771) (-1242.840) [-1241.884] (-1241.300) * (-1241.707) (-1244.493) (-1243.579) [-1242.546] -- 0:00:28
584000 -- (-1239.864) (-1242.536) (-1242.646) [-1241.492] * (-1241.400) (-1243.428) [-1241.550] (-1243.756) -- 0:00:28
584500 -- (-1245.544) [-1242.393] (-1241.305) (-1243.281) * [-1241.110] (-1244.086) (-1242.200) (-1244.658) -- 0:00:28
585000 -- (-1241.716) [-1242.657] (-1241.270) (-1241.472) * (-1241.557) [-1242.209] (-1244.650) (-1242.642) -- 0:00:28
Average standard deviation of split frequencies: 0.010373
585500 -- (-1244.634) (-1243.318) [-1245.043] (-1244.408) * (-1241.135) [-1241.289] (-1244.486) (-1239.432) -- 0:00:28
586000 -- (-1242.985) (-1243.464) [-1240.155] (-1244.181) * (-1241.653) (-1242.261) (-1242.966) [-1241.834] -- 0:00:28
586500 -- (-1244.712) (-1243.067) (-1243.472) [-1240.531] * (-1247.487) (-1240.820) (-1243.322) [-1243.468] -- 0:00:28
587000 -- (-1241.975) (-1241.603) (-1241.501) [-1240.518] * (-1242.874) (-1240.712) [-1242.218] (-1244.850) -- 0:00:28
587500 -- [-1244.675] (-1244.073) (-1240.554) (-1245.310) * (-1243.782) (-1241.174) [-1245.800] (-1243.763) -- 0:00:28
588000 -- (-1241.917) (-1244.622) [-1242.228] (-1240.585) * (-1243.494) (-1241.744) [-1242.780] (-1243.140) -- 0:00:28
588500 -- (-1243.306) (-1244.658) (-1241.663) [-1240.892] * [-1241.717] (-1243.243) (-1242.159) (-1242.161) -- 0:00:27
589000 -- (-1241.565) [-1242.767] (-1244.752) (-1242.623) * (-1242.347) (-1241.814) [-1241.925] (-1241.513) -- 0:00:27
589500 -- (-1243.617) [-1240.737] (-1241.470) (-1240.675) * (-1241.374) (-1243.287) [-1241.092] (-1242.206) -- 0:00:27
590000 -- (-1243.573) (-1240.894) (-1241.983) [-1241.015] * [-1239.510] (-1244.421) (-1242.252) (-1242.679) -- 0:00:27
Average standard deviation of split frequencies: 0.010963
590500 -- (-1244.151) (-1241.623) [-1242.495] (-1241.081) * [-1240.889] (-1241.229) (-1241.759) (-1243.985) -- 0:00:27
591000 -- [-1243.832] (-1241.403) (-1241.300) (-1241.465) * (-1242.538) [-1242.370] (-1242.100) (-1240.690) -- 0:00:27
591500 -- [-1241.806] (-1243.405) (-1241.695) (-1242.504) * (-1243.279) (-1242.688) [-1240.861] (-1246.437) -- 0:00:27
592000 -- (-1241.555) [-1244.269] (-1241.529) (-1240.175) * (-1243.642) (-1242.204) [-1241.146] (-1242.747) -- 0:00:27
592500 -- (-1239.772) (-1243.021) (-1240.982) [-1240.355] * (-1243.650) (-1241.273) [-1243.113] (-1243.000) -- 0:00:27
593000 -- (-1238.014) [-1242.052] (-1241.319) (-1242.108) * (-1243.166) (-1241.650) [-1241.150] (-1241.438) -- 0:00:27
593500 -- (-1240.749) (-1241.812) (-1242.732) [-1241.719] * (-1241.322) [-1242.664] (-1241.177) (-1243.715) -- 0:00:27
594000 -- [-1241.270] (-1242.616) (-1242.654) (-1243.159) * (-1241.913) (-1241.655) (-1242.210) [-1242.444] -- 0:00:27
594500 -- (-1241.989) (-1242.046) [-1241.840] (-1243.591) * (-1241.737) [-1242.435] (-1244.047) (-1246.419) -- 0:00:27
595000 -- (-1243.303) (-1241.701) (-1242.026) [-1242.600] * (-1240.150) [-1241.727] (-1242.422) (-1246.711) -- 0:00:27
Average standard deviation of split frequencies: 0.010241
595500 -- (-1240.762) [-1243.301] (-1243.016) (-1238.928) * [-1240.844] (-1241.414) (-1241.112) (-1242.808) -- 0:00:27
596000 -- (-1241.348) (-1241.428) (-1242.835) [-1243.733] * (-1243.138) [-1242.463] (-1243.096) (-1240.717) -- 0:00:27
596500 -- (-1242.255) (-1244.708) [-1244.453] (-1241.237) * (-1241.528) (-1242.922) (-1241.256) [-1242.358] -- 0:00:27
597000 -- [-1240.375] (-1244.402) (-1241.133) (-1241.435) * [-1240.928] (-1242.591) (-1243.289) (-1242.336) -- 0:00:27
597500 -- (-1241.481) (-1243.677) [-1241.812] (-1242.858) * [-1244.227] (-1242.167) (-1243.515) (-1243.623) -- 0:00:27
598000 -- [-1241.888] (-1241.604) (-1241.039) (-1242.165) * (-1244.072) (-1244.732) [-1242.710] (-1242.513) -- 0:00:27
598500 -- [-1240.800] (-1243.533) (-1242.565) (-1242.095) * (-1241.262) [-1243.127] (-1242.206) (-1242.298) -- 0:00:27
599000 -- (-1239.530) (-1243.858) (-1240.935) [-1242.427] * [-1241.950] (-1240.961) (-1241.556) (-1244.362) -- 0:00:27
599500 -- (-1242.097) (-1245.576) [-1242.342] (-1243.773) * (-1248.053) [-1241.657] (-1242.486) (-1242.404) -- 0:00:27
600000 -- (-1242.450) [-1242.296] (-1243.135) (-1245.277) * [-1246.020] (-1241.171) (-1240.867) (-1242.938) -- 0:00:27
Average standard deviation of split frequencies: 0.010450
600500 -- (-1246.190) (-1244.836) (-1246.178) [-1239.740] * (-1242.723) (-1241.607) (-1241.837) [-1246.094] -- 0:00:27
601000 -- (-1248.284) (-1241.109) [-1241.893] (-1242.684) * (-1242.285) [-1240.846] (-1240.863) (-1250.282) -- 0:00:27
601500 -- (-1240.576) (-1240.969) [-1241.735] (-1243.209) * (-1241.801) [-1240.863] (-1240.612) (-1242.317) -- 0:00:27
602000 -- (-1241.906) [-1241.060] (-1241.059) (-1240.655) * (-1243.951) [-1243.960] (-1241.012) (-1242.296) -- 0:00:27
602500 -- [-1241.668] (-1242.060) (-1243.854) (-1241.278) * (-1244.083) [-1245.464] (-1242.069) (-1241.588) -- 0:00:27
603000 -- [-1243.788] (-1241.995) (-1241.882) (-1242.800) * (-1245.481) [-1242.655] (-1242.667) (-1241.679) -- 0:00:26
603500 -- (-1242.573) (-1241.362) (-1241.914) [-1242.713] * (-1243.988) (-1243.110) [-1241.020] (-1241.678) -- 0:00:26
604000 -- [-1242.726] (-1243.578) (-1243.358) (-1243.232) * (-1244.686) (-1241.776) [-1239.288] (-1242.696) -- 0:00:26
604500 -- (-1242.268) (-1245.311) [-1243.572] (-1242.094) * (-1243.360) (-1242.682) [-1241.762] (-1244.741) -- 0:00:26
605000 -- (-1240.341) [-1241.674] (-1244.679) (-1240.212) * (-1246.616) (-1241.580) [-1242.128] (-1243.707) -- 0:00:26
Average standard deviation of split frequencies: 0.010809
605500 -- (-1242.987) [-1241.132] (-1243.716) (-1243.078) * (-1245.078) (-1241.528) (-1239.480) [-1241.376] -- 0:00:26
606000 -- (-1242.555) (-1246.023) [-1244.630] (-1242.213) * (-1242.306) (-1241.602) (-1241.748) [-1241.232] -- 0:00:26
606500 -- (-1240.402) [-1240.146] (-1241.977) (-1241.200) * [-1241.280] (-1247.096) (-1244.237) (-1242.796) -- 0:00:26
607000 -- [-1242.081] (-1243.062) (-1241.113) (-1240.613) * (-1241.444) (-1245.013) [-1243.518] (-1243.180) -- 0:00:26
607500 -- (-1243.363) [-1242.555] (-1242.091) (-1241.737) * (-1243.802) (-1240.931) [-1240.560] (-1242.194) -- 0:00:26
608000 -- (-1243.242) [-1242.702] (-1241.213) (-1241.218) * (-1240.805) [-1239.841] (-1238.663) (-1241.519) -- 0:00:26
608500 -- [-1244.021] (-1240.846) (-1242.667) (-1239.568) * (-1241.663) [-1242.627] (-1241.374) (-1247.149) -- 0:00:26
609000 -- (-1245.670) (-1240.044) (-1240.137) [-1241.628] * (-1241.725) [-1244.802] (-1242.883) (-1244.323) -- 0:00:26
609500 -- [-1244.126] (-1241.213) (-1239.139) (-1240.889) * (-1242.909) [-1240.162] (-1240.515) (-1244.041) -- 0:00:26
610000 -- (-1240.032) [-1243.742] (-1241.484) (-1246.438) * (-1242.413) (-1242.428) [-1241.489] (-1242.130) -- 0:00:26
Average standard deviation of split frequencies: 0.010360
610500 -- (-1242.045) (-1241.218) (-1242.036) [-1240.894] * (-1244.872) (-1241.346) (-1242.318) [-1241.448] -- 0:00:26
611000 -- (-1241.063) [-1243.433] (-1243.005) (-1241.399) * (-1244.653) [-1240.930] (-1244.168) (-1240.962) -- 0:00:26
611500 -- [-1243.792] (-1240.976) (-1243.141) (-1243.766) * (-1242.320) (-1245.040) [-1241.971] (-1241.939) -- 0:00:26
612000 -- (-1240.845) (-1245.952) (-1244.830) [-1242.508] * [-1242.347] (-1243.402) (-1241.533) (-1240.866) -- 0:00:26
612500 -- [-1241.885] (-1244.626) (-1245.099) (-1238.911) * (-1241.332) (-1239.358) (-1240.916) [-1243.789] -- 0:00:26
613000 -- (-1244.184) (-1239.800) [-1245.408] (-1240.520) * (-1242.929) [-1241.500] (-1241.674) (-1244.721) -- 0:00:26
613500 -- (-1243.143) [-1241.330] (-1246.170) (-1242.270) * [-1241.041] (-1241.784) (-1246.349) (-1243.871) -- 0:00:26
614000 -- (-1239.144) (-1241.694) (-1243.724) [-1241.910] * [-1242.378] (-1243.359) (-1246.249) (-1242.005) -- 0:00:26
614500 -- (-1242.344) [-1242.522] (-1243.336) (-1241.141) * (-1243.815) (-1250.152) (-1244.268) [-1242.878] -- 0:00:26
615000 -- [-1242.915] (-1243.542) (-1241.579) (-1242.786) * (-1243.430) (-1248.984) (-1242.484) [-1241.632] -- 0:00:26
Average standard deviation of split frequencies: 0.010230
615500 -- (-1240.727) [-1243.043] (-1242.538) (-1243.392) * (-1241.704) [-1246.799] (-1241.705) (-1241.617) -- 0:00:26
616000 -- [-1241.755] (-1243.109) (-1241.622) (-1244.710) * [-1241.880] (-1239.453) (-1248.410) (-1241.276) -- 0:00:26
616500 -- (-1244.494) [-1241.899] (-1245.510) (-1240.360) * [-1243.617] (-1243.518) (-1245.405) (-1242.909) -- 0:00:26
617000 -- (-1244.167) (-1241.262) (-1241.132) [-1242.227] * [-1242.955] (-1243.957) (-1244.054) (-1246.097) -- 0:00:26
617500 -- (-1242.598) (-1240.413) (-1244.466) [-1240.986] * (-1243.705) [-1243.566] (-1242.334) (-1245.790) -- 0:00:26
618000 -- (-1240.421) (-1241.778) (-1241.977) [-1241.119] * (-1243.652) [-1247.568] (-1242.812) (-1243.114) -- 0:00:25
618500 -- (-1242.343) [-1238.766] (-1242.120) (-1244.308) * (-1240.189) (-1244.797) (-1242.118) [-1241.797] -- 0:00:25
619000 -- [-1242.020] (-1241.135) (-1245.497) (-1248.424) * (-1242.612) [-1241.073] (-1244.519) (-1241.370) -- 0:00:25
619500 -- (-1241.094) (-1239.036) [-1243.871] (-1242.706) * [-1242.323] (-1243.684) (-1242.071) (-1242.139) -- 0:00:25
620000 -- (-1244.606) (-1240.250) [-1241.857] (-1240.940) * (-1244.576) [-1240.945] (-1243.009) (-1242.969) -- 0:00:25
Average standard deviation of split frequencies: 0.010393
620500 -- [-1241.423] (-1242.984) (-1245.913) (-1240.898) * (-1245.982) (-1243.383) [-1242.457] (-1243.134) -- 0:00:25
621000 -- (-1241.577) (-1241.996) [-1246.248] (-1241.905) * (-1242.505) [-1240.566] (-1241.972) (-1241.424) -- 0:00:25
621500 -- [-1241.446] (-1243.059) (-1243.850) (-1241.881) * (-1243.858) (-1243.435) (-1246.930) [-1244.383] -- 0:00:25
622000 -- [-1242.874] (-1241.175) (-1243.925) (-1241.353) * (-1244.427) (-1243.610) [-1241.528] (-1242.826) -- 0:00:25
622500 -- (-1244.389) (-1242.681) [-1242.793] (-1242.806) * [-1246.133] (-1242.312) (-1242.187) (-1246.441) -- 0:00:25
623000 -- [-1243.436] (-1242.032) (-1243.461) (-1242.434) * (-1240.734) (-1242.166) (-1242.117) [-1240.936] -- 0:00:25
623500 -- [-1241.840] (-1241.699) (-1243.951) (-1242.733) * (-1241.382) (-1241.203) [-1242.357] (-1241.558) -- 0:00:25
624000 -- (-1244.289) [-1239.841] (-1241.542) (-1242.044) * (-1243.713) (-1244.353) (-1243.175) [-1242.606] -- 0:00:25
624500 -- (-1241.220) (-1240.985) (-1243.456) [-1241.943] * (-1242.939) (-1241.285) (-1246.513) [-1241.383] -- 0:00:25
625000 -- [-1241.516] (-1240.486) (-1243.071) (-1244.356) * (-1243.039) [-1241.138] (-1245.346) (-1240.885) -- 0:00:25
Average standard deviation of split frequencies: 0.010305
625500 -- (-1245.218) (-1241.188) [-1244.755] (-1241.332) * (-1241.347) (-1242.135) (-1241.004) [-1244.932] -- 0:00:25
626000 -- (-1242.415) (-1241.179) (-1241.631) [-1241.812] * (-1244.209) (-1240.490) [-1238.314] (-1241.986) -- 0:00:25
626500 -- (-1244.247) [-1242.278] (-1243.616) (-1243.580) * (-1244.716) (-1243.950) [-1239.602] (-1241.204) -- 0:00:25
627000 -- (-1244.012) [-1241.958] (-1241.185) (-1240.525) * [-1246.134] (-1241.873) (-1242.302) (-1241.111) -- 0:00:25
627500 -- (-1241.844) (-1241.372) [-1240.687] (-1244.162) * (-1241.445) [-1241.971] (-1241.842) (-1243.630) -- 0:00:25
628000 -- (-1241.962) (-1241.830) [-1243.583] (-1243.503) * [-1241.276] (-1242.357) (-1243.114) (-1243.656) -- 0:00:25
628500 -- [-1242.349] (-1241.183) (-1241.273) (-1246.294) * (-1241.137) (-1241.413) [-1241.952] (-1243.761) -- 0:00:25
629000 -- (-1242.374) (-1242.132) [-1240.044] (-1243.981) * (-1241.822) (-1242.963) [-1240.143] (-1240.627) -- 0:00:25
629500 -- (-1247.740) [-1241.561] (-1247.372) (-1242.060) * [-1241.172] (-1241.577) (-1245.671) (-1241.989) -- 0:00:25
630000 -- [-1240.338] (-1243.602) (-1240.632) (-1243.002) * [-1242.614] (-1243.855) (-1247.871) (-1241.162) -- 0:00:25
Average standard deviation of split frequencies: 0.009756
630500 -- (-1241.657) (-1243.680) (-1238.845) [-1241.296] * (-1244.191) (-1243.915) [-1241.487] (-1243.327) -- 0:00:25
631000 -- (-1243.184) (-1243.149) (-1244.504) [-1241.291] * [-1241.493] (-1243.599) (-1240.403) (-1242.223) -- 0:00:25
631500 -- (-1242.846) [-1240.677] (-1244.104) (-1247.128) * (-1240.932) (-1245.312) (-1241.946) [-1241.080] -- 0:00:25
632000 -- [-1241.641] (-1241.677) (-1240.840) (-1245.106) * (-1243.243) (-1245.823) [-1243.027] (-1240.757) -- 0:00:25
632500 -- (-1244.754) (-1240.850) (-1238.731) [-1242.936] * (-1241.947) [-1246.018] (-1243.026) (-1241.016) -- 0:00:24
633000 -- [-1242.024] (-1238.831) (-1241.779) (-1242.799) * (-1246.871) (-1248.790) (-1247.794) [-1243.101] -- 0:00:24
633500 -- (-1242.460) (-1241.867) [-1240.714] (-1243.764) * [-1241.454] (-1246.324) (-1247.007) (-1242.916) -- 0:00:24
634000 -- (-1242.342) (-1241.371) [-1241.173] (-1242.290) * (-1242.771) (-1242.017) [-1249.826] (-1245.449) -- 0:00:24
634500 -- (-1242.786) [-1243.407] (-1239.139) (-1242.884) * [-1242.042] (-1241.793) (-1241.786) (-1247.429) -- 0:00:24
635000 -- (-1243.333) (-1240.907) (-1242.055) [-1241.999] * (-1243.489) (-1243.165) [-1239.444] (-1245.374) -- 0:00:24
Average standard deviation of split frequencies: 0.009714
635500 -- [-1242.393] (-1240.795) (-1241.698) (-1244.143) * [-1241.687] (-1242.820) (-1244.431) (-1245.090) -- 0:00:24
636000 -- (-1243.299) (-1243.452) [-1242.549] (-1242.846) * (-1242.233) (-1242.417) (-1245.162) [-1241.606] -- 0:00:24
636500 -- [-1243.092] (-1245.871) (-1243.402) (-1241.905) * (-1241.797) (-1249.220) (-1245.393) [-1242.550] -- 0:00:24
637000 -- (-1242.489) (-1242.003) (-1243.164) [-1243.805] * (-1241.804) [-1241.292] (-1242.701) (-1244.299) -- 0:00:24
637500 -- (-1241.088) (-1244.627) (-1243.040) [-1243.343] * (-1246.048) (-1244.857) [-1241.902] (-1242.595) -- 0:00:24
638000 -- (-1241.335) [-1239.745] (-1243.546) (-1243.089) * [-1241.409] (-1241.555) (-1243.414) (-1242.506) -- 0:00:24
638500 -- (-1241.537) (-1241.844) (-1243.398) [-1240.507] * (-1243.094) (-1241.761) [-1241.484] (-1244.566) -- 0:00:24
639000 -- (-1243.952) [-1240.625] (-1243.044) (-1240.904) * (-1241.227) (-1241.223) [-1245.126] (-1244.321) -- 0:00:24
639500 -- [-1244.387] (-1243.505) (-1244.659) (-1243.693) * (-1242.487) (-1242.610) (-1243.917) [-1246.249] -- 0:00:24
640000 -- (-1241.699) (-1240.807) (-1244.319) [-1241.999] * (-1242.854) (-1242.738) (-1242.244) [-1244.948] -- 0:00:24
Average standard deviation of split frequencies: 0.009720
640500 -- (-1241.978) (-1242.753) (-1244.460) [-1244.043] * (-1242.090) (-1241.660) (-1240.594) [-1240.933] -- 0:00:24
641000 -- (-1240.589) (-1241.573) [-1241.024] (-1242.236) * (-1243.920) [-1242.382] (-1244.230) (-1240.864) -- 0:00:24
641500 -- [-1242.406] (-1242.662) (-1243.219) (-1246.253) * (-1243.764) [-1242.133] (-1242.532) (-1241.371) -- 0:00:24
642000 -- (-1243.688) (-1244.123) [-1241.172] (-1241.548) * (-1244.463) [-1240.959] (-1251.028) (-1241.142) -- 0:00:24
642500 -- (-1242.337) (-1242.873) [-1240.246] (-1241.406) * (-1244.586) (-1241.510) [-1241.515] (-1242.921) -- 0:00:24
643000 -- (-1242.884) [-1242.269] (-1241.724) (-1244.106) * (-1241.561) (-1247.385) (-1243.993) [-1244.351] -- 0:00:24
643500 -- (-1244.486) [-1240.672] (-1241.586) (-1245.684) * (-1242.006) (-1246.433) [-1242.074] (-1244.560) -- 0:00:24
644000 -- (-1243.925) (-1244.700) [-1241.994] (-1241.755) * (-1244.370) (-1250.315) [-1241.228] (-1243.285) -- 0:00:24
644500 -- (-1244.638) [-1243.023] (-1243.176) (-1243.941) * (-1241.343) (-1242.306) (-1240.771) [-1242.617] -- 0:00:24
645000 -- [-1241.684] (-1245.185) (-1245.654) (-1241.761) * (-1239.536) (-1245.185) (-1243.868) [-1242.329] -- 0:00:24
Average standard deviation of split frequencies: 0.009717
645500 -- (-1241.469) [-1242.177] (-1243.466) (-1246.894) * [-1238.931] (-1241.108) (-1244.560) (-1240.633) -- 0:00:24
646000 -- [-1239.709] (-1243.253) (-1242.654) (-1242.007) * (-1243.841) (-1241.542) (-1244.876) [-1241.827] -- 0:00:24
646500 -- (-1241.486) (-1243.298) [-1241.000] (-1241.415) * [-1241.899] (-1241.591) (-1243.586) (-1244.237) -- 0:00:24
647000 -- [-1241.284] (-1243.154) (-1243.307) (-1243.842) * (-1241.415) (-1241.508) [-1240.850] (-1243.682) -- 0:00:24
647500 -- (-1241.665) [-1241.943] (-1239.707) (-1242.175) * (-1241.559) [-1241.453] (-1240.827) (-1242.652) -- 0:00:23
648000 -- (-1240.515) (-1244.132) [-1241.805] (-1241.711) * (-1242.480) (-1242.626) (-1241.409) [-1243.799] -- 0:00:23
648500 -- [-1241.952] (-1243.418) (-1241.204) (-1241.260) * (-1241.987) (-1245.256) [-1241.367] (-1243.119) -- 0:00:23
649000 -- (-1242.453) (-1245.823) [-1240.263] (-1242.061) * [-1241.318] (-1246.022) (-1244.018) (-1242.997) -- 0:00:23
649500 -- (-1238.977) [-1240.720] (-1246.169) (-1242.663) * (-1244.640) [-1244.128] (-1240.975) (-1244.731) -- 0:00:23
650000 -- (-1240.467) [-1242.214] (-1246.675) (-1241.384) * (-1242.466) (-1242.360) [-1244.597] (-1242.054) -- 0:00:23
Average standard deviation of split frequencies: 0.009418
650500 -- (-1240.532) [-1240.895] (-1240.877) (-1244.504) * [-1238.640] (-1243.858) (-1240.863) (-1241.125) -- 0:00:23
651000 -- (-1245.217) [-1243.046] (-1241.079) (-1243.937) * [-1240.347] (-1243.140) (-1243.819) (-1241.175) -- 0:00:23
651500 -- (-1241.973) [-1242.204] (-1242.833) (-1246.100) * (-1242.398) (-1242.304) [-1244.930] (-1243.872) -- 0:00:23
652000 -- (-1242.207) (-1243.308) [-1241.722] (-1241.491) * (-1242.086) (-1243.348) [-1243.174] (-1244.385) -- 0:00:23
652500 -- [-1241.458] (-1242.196) (-1241.271) (-1241.549) * (-1244.874) (-1239.537) (-1243.043) [-1241.293] -- 0:00:23
653000 -- (-1240.802) (-1240.783) [-1240.856] (-1241.466) * (-1238.669) (-1242.928) [-1243.953] (-1241.868) -- 0:00:23
653500 -- [-1242.158] (-1241.667) (-1243.491) (-1243.848) * [-1239.387] (-1244.890) (-1242.462) (-1243.166) -- 0:00:23
654000 -- (-1241.901) [-1244.192] (-1245.584) (-1241.659) * (-1240.991) (-1240.729) (-1242.546) [-1241.786] -- 0:00:23
654500 -- [-1242.246] (-1240.937) (-1246.985) (-1242.129) * [-1240.647] (-1241.468) (-1243.424) (-1240.923) -- 0:00:23
655000 -- (-1240.930) (-1240.717) (-1244.180) [-1248.633] * (-1244.039) (-1242.274) (-1242.297) [-1241.729] -- 0:00:23
Average standard deviation of split frequencies: 0.009191
655500 -- (-1244.273) (-1241.835) [-1240.108] (-1243.827) * [-1242.740] (-1241.384) (-1245.798) (-1243.609) -- 0:00:23
656000 -- (-1245.651) (-1241.549) (-1244.420) [-1239.667] * [-1242.373] (-1243.061) (-1243.144) (-1242.436) -- 0:00:23
656500 -- [-1241.677] (-1241.737) (-1242.924) (-1242.991) * (-1243.208) [-1242.032] (-1239.157) (-1242.077) -- 0:00:23
657000 -- (-1243.533) (-1243.241) [-1242.322] (-1245.253) * (-1244.153) (-1248.014) [-1240.766] (-1247.880) -- 0:00:23
657500 -- [-1244.707] (-1243.804) (-1245.657) (-1242.416) * (-1243.430) [-1242.990] (-1242.031) (-1242.342) -- 0:00:23
658000 -- (-1241.370) (-1241.377) [-1241.028] (-1241.715) * (-1242.584) (-1251.999) (-1244.579) [-1243.385] -- 0:00:23
658500 -- (-1242.356) (-1241.186) (-1244.090) [-1242.130] * [-1244.334] (-1250.583) (-1241.028) (-1241.089) -- 0:00:23
659000 -- (-1242.352) (-1240.933) (-1242.927) [-1241.889] * [-1242.341] (-1242.379) (-1244.621) (-1244.935) -- 0:00:23
659500 -- (-1241.257) (-1243.261) [-1243.034] (-1241.709) * (-1244.052) (-1241.464) (-1242.093) [-1239.344] -- 0:00:23
660000 -- (-1243.471) (-1242.803) (-1245.635) [-1241.079] * (-1242.447) [-1243.751] (-1247.087) (-1241.847) -- 0:00:23
Average standard deviation of split frequencies: 0.008975
660500 -- (-1243.062) (-1242.709) [-1246.264] (-1242.597) * (-1242.448) (-1244.047) (-1241.377) [-1243.069] -- 0:00:23
661000 -- (-1245.398) [-1241.084] (-1242.592) (-1243.112) * (-1252.893) (-1241.348) [-1241.636] (-1241.520) -- 0:00:23
661500 -- (-1244.597) (-1249.817) (-1244.101) [-1241.361] * [-1246.776] (-1242.085) (-1241.931) (-1241.755) -- 0:00:23
662000 -- (-1240.818) (-1244.110) [-1241.026] (-1241.600) * [-1241.583] (-1242.091) (-1241.785) (-1238.973) -- 0:00:22
662500 -- [-1241.341] (-1246.588) (-1245.171) (-1247.743) * [-1243.444] (-1241.903) (-1243.314) (-1243.484) -- 0:00:22
663000 -- [-1241.701] (-1243.698) (-1243.363) (-1241.559) * (-1241.251) [-1244.128] (-1242.317) (-1241.254) -- 0:00:22
663500 -- (-1243.075) (-1243.092) [-1242.298] (-1242.531) * (-1242.923) (-1242.662) (-1242.650) [-1245.678] -- 0:00:22
664000 -- (-1244.556) [-1241.554] (-1241.664) (-1241.764) * [-1240.845] (-1246.892) (-1242.135) (-1239.810) -- 0:00:22
664500 -- (-1241.022) (-1242.799) (-1241.460) [-1241.771] * (-1241.532) (-1242.904) (-1246.513) [-1243.513] -- 0:00:22
665000 -- (-1247.981) (-1244.212) (-1245.971) [-1245.507] * [-1240.895] (-1243.998) (-1243.801) (-1242.930) -- 0:00:22
Average standard deviation of split frequencies: 0.008755
665500 -- (-1242.399) [-1242.357] (-1245.158) (-1243.995) * (-1241.108) (-1240.963) [-1239.438] (-1245.398) -- 0:00:22
666000 -- [-1243.202] (-1244.186) (-1244.599) (-1242.926) * (-1243.167) [-1248.109] (-1241.249) (-1243.509) -- 0:00:22
666500 -- (-1241.699) (-1243.433) (-1242.574) [-1241.924] * (-1239.214) [-1244.376] (-1241.486) (-1244.071) -- 0:00:22
667000 -- (-1243.218) [-1241.721] (-1240.518) (-1242.104) * (-1242.558) [-1242.082] (-1241.491) (-1243.597) -- 0:00:22
667500 -- (-1241.035) [-1238.857] (-1242.536) (-1241.390) * (-1241.999) (-1242.904) [-1241.133] (-1245.190) -- 0:00:22
668000 -- (-1245.882) (-1242.046) [-1243.215] (-1244.254) * (-1241.948) (-1241.768) (-1241.381) [-1244.534] -- 0:00:22
668500 -- (-1245.517) (-1240.657) [-1244.483] (-1243.871) * [-1240.425] (-1240.323) (-1239.863) (-1246.061) -- 0:00:22
669000 -- (-1247.282) (-1246.392) (-1240.789) [-1242.994] * (-1240.780) [-1245.785] (-1241.793) (-1241.652) -- 0:00:22
669500 -- (-1243.249) (-1242.754) (-1242.101) [-1241.958] * [-1243.167] (-1244.155) (-1241.994) (-1240.684) -- 0:00:22
670000 -- (-1242.194) (-1244.056) (-1243.848) [-1241.737] * [-1242.305] (-1242.950) (-1243.050) (-1243.226) -- 0:00:22
Average standard deviation of split frequencies: 0.008916
670500 -- (-1240.367) (-1240.610) [-1242.094] (-1243.341) * [-1240.432] (-1243.451) (-1243.532) (-1242.696) -- 0:00:22
671000 -- [-1240.623] (-1241.599) (-1241.707) (-1240.360) * (-1242.667) [-1240.954] (-1241.759) (-1242.659) -- 0:00:22
671500 -- (-1243.229) [-1241.793] (-1242.602) (-1244.470) * (-1242.357) (-1241.492) [-1239.822] (-1245.258) -- 0:00:22
672000 -- [-1242.415] (-1243.244) (-1243.693) (-1241.520) * [-1240.812] (-1241.148) (-1243.223) (-1247.359) -- 0:00:22
672500 -- (-1244.637) [-1241.671] (-1244.633) (-1244.969) * (-1242.986) (-1241.978) (-1245.948) [-1240.918] -- 0:00:22
673000 -- (-1247.868) (-1242.968) (-1246.183) [-1240.817] * (-1243.739) (-1239.651) [-1241.978] (-1244.129) -- 0:00:22
673500 -- (-1245.874) (-1242.025) [-1245.990] (-1242.616) * [-1240.323] (-1242.900) (-1244.159) (-1243.392) -- 0:00:22
674000 -- (-1243.403) (-1243.923) [-1241.173] (-1242.862) * [-1241.301] (-1240.289) (-1242.240) (-1240.944) -- 0:00:22
674500 -- (-1243.075) (-1245.067) (-1242.198) [-1241.437] * (-1244.159) (-1242.175) (-1241.067) [-1240.454] -- 0:00:22
675000 -- [-1244.569] (-1245.045) (-1242.735) (-1248.589) * [-1239.859] (-1240.058) (-1241.444) (-1242.672) -- 0:00:22
Average standard deviation of split frequencies: 0.008331
675500 -- (-1240.192) (-1242.855) (-1243.606) [-1242.489] * (-1241.585) [-1242.271] (-1242.239) (-1239.791) -- 0:00:22
676000 -- [-1241.160] (-1247.110) (-1242.960) (-1241.063) * [-1240.610] (-1242.325) (-1242.647) (-1241.824) -- 0:00:22
676500 -- (-1242.391) (-1245.560) [-1243.058] (-1241.612) * [-1240.925] (-1245.239) (-1242.836) (-1240.101) -- 0:00:21
677000 -- [-1240.520] (-1245.089) (-1241.490) (-1241.862) * (-1245.568) [-1243.949] (-1242.730) (-1242.348) -- 0:00:21
677500 -- (-1241.756) (-1245.203) (-1245.014) [-1243.558] * (-1248.886) [-1243.545] (-1241.808) (-1240.870) -- 0:00:21
678000 -- [-1241.462] (-1246.408) (-1241.233) (-1242.455) * (-1245.737) (-1242.439) (-1243.075) [-1240.752] -- 0:00:21
678500 -- [-1245.644] (-1241.065) (-1242.598) (-1243.392) * (-1241.746) (-1242.736) (-1242.015) [-1244.389] -- 0:00:21
679000 -- (-1243.714) (-1242.176) (-1239.728) [-1239.541] * (-1241.080) (-1244.342) (-1242.135) [-1240.996] -- 0:00:21
679500 -- (-1246.212) [-1242.661] (-1240.620) (-1240.347) * [-1245.198] (-1241.185) (-1244.567) (-1243.466) -- 0:00:21
680000 -- (-1242.941) [-1239.857] (-1240.831) (-1242.393) * (-1241.809) [-1242.841] (-1242.117) (-1241.404) -- 0:00:21
Average standard deviation of split frequencies: 0.008566
680500 -- (-1243.210) [-1241.559] (-1241.546) (-1244.182) * [-1241.281] (-1242.808) (-1241.691) (-1242.750) -- 0:00:21
681000 -- [-1242.865] (-1244.044) (-1241.359) (-1246.722) * (-1240.526) (-1238.760) (-1243.715) [-1242.492] -- 0:00:21
681500 -- (-1244.993) (-1241.463) (-1241.229) [-1240.693] * (-1241.661) (-1241.442) [-1243.032] (-1241.060) -- 0:00:21
682000 -- (-1244.414) [-1242.170] (-1240.760) (-1243.078) * [-1241.398] (-1243.492) (-1241.963) (-1240.183) -- 0:00:21
682500 -- [-1240.943] (-1243.549) (-1242.971) (-1243.359) * (-1242.128) [-1244.053] (-1241.847) (-1245.683) -- 0:00:21
683000 -- (-1242.323) [-1243.639] (-1242.747) (-1243.475) * (-1241.841) [-1242.593] (-1241.703) (-1243.972) -- 0:00:21
683500 -- (-1241.615) (-1242.313) [-1240.461] (-1242.708) * (-1241.730) (-1243.154) [-1241.565] (-1242.617) -- 0:00:21
684000 -- (-1241.963) (-1241.439) [-1241.503] (-1245.023) * [-1240.825] (-1242.177) (-1242.198) (-1242.785) -- 0:00:21
684500 -- (-1242.942) [-1241.511] (-1242.765) (-1240.407) * (-1243.729) (-1241.616) (-1242.474) [-1241.211] -- 0:00:21
685000 -- (-1241.394) (-1242.755) (-1241.359) [-1241.348] * (-1242.456) (-1246.747) [-1241.111] (-1242.062) -- 0:00:21
Average standard deviation of split frequencies: 0.008210
685500 -- (-1239.500) [-1243.667] (-1243.860) (-1241.381) * (-1242.085) (-1243.085) (-1243.079) [-1241.734] -- 0:00:21
686000 -- (-1242.904) (-1242.786) [-1244.156] (-1242.845) * (-1244.738) [-1241.951] (-1251.611) (-1241.062) -- 0:00:21
686500 -- (-1245.555) (-1241.353) (-1241.557) [-1241.943] * (-1242.217) [-1244.024] (-1242.340) (-1241.932) -- 0:00:21
687000 -- [-1241.942] (-1243.583) (-1242.303) (-1240.974) * (-1242.249) [-1244.098] (-1243.274) (-1239.268) -- 0:00:21
687500 -- (-1242.834) [-1242.737] (-1242.132) (-1240.950) * (-1241.542) [-1241.524] (-1241.023) (-1242.168) -- 0:00:21
688000 -- [-1244.779] (-1241.944) (-1242.574) (-1241.504) * (-1243.025) (-1247.124) [-1242.720] (-1239.552) -- 0:00:21
688500 -- (-1243.561) (-1241.744) [-1241.139] (-1243.956) * (-1242.055) (-1241.962) (-1241.495) [-1240.858] -- 0:00:21
689000 -- (-1246.345) (-1241.755) [-1240.225] (-1241.132) * (-1243.251) (-1244.364) [-1241.647] (-1242.295) -- 0:00:21
689500 -- (-1243.779) (-1241.855) [-1239.531] (-1241.852) * (-1242.358) (-1242.849) [-1245.562] (-1241.801) -- 0:00:21
690000 -- (-1243.768) [-1242.908] (-1242.824) (-1242.610) * (-1240.581) (-1243.028) (-1249.983) [-1243.257] -- 0:00:21
Average standard deviation of split frequencies: 0.008298
690500 -- (-1247.520) (-1243.387) [-1241.802] (-1241.888) * (-1243.773) (-1245.197) (-1242.540) [-1245.834] -- 0:00:21
691000 -- [-1241.493] (-1241.575) (-1241.570) (-1240.715) * (-1242.058) (-1245.934) [-1240.869] (-1243.850) -- 0:00:21
691500 -- (-1241.707) [-1242.811] (-1241.695) (-1240.913) * (-1241.869) (-1244.417) [-1242.433] (-1241.218) -- 0:00:20
692000 -- (-1242.423) (-1246.171) [-1242.239] (-1241.419) * (-1244.158) (-1241.127) [-1242.382] (-1250.784) -- 0:00:20
692500 -- (-1242.419) (-1241.421) (-1247.542) [-1241.418] * (-1242.576) [-1242.196] (-1242.605) (-1245.728) -- 0:00:20
693000 -- (-1241.855) [-1242.537] (-1243.206) (-1244.807) * (-1244.110) (-1243.609) [-1243.049] (-1241.506) -- 0:00:20
693500 -- (-1244.177) (-1242.805) (-1242.330) [-1246.124] * (-1241.387) [-1243.742] (-1244.039) (-1244.604) -- 0:00:20
694000 -- (-1244.253) [-1242.986] (-1243.218) (-1244.125) * (-1241.632) (-1243.404) (-1241.471) [-1243.605] -- 0:00:20
694500 -- (-1241.987) (-1244.169) [-1241.812] (-1242.679) * [-1244.903] (-1244.553) (-1242.648) (-1243.918) -- 0:00:20
695000 -- (-1244.670) [-1243.484] (-1241.607) (-1241.706) * (-1241.287) (-1241.078) (-1241.906) [-1242.379] -- 0:00:20
Average standard deviation of split frequencies: 0.007914
695500 -- [-1242.799] (-1243.560) (-1240.809) (-1242.919) * [-1239.121] (-1245.416) (-1241.960) (-1242.701) -- 0:00:20
696000 -- (-1240.562) (-1242.204) [-1241.208] (-1244.140) * [-1242.197] (-1244.337) (-1245.900) (-1242.503) -- 0:00:20
696500 -- (-1242.073) (-1243.333) (-1243.792) [-1242.501] * (-1242.651) (-1241.452) (-1242.956) [-1240.798] -- 0:00:20
697000 -- [-1243.100] (-1241.518) (-1244.809) (-1244.869) * (-1239.267) (-1241.315) (-1241.022) [-1241.151] -- 0:00:20
697500 -- (-1243.915) (-1243.076) [-1243.685] (-1241.812) * (-1242.087) (-1243.061) (-1240.678) [-1242.632] -- 0:00:20
698000 -- (-1242.704) (-1243.101) (-1241.473) [-1242.297] * [-1242.983] (-1240.859) (-1241.003) (-1241.822) -- 0:00:20
698500 -- [-1245.257] (-1241.773) (-1243.917) (-1243.601) * (-1241.980) [-1241.377] (-1241.002) (-1244.288) -- 0:00:20
699000 -- (-1241.579) (-1241.059) (-1243.468) [-1241.493] * (-1241.810) (-1241.737) (-1241.207) [-1242.800] -- 0:00:20
699500 -- (-1242.440) (-1243.974) [-1244.892] (-1243.401) * (-1240.710) [-1243.555] (-1241.206) (-1242.908) -- 0:00:20
700000 -- (-1243.834) [-1241.481] (-1247.444) (-1242.513) * [-1243.288] (-1242.659) (-1241.326) (-1240.592) -- 0:00:20
Average standard deviation of split frequencies: 0.007861
700500 -- [-1243.677] (-1242.646) (-1241.832) (-1245.311) * (-1242.500) [-1243.654] (-1241.881) (-1239.853) -- 0:00:20
701000 -- (-1244.316) (-1243.995) [-1239.987] (-1245.414) * [-1246.086] (-1241.815) (-1243.616) (-1240.647) -- 0:00:20
701500 -- (-1241.881) (-1242.563) [-1243.362] (-1238.600) * (-1241.763) (-1241.953) [-1243.650] (-1239.079) -- 0:00:20
702000 -- [-1243.850] (-1241.312) (-1242.283) (-1241.741) * (-1242.385) [-1241.037] (-1243.327) (-1243.881) -- 0:00:20
702500 -- (-1241.570) (-1242.559) [-1242.727] (-1243.459) * [-1243.506] (-1241.431) (-1243.670) (-1238.510) -- 0:00:20
703000 -- (-1240.053) (-1241.744) [-1243.926] (-1243.165) * (-1240.255) (-1240.528) [-1244.183] (-1241.182) -- 0:00:20
703500 -- [-1242.845] (-1248.028) (-1243.744) (-1246.277) * (-1242.488) (-1241.489) [-1242.979] (-1243.062) -- 0:00:20
704000 -- (-1241.829) (-1244.410) [-1241.462] (-1242.666) * (-1242.842) (-1241.169) [-1241.609] (-1243.592) -- 0:00:20
704500 -- (-1241.615) (-1244.114) (-1241.617) [-1240.934] * (-1241.824) (-1245.499) [-1242.273] (-1244.827) -- 0:00:20
705000 -- (-1241.623) (-1244.459) [-1242.176] (-1240.777) * (-1244.164) (-1243.100) [-1242.109] (-1242.993) -- 0:00:20
Average standard deviation of split frequencies: 0.008294
705500 -- (-1243.425) (-1242.659) [-1241.078] (-1241.112) * [-1240.133] (-1239.371) (-1242.868) (-1243.969) -- 0:00:20
706000 -- [-1242.534] (-1241.320) (-1243.667) (-1241.514) * [-1241.154] (-1243.740) (-1241.436) (-1240.966) -- 0:00:19
706500 -- (-1245.662) (-1240.696) (-1242.367) [-1242.483] * (-1241.064) (-1244.957) [-1242.033] (-1244.440) -- 0:00:19
707000 -- (-1243.749) (-1241.755) (-1241.748) [-1241.385] * (-1240.973) [-1243.716] (-1242.575) (-1243.834) -- 0:00:19
707500 -- (-1240.015) (-1241.317) [-1241.907] (-1242.366) * [-1240.640] (-1240.918) (-1243.651) (-1240.511) -- 0:00:19
708000 -- (-1247.597) [-1241.694] (-1242.152) (-1242.068) * (-1241.162) (-1241.003) (-1243.190) [-1245.069] -- 0:00:19
708500 -- (-1251.206) (-1242.048) [-1243.473] (-1242.357) * (-1241.703) [-1241.811] (-1242.085) (-1240.802) -- 0:00:19
709000 -- (-1244.580) (-1244.720) (-1247.464) [-1241.246] * (-1242.631) (-1243.113) [-1242.551] (-1242.260) -- 0:00:19
709500 -- (-1244.590) (-1251.886) [-1242.764] (-1243.045) * (-1244.352) (-1244.411) (-1241.251) [-1243.816] -- 0:00:19
710000 -- (-1242.647) (-1251.099) (-1244.002) [-1241.368] * (-1243.612) (-1246.229) [-1241.194] (-1240.601) -- 0:00:19
Average standard deviation of split frequencies: 0.008519
710500 -- (-1243.330) (-1246.561) [-1241.765] (-1241.331) * (-1242.179) [-1243.634] (-1238.805) (-1244.381) -- 0:00:19
711000 -- (-1242.384) (-1240.652) (-1241.654) [-1243.644] * (-1238.317) (-1240.893) [-1243.363] (-1243.731) -- 0:00:19
711500 -- (-1241.630) (-1241.402) (-1241.932) [-1242.737] * (-1247.452) (-1240.169) [-1243.296] (-1241.993) -- 0:00:19
712000 -- (-1239.881) (-1242.130) [-1240.489] (-1242.151) * (-1242.994) [-1242.518] (-1245.357) (-1242.258) -- 0:00:19
712500 -- (-1241.786) [-1241.797] (-1242.807) (-1243.481) * (-1244.457) [-1243.387] (-1242.000) (-1241.303) -- 0:00:19
713000 -- (-1241.198) (-1241.332) [-1241.676] (-1241.199) * (-1241.257) (-1241.822) [-1240.614] (-1244.237) -- 0:00:19
713500 -- (-1241.260) [-1242.995] (-1243.039) (-1243.615) * (-1243.279) [-1241.821] (-1241.897) (-1244.855) -- 0:00:19
714000 -- [-1238.191] (-1239.594) (-1242.444) (-1243.811) * (-1240.420) [-1240.424] (-1241.464) (-1242.828) -- 0:00:19
714500 -- [-1241.274] (-1242.968) (-1244.112) (-1241.087) * (-1242.473) [-1241.861] (-1242.464) (-1241.844) -- 0:00:19
715000 -- [-1237.970] (-1241.749) (-1243.645) (-1245.015) * (-1240.961) [-1241.303] (-1243.235) (-1245.338) -- 0:00:19
Average standard deviation of split frequencies: 0.008213
715500 -- (-1242.733) [-1241.277] (-1242.728) (-1244.425) * [-1240.719] (-1241.278) (-1244.220) (-1245.122) -- 0:00:19
716000 -- (-1245.908) (-1244.253) (-1242.125) [-1241.741] * (-1243.183) [-1238.439] (-1245.491) (-1243.573) -- 0:00:19
716500 -- (-1244.627) (-1242.756) [-1242.451] (-1242.301) * (-1242.660) (-1241.224) [-1245.242] (-1243.857) -- 0:00:19
717000 -- (-1242.902) (-1244.259) [-1243.990] (-1242.768) * [-1245.854] (-1241.982) (-1249.215) (-1242.862) -- 0:00:19
717500 -- (-1243.749) (-1243.539) (-1242.016) [-1238.376] * (-1241.489) [-1243.637] (-1245.973) (-1243.422) -- 0:00:19
718000 -- (-1242.293) [-1241.086] (-1241.653) (-1239.106) * (-1241.359) [-1241.721] (-1247.239) (-1241.601) -- 0:00:19
718500 -- (-1241.117) [-1243.107] (-1241.426) (-1240.854) * (-1242.261) [-1244.999] (-1243.759) (-1240.566) -- 0:00:19
719000 -- (-1240.809) [-1244.252] (-1240.782) (-1243.630) * (-1241.217) (-1244.643) [-1241.677] (-1243.796) -- 0:00:19
719500 -- (-1241.973) (-1240.747) [-1243.738] (-1243.599) * [-1240.704] (-1243.323) (-1246.361) (-1244.091) -- 0:00:19
720000 -- (-1241.343) (-1241.306) [-1239.588] (-1245.143) * [-1240.829] (-1243.099) (-1242.430) (-1243.256) -- 0:00:19
Average standard deviation of split frequencies: 0.008022
720500 -- (-1244.500) (-1242.498) [-1242.515] (-1242.910) * (-1240.888) [-1242.575] (-1241.328) (-1243.215) -- 0:00:19
721000 -- [-1243.662] (-1246.670) (-1243.991) (-1245.255) * (-1240.560) [-1242.793] (-1241.336) (-1242.398) -- 0:00:18
721500 -- (-1242.679) [-1240.900] (-1242.752) (-1242.542) * (-1241.821) (-1241.533) (-1242.328) [-1244.002] -- 0:00:18
722000 -- (-1248.998) [-1242.320] (-1241.528) (-1240.212) * [-1241.373] (-1242.554) (-1242.365) (-1243.186) -- 0:00:18
722500 -- [-1242.094] (-1242.480) (-1245.849) (-1239.990) * (-1244.968) (-1242.789) [-1241.729] (-1243.107) -- 0:00:18
723000 -- [-1242.072] (-1241.678) (-1243.606) (-1241.232) * (-1244.718) (-1243.099) [-1242.199] (-1244.243) -- 0:00:18
723500 -- (-1242.837) [-1242.726] (-1243.396) (-1241.173) * (-1247.298) [-1241.658] (-1241.238) (-1243.946) -- 0:00:18
724000 -- [-1245.194] (-1242.145) (-1240.610) (-1241.900) * [-1243.006] (-1241.362) (-1240.839) (-1245.945) -- 0:00:18
724500 -- (-1247.167) (-1246.309) (-1240.742) [-1239.462] * (-1243.453) [-1245.052] (-1242.230) (-1242.347) -- 0:00:18
725000 -- (-1247.155) (-1244.043) [-1245.742] (-1239.749) * (-1242.143) (-1243.368) (-1242.390) [-1242.315] -- 0:00:18
Average standard deviation of split frequencies: 0.008373
725500 -- (-1249.256) (-1241.780) (-1245.432) [-1246.456] * [-1239.349] (-1242.101) (-1243.269) (-1242.215) -- 0:00:18
726000 -- [-1243.561] (-1242.709) (-1242.176) (-1241.429) * [-1240.617] (-1243.453) (-1245.054) (-1241.987) -- 0:00:18
726500 -- (-1243.966) (-1242.615) [-1238.952] (-1241.660) * (-1241.573) (-1241.757) (-1242.226) [-1244.122] -- 0:00:18
727000 -- (-1243.919) (-1242.731) [-1238.768] (-1239.685) * (-1246.425) (-1241.381) [-1242.822] (-1242.395) -- 0:00:18
727500 -- (-1241.858) [-1244.416] (-1241.112) (-1246.691) * (-1245.549) (-1241.360) (-1242.854) [-1240.671] -- 0:00:18
728000 -- [-1244.106] (-1246.025) (-1243.928) (-1239.333) * (-1242.266) (-1240.747) [-1242.054] (-1244.085) -- 0:00:18
728500 -- (-1245.320) [-1244.905] (-1240.925) (-1240.432) * (-1245.115) (-1241.391) (-1240.861) [-1243.212] -- 0:00:18
729000 -- (-1244.269) (-1242.063) [-1242.125] (-1239.622) * [-1242.366] (-1243.107) (-1243.786) (-1242.892) -- 0:00:18
729500 -- [-1241.854] (-1241.667) (-1248.976) (-1242.807) * (-1246.866) (-1240.806) [-1241.565] (-1240.467) -- 0:00:18
730000 -- (-1244.087) (-1241.444) [-1242.061] (-1239.705) * (-1243.328) (-1242.212) [-1239.672] (-1242.047) -- 0:00:18
Average standard deviation of split frequencies: 0.008455
730500 -- (-1241.352) [-1239.951] (-1241.474) (-1244.048) * (-1244.255) (-1244.339) (-1241.538) [-1241.444] -- 0:00:18
731000 -- [-1240.303] (-1246.193) (-1243.683) (-1243.691) * (-1242.176) (-1242.893) (-1244.176) [-1242.097] -- 0:00:18
731500 -- (-1246.656) [-1246.075] (-1241.548) (-1242.092) * (-1241.961) [-1244.706] (-1243.750) (-1243.129) -- 0:00:18
732000 -- [-1241.033] (-1241.426) (-1243.221) (-1242.686) * [-1244.049] (-1245.009) (-1241.635) (-1242.287) -- 0:00:18
732500 -- [-1240.819] (-1239.483) (-1241.787) (-1241.433) * (-1241.278) [-1241.879] (-1241.408) (-1244.054) -- 0:00:18
733000 -- [-1242.492] (-1240.210) (-1240.952) (-1243.071) * (-1240.943) (-1242.305) [-1240.111] (-1243.243) -- 0:00:18
733500 -- (-1245.045) [-1242.476] (-1242.169) (-1242.682) * [-1243.228] (-1242.078) (-1242.834) (-1244.242) -- 0:00:18
734000 -- (-1240.100) (-1240.869) (-1241.093) [-1242.676] * (-1244.500) (-1243.505) [-1241.002] (-1244.248) -- 0:00:18
734500 -- (-1242.175) (-1244.050) [-1241.697] (-1242.754) * (-1241.543) (-1243.354) (-1243.480) [-1243.811] -- 0:00:18
735000 -- (-1240.488) [-1239.888] (-1241.388) (-1246.507) * (-1242.126) (-1246.471) [-1241.760] (-1242.667) -- 0:00:18
Average standard deviation of split frequencies: 0.008326
735500 -- [-1242.295] (-1242.319) (-1241.813) (-1242.009) * (-1241.837) (-1245.100) [-1241.065] (-1242.637) -- 0:00:17
736000 -- (-1243.993) (-1248.042) [-1242.009] (-1243.946) * (-1240.557) [-1241.231] (-1240.688) (-1240.308) -- 0:00:17
736500 -- [-1242.113] (-1244.432) (-1241.534) (-1243.251) * [-1242.230] (-1243.076) (-1241.078) (-1241.527) -- 0:00:17
737000 -- (-1241.846) (-1244.849) (-1240.932) [-1245.685] * (-1243.208) (-1241.452) (-1241.123) [-1241.274] -- 0:00:17
737500 -- (-1239.382) (-1245.767) [-1241.001] (-1242.933) * (-1241.870) (-1241.729) [-1245.707] (-1241.890) -- 0:00:17
738000 -- (-1243.798) [-1245.719] (-1242.339) (-1245.030) * [-1240.365] (-1245.638) (-1242.627) (-1241.126) -- 0:00:17
738500 -- (-1241.274) (-1243.711) (-1242.918) [-1241.123] * (-1241.647) (-1244.185) (-1239.627) [-1244.581] -- 0:00:17
739000 -- [-1241.752] (-1242.052) (-1243.743) (-1241.293) * [-1242.635] (-1243.726) (-1244.742) (-1241.540) -- 0:00:17
739500 -- (-1242.363) (-1241.857) [-1241.401] (-1243.008) * [-1241.298] (-1241.832) (-1241.624) (-1242.396) -- 0:00:17
740000 -- (-1248.017) (-1243.441) (-1242.097) [-1243.100] * [-1240.977] (-1241.177) (-1240.250) (-1243.692) -- 0:00:17
Average standard deviation of split frequencies: 0.008374
740500 -- (-1244.166) (-1242.477) (-1244.283) [-1241.887] * (-1241.589) (-1240.879) (-1242.652) [-1243.178] -- 0:00:17
741000 -- [-1242.638] (-1241.399) (-1240.843) (-1249.242) * (-1245.805) (-1245.779) (-1242.730) [-1241.372] -- 0:00:17
741500 -- (-1241.804) (-1241.750) [-1241.772] (-1241.454) * [-1239.575] (-1250.457) (-1241.674) (-1242.124) -- 0:00:17
742000 -- (-1242.007) [-1241.243] (-1242.360) (-1244.362) * [-1239.448] (-1242.279) (-1242.569) (-1243.729) -- 0:00:17
742500 -- (-1241.506) (-1246.066) [-1242.574] (-1242.991) * (-1242.728) (-1241.624) (-1241.684) [-1244.163] -- 0:00:17
743000 -- (-1243.192) (-1244.685) [-1240.908] (-1241.734) * (-1242.766) [-1241.924] (-1242.817) (-1243.031) -- 0:00:17
743500 -- (-1241.603) [-1243.115] (-1241.583) (-1242.016) * (-1241.589) (-1242.964) [-1242.354] (-1244.274) -- 0:00:17
744000 -- (-1241.817) [-1241.010] (-1242.112) (-1243.953) * (-1241.544) (-1244.374) [-1240.642] (-1242.295) -- 0:00:17
744500 -- (-1249.691) [-1240.851] (-1247.045) (-1241.510) * (-1241.786) (-1245.140) (-1239.748) [-1243.118] -- 0:00:17
745000 -- (-1242.672) (-1241.986) (-1242.181) [-1241.806] * [-1241.246] (-1244.642) (-1240.848) (-1241.811) -- 0:00:17
Average standard deviation of split frequencies: 0.008414
745500 -- (-1242.180) (-1241.708) [-1242.007] (-1241.844) * (-1242.976) [-1242.950] (-1243.884) (-1242.065) -- 0:00:17
746000 -- (-1242.046) (-1242.834) (-1242.053) [-1242.733] * (-1243.512) (-1242.358) [-1243.167] (-1242.919) -- 0:00:17
746500 -- (-1242.339) [-1242.684] (-1240.973) (-1242.769) * (-1242.468) [-1240.749] (-1242.466) (-1241.207) -- 0:00:17
747000 -- (-1246.562) (-1243.372) [-1241.738] (-1242.834) * (-1241.634) (-1245.398) (-1242.118) [-1243.940] -- 0:00:17
747500 -- (-1243.429) [-1241.690] (-1242.565) (-1245.752) * (-1242.951) (-1245.515) (-1240.584) [-1242.476] -- 0:00:17
748000 -- (-1241.672) [-1240.421] (-1243.369) (-1241.375) * (-1245.677) (-1245.318) [-1241.097] (-1241.757) -- 0:00:17
748500 -- (-1241.722) [-1242.875] (-1243.058) (-1244.603) * (-1241.882) (-1244.286) [-1241.163] (-1241.923) -- 0:00:17
749000 -- (-1242.145) (-1240.898) (-1241.433) [-1243.004] * [-1240.333] (-1243.986) (-1241.504) (-1241.213) -- 0:00:17
749500 -- (-1240.850) (-1242.938) (-1241.165) [-1243.549] * (-1242.806) (-1240.996) [-1243.790] (-1244.507) -- 0:00:17
750000 -- (-1241.851) (-1241.508) [-1240.033] (-1240.687) * [-1241.964] (-1240.847) (-1242.186) (-1247.048) -- 0:00:17
Average standard deviation of split frequencies: 0.008461
750500 -- (-1242.232) [-1241.382] (-1241.548) (-1242.012) * (-1242.455) (-1240.812) [-1239.871] (-1247.694) -- 0:00:16
751000 -- (-1244.410) [-1241.542] (-1241.263) (-1240.805) * (-1240.850) (-1241.543) (-1241.765) [-1243.486] -- 0:00:16
751500 -- (-1244.115) (-1243.494) (-1242.340) [-1242.465] * (-1238.591) (-1241.418) [-1244.345] (-1242.506) -- 0:00:16
752000 -- (-1250.503) (-1242.937) [-1241.608] (-1245.685) * [-1243.646] (-1242.461) (-1243.441) (-1241.997) -- 0:00:16
752500 -- (-1248.741) [-1242.205] (-1240.770) (-1244.563) * (-1243.579) (-1243.186) [-1239.764] (-1242.943) -- 0:00:16
753000 -- (-1245.125) (-1241.453) [-1241.761] (-1242.802) * (-1240.649) (-1244.896) (-1242.017) [-1244.229] -- 0:00:16
753500 -- (-1244.669) (-1243.285) [-1239.485] (-1243.722) * [-1239.902] (-1239.806) (-1240.618) (-1245.316) -- 0:00:16
754000 -- (-1242.593) [-1241.055] (-1242.129) (-1246.259) * [-1238.459] (-1242.342) (-1243.533) (-1246.010) -- 0:00:16
754500 -- [-1244.346] (-1241.913) (-1241.156) (-1240.889) * (-1243.721) [-1241.370] (-1242.162) (-1242.341) -- 0:00:16
755000 -- (-1243.317) (-1241.032) [-1242.001] (-1245.286) * [-1240.861] (-1242.268) (-1241.868) (-1240.953) -- 0:00:16
Average standard deviation of split frequencies: 0.008106
755500 -- [-1242.979] (-1242.524) (-1242.082) (-1242.243) * (-1240.720) (-1242.300) [-1240.847] (-1239.474) -- 0:00:16
756000 -- (-1242.020) [-1245.945] (-1243.704) (-1242.438) * (-1240.056) (-1243.281) (-1242.585) [-1241.388] -- 0:00:16
756500 -- [-1240.698] (-1244.019) (-1243.263) (-1244.279) * [-1240.920] (-1242.443) (-1242.300) (-1241.479) -- 0:00:16
757000 -- [-1241.176] (-1242.630) (-1241.849) (-1243.476) * (-1243.167) [-1241.172] (-1240.858) (-1240.822) -- 0:00:16
757500 -- [-1241.346] (-1241.856) (-1241.720) (-1241.201) * [-1241.768] (-1243.371) (-1242.424) (-1238.573) -- 0:00:16
758000 -- (-1239.259) (-1243.952) (-1243.035) [-1242.660] * (-1244.835) (-1240.441) [-1241.370] (-1238.991) -- 0:00:16
758500 -- [-1240.147] (-1245.501) (-1245.166) (-1242.425) * (-1241.066) (-1241.076) (-1240.065) [-1240.712] -- 0:00:16
759000 -- (-1241.293) [-1243.919] (-1244.292) (-1241.721) * (-1246.914) (-1244.253) (-1241.626) [-1241.567] -- 0:00:16
759500 -- (-1241.838) (-1242.672) (-1244.202) [-1245.618] * (-1243.346) (-1243.865) (-1242.573) [-1241.986] -- 0:00:16
760000 -- (-1243.724) (-1242.489) [-1242.281] (-1244.329) * [-1244.843] (-1240.963) (-1242.373) (-1244.127) -- 0:00:16
Average standard deviation of split frequencies: 0.008285
760500 -- (-1242.150) [-1240.388] (-1242.250) (-1244.461) * (-1243.360) (-1244.354) (-1242.707) [-1241.157] -- 0:00:16
761000 -- (-1244.249) (-1247.743) [-1241.374] (-1245.669) * (-1242.663) (-1241.910) [-1241.351] (-1240.548) -- 0:00:16
761500 -- (-1243.231) (-1242.954) (-1242.678) [-1241.671] * (-1242.279) (-1242.467) (-1242.435) [-1241.050] -- 0:00:16
762000 -- (-1243.272) (-1240.923) [-1243.906] (-1243.193) * [-1243.605] (-1243.332) (-1242.638) (-1240.046) -- 0:00:16
762500 -- (-1243.317) (-1242.089) [-1242.583] (-1240.783) * (-1245.408) (-1243.010) (-1242.670) [-1242.407] -- 0:00:16
763000 -- (-1243.188) [-1240.535] (-1241.730) (-1242.080) * (-1241.198) (-1241.021) (-1242.727) [-1242.397] -- 0:00:16
763500 -- [-1243.574] (-1241.236) (-1241.123) (-1243.293) * [-1242.842] (-1243.308) (-1241.966) (-1241.530) -- 0:00:16
764000 -- (-1240.821) [-1240.283] (-1242.088) (-1242.349) * (-1242.412) (-1240.569) [-1241.999] (-1244.815) -- 0:00:16
764500 -- (-1243.658) [-1243.051] (-1243.480) (-1240.467) * (-1242.278) (-1242.895) [-1242.234] (-1246.286) -- 0:00:16
765000 -- (-1242.940) [-1245.134] (-1241.893) (-1242.719) * (-1243.024) [-1242.362] (-1243.001) (-1243.493) -- 0:00:15
Average standard deviation of split frequencies: 0.008195
765500 -- [-1241.427] (-1242.238) (-1241.809) (-1241.446) * (-1241.388) (-1240.848) [-1244.136] (-1241.057) -- 0:00:15
766000 -- (-1243.228) (-1242.893) (-1240.537) [-1241.903] * [-1241.584] (-1240.158) (-1243.107) (-1241.241) -- 0:00:15
766500 -- (-1242.186) [-1242.504] (-1242.075) (-1243.493) * (-1244.688) (-1242.084) (-1246.077) [-1245.530] -- 0:00:15
767000 -- [-1245.855] (-1242.883) (-1241.553) (-1241.934) * [-1242.063] (-1241.600) (-1246.054) (-1242.116) -- 0:00:15
767500 -- (-1246.337) (-1243.132) [-1242.861] (-1241.953) * (-1243.088) (-1241.190) (-1244.375) [-1241.128] -- 0:00:15
768000 -- [-1246.580] (-1244.008) (-1241.917) (-1249.271) * (-1242.927) (-1242.832) [-1243.517] (-1241.650) -- 0:00:15
768500 -- [-1241.816] (-1238.999) (-1240.275) (-1244.549) * (-1242.318) (-1240.724) [-1240.919] (-1240.809) -- 0:00:15
769000 -- [-1240.776] (-1242.098) (-1242.395) (-1242.123) * (-1242.500) (-1249.149) [-1241.367] (-1242.176) -- 0:00:15
769500 -- (-1242.168) (-1242.924) [-1240.480] (-1242.515) * [-1240.838] (-1241.147) (-1241.082) (-1242.583) -- 0:00:15
770000 -- (-1245.221) (-1244.904) [-1239.455] (-1242.273) * (-1242.348) (-1241.738) (-1242.494) [-1240.948] -- 0:00:15
Average standard deviation of split frequencies: 0.008242
770500 -- (-1244.057) (-1244.910) [-1241.688] (-1242.453) * (-1241.718) (-1244.327) [-1240.902] (-1240.486) -- 0:00:15
771000 -- (-1242.379) (-1242.549) [-1242.400] (-1243.565) * (-1242.038) (-1244.315) [-1242.524] (-1242.776) -- 0:00:15
771500 -- (-1242.798) [-1243.352] (-1241.834) (-1240.415) * (-1243.270) (-1242.585) [-1241.775] (-1245.664) -- 0:00:15
772000 -- (-1244.967) (-1242.832) (-1242.261) [-1237.289] * (-1242.164) (-1241.204) [-1243.568] (-1242.645) -- 0:00:15
772500 -- (-1246.138) (-1242.922) (-1243.156) [-1240.604] * (-1241.269) [-1242.368] (-1247.292) (-1242.548) -- 0:00:15
773000 -- (-1244.238) (-1243.861) (-1242.399) [-1241.478] * (-1241.982) [-1242.698] (-1246.467) (-1241.833) -- 0:00:15
773500 -- (-1242.125) (-1241.841) (-1242.711) [-1244.000] * (-1242.769) (-1244.594) [-1242.892] (-1242.862) -- 0:00:15
774000 -- (-1243.532) [-1240.657] (-1242.692) (-1242.010) * (-1244.154) (-1241.167) (-1243.877) [-1240.720] -- 0:00:15
774500 -- [-1244.232] (-1240.740) (-1241.738) (-1244.524) * [-1241.681] (-1244.922) (-1243.933) (-1242.937) -- 0:00:15
775000 -- (-1241.331) (-1241.528) [-1242.023] (-1243.636) * (-1243.566) (-1247.371) [-1240.853] (-1240.869) -- 0:00:15
Average standard deviation of split frequencies: 0.008153
775500 -- (-1243.365) (-1243.863) [-1243.052] (-1243.637) * (-1242.635) (-1241.604) (-1242.465) [-1243.592] -- 0:00:15
776000 -- (-1242.750) [-1241.248] (-1240.679) (-1243.993) * (-1242.330) (-1241.171) (-1243.241) [-1241.274] -- 0:00:15
776500 -- (-1243.566) [-1240.801] (-1245.649) (-1242.750) * (-1241.292) (-1240.887) [-1245.176] (-1245.381) -- 0:00:15
777000 -- (-1244.656) (-1245.766) [-1240.903] (-1241.734) * (-1242.404) (-1243.150) (-1243.748) [-1240.384] -- 0:00:15
777500 -- (-1243.685) (-1241.441) [-1241.504] (-1241.387) * (-1241.774) (-1243.731) (-1240.862) [-1242.344] -- 0:00:15
778000 -- [-1243.715] (-1243.780) (-1242.915) (-1240.441) * [-1241.211] (-1242.328) (-1243.838) (-1242.554) -- 0:00:15
778500 -- (-1242.191) [-1241.906] (-1242.238) (-1242.728) * (-1242.025) (-1242.136) [-1242.038] (-1244.070) -- 0:00:15
779000 -- (-1241.399) (-1242.651) [-1241.228] (-1249.236) * (-1244.683) (-1242.380) (-1242.920) [-1241.360] -- 0:00:15
779500 -- [-1244.495] (-1244.549) (-1240.874) (-1241.594) * (-1244.202) (-1243.911) (-1242.573) [-1242.475] -- 0:00:14
780000 -- (-1241.856) [-1240.729] (-1241.101) (-1242.497) * (-1242.732) (-1242.174) [-1239.294] (-1244.233) -- 0:00:14
Average standard deviation of split frequencies: 0.008327
780500 -- (-1245.831) [-1243.609] (-1241.290) (-1241.978) * [-1244.007] (-1244.717) (-1243.427) (-1246.250) -- 0:00:14
781000 -- (-1241.256) [-1241.447] (-1242.617) (-1241.453) * (-1243.058) (-1241.677) (-1244.629) [-1242.822] -- 0:00:14
781500 -- [-1242.255] (-1241.724) (-1241.436) (-1242.713) * [-1242.933] (-1242.053) (-1244.742) (-1245.288) -- 0:00:14
782000 -- (-1242.865) [-1242.249] (-1247.001) (-1244.300) * [-1240.907] (-1240.592) (-1242.724) (-1241.452) -- 0:00:14
782500 -- [-1241.327] (-1242.947) (-1241.932) (-1241.903) * (-1246.859) [-1243.168] (-1244.375) (-1241.621) -- 0:00:14
783000 -- (-1246.820) (-1241.686) [-1243.516] (-1243.925) * (-1244.669) (-1252.663) [-1241.361] (-1245.251) -- 0:00:14
783500 -- [-1241.709] (-1243.277) (-1244.391) (-1247.280) * (-1247.006) (-1241.542) [-1241.952] (-1242.468) -- 0:00:14
784000 -- (-1244.368) (-1243.399) [-1241.992] (-1241.813) * [-1243.341] (-1240.749) (-1244.912) (-1241.747) -- 0:00:14
784500 -- (-1243.475) (-1242.828) (-1242.398) [-1241.211] * (-1246.305) (-1240.825) (-1246.544) [-1242.586] -- 0:00:14
785000 -- [-1244.008] (-1243.450) (-1240.812) (-1243.159) * (-1241.489) (-1241.791) [-1239.709] (-1242.982) -- 0:00:14
Average standard deviation of split frequencies: 0.008649
785500 -- (-1243.250) (-1247.765) (-1242.113) [-1243.582] * (-1242.830) (-1243.486) [-1238.689] (-1245.155) -- 0:00:14
786000 -- (-1244.709) [-1241.549] (-1240.359) (-1244.332) * (-1245.443) (-1243.998) [-1239.582] (-1240.899) -- 0:00:14
786500 -- (-1241.346) (-1241.313) [-1243.633] (-1242.317) * [-1240.894] (-1248.744) (-1242.013) (-1243.228) -- 0:00:14
787000 -- (-1241.679) (-1242.620) (-1243.268) [-1246.013] * (-1243.237) (-1247.850) [-1241.208] (-1245.935) -- 0:00:14
787500 -- [-1239.306] (-1241.786) (-1242.351) (-1241.271) * (-1241.985) (-1245.979) [-1239.295] (-1245.344) -- 0:00:14
788000 -- (-1241.103) [-1242.929] (-1242.329) (-1241.562) * (-1242.576) (-1243.903) [-1242.170] (-1243.105) -- 0:00:14
788500 -- (-1243.531) (-1240.888) [-1242.428] (-1242.179) * (-1243.192) [-1242.220] (-1242.366) (-1248.036) -- 0:00:14
789000 -- (-1243.135) (-1242.898) [-1240.881] (-1242.806) * (-1243.192) (-1243.356) [-1243.966] (-1243.478) -- 0:00:14
789500 -- (-1242.711) (-1242.193) (-1241.454) [-1241.644] * (-1242.994) (-1245.785) (-1243.396) [-1243.814] -- 0:00:14
790000 -- (-1242.789) (-1244.437) [-1242.828] (-1243.295) * (-1243.199) (-1240.137) [-1241.867] (-1241.898) -- 0:00:14
Average standard deviation of split frequencies: 0.008316
790500 -- (-1243.751) (-1239.801) [-1241.801] (-1242.494) * (-1243.931) [-1241.647] (-1249.325) (-1242.013) -- 0:00:14
791000 -- (-1240.328) (-1241.503) (-1243.582) [-1244.754] * (-1243.512) [-1242.100] (-1244.485) (-1242.152) -- 0:00:14
791500 -- (-1248.963) (-1243.460) (-1244.101) [-1241.997] * (-1242.851) [-1244.370] (-1243.133) (-1242.260) -- 0:00:14
792000 -- (-1242.614) (-1242.180) (-1243.767) [-1241.086] * (-1242.249) (-1243.187) (-1243.986) [-1243.603] -- 0:00:14
792500 -- (-1243.325) [-1241.108] (-1244.205) (-1242.079) * (-1242.021) (-1243.487) [-1244.478] (-1242.800) -- 0:00:14
793000 -- (-1245.308) (-1241.278) (-1245.284) [-1240.489] * [-1240.621] (-1242.181) (-1243.614) (-1241.970) -- 0:00:14
793500 -- [-1241.407] (-1247.298) (-1242.136) (-1243.429) * (-1243.043) [-1244.021] (-1243.588) (-1241.901) -- 0:00:14
794000 -- (-1244.900) (-1243.428) (-1241.797) [-1242.568] * (-1241.781) (-1243.660) [-1240.751] (-1242.288) -- 0:00:14
794500 -- (-1243.581) (-1243.582) (-1241.876) [-1240.785] * (-1242.472) (-1241.984) [-1241.625] (-1242.529) -- 0:00:13
795000 -- (-1245.163) (-1241.266) [-1241.197] (-1243.999) * [-1243.961] (-1244.251) (-1242.248) (-1241.653) -- 0:00:13
Average standard deviation of split frequencies: 0.008572
795500 -- (-1242.232) (-1240.000) (-1241.380) [-1241.391] * [-1241.253] (-1241.610) (-1242.362) (-1241.364) -- 0:00:13
796000 -- [-1243.940] (-1241.691) (-1241.317) (-1243.361) * (-1241.123) (-1242.456) [-1242.617] (-1247.783) -- 0:00:13
796500 -- (-1241.455) (-1242.048) [-1242.799] (-1241.204) * (-1241.158) (-1242.195) [-1241.247] (-1247.729) -- 0:00:13
797000 -- (-1241.903) [-1238.824] (-1242.888) (-1244.217) * (-1240.558) (-1241.346) [-1240.333] (-1242.176) -- 0:00:13
797500 -- (-1242.594) (-1241.088) (-1243.044) [-1241.635] * (-1240.658) (-1244.017) (-1244.288) [-1241.771] -- 0:00:13
798000 -- (-1241.924) [-1241.190] (-1242.618) (-1239.639) * (-1241.917) [-1242.441] (-1243.280) (-1242.124) -- 0:00:13
798500 -- (-1240.606) (-1242.720) [-1244.986] (-1241.368) * (-1240.734) (-1241.969) (-1242.051) [-1241.898] -- 0:00:13
799000 -- [-1239.882] (-1241.063) (-1244.979) (-1242.602) * (-1242.141) [-1243.381] (-1242.235) (-1243.408) -- 0:00:13
799500 -- (-1243.813) (-1240.647) (-1244.584) [-1243.271] * (-1241.000) [-1242.626] (-1242.278) (-1244.670) -- 0:00:13
800000 -- (-1240.898) (-1241.507) (-1242.920) [-1241.895] * (-1241.770) (-1240.102) [-1246.639] (-1243.724) -- 0:00:13
Average standard deviation of split frequencies: 0.008646
800500 -- (-1241.409) (-1245.209) (-1245.235) [-1240.716] * (-1241.963) [-1237.828] (-1244.001) (-1246.954) -- 0:00:13
801000 -- (-1242.829) (-1247.459) [-1243.637] (-1242.826) * [-1240.905] (-1241.763) (-1242.099) (-1247.103) -- 0:00:13
801500 -- (-1240.244) [-1247.067] (-1245.758) (-1241.926) * (-1240.892) [-1241.757] (-1241.841) (-1242.005) -- 0:00:13
802000 -- (-1240.487) [-1244.121] (-1245.303) (-1243.877) * [-1240.604] (-1242.793) (-1243.183) (-1241.063) -- 0:00:13
802500 -- (-1244.702) (-1241.621) [-1245.637] (-1242.760) * (-1244.542) [-1240.808] (-1242.021) (-1241.138) -- 0:00:13
803000 -- [-1242.754] (-1242.208) (-1245.567) (-1241.018) * (-1241.929) (-1239.794) (-1241.948) [-1240.641] -- 0:00:13
803500 -- (-1241.809) [-1242.873] (-1242.014) (-1241.185) * [-1244.545] (-1244.062) (-1241.013) (-1240.755) -- 0:00:13
804000 -- [-1241.641] (-1244.354) (-1246.683) (-1240.349) * (-1246.558) (-1242.746) (-1241.965) [-1240.844] -- 0:00:13
804500 -- (-1241.264) [-1244.146] (-1242.468) (-1240.128) * (-1242.797) (-1242.355) (-1241.199) [-1240.748] -- 0:00:13
805000 -- (-1238.470) (-1241.678) (-1241.421) [-1240.753] * [-1241.647] (-1240.104) (-1242.911) (-1240.477) -- 0:00:13
Average standard deviation of split frequencies: 0.008804
805500 -- (-1246.601) (-1244.211) [-1241.510] (-1242.115) * (-1242.060) (-1242.787) (-1245.558) [-1241.304] -- 0:00:13
806000 -- [-1242.718] (-1241.930) (-1241.442) (-1242.263) * (-1240.515) (-1242.961) (-1240.549) [-1242.318] -- 0:00:13
806500 -- [-1243.135] (-1239.990) (-1243.385) (-1243.170) * (-1240.310) (-1250.977) (-1239.097) [-1239.819] -- 0:00:13
807000 -- (-1240.820) (-1239.257) (-1243.622) [-1242.690] * [-1242.903] (-1240.878) (-1242.334) (-1243.534) -- 0:00:13
807500 -- (-1240.669) [-1243.706] (-1241.411) (-1241.109) * (-1245.334) [-1240.399] (-1245.409) (-1241.771) -- 0:00:13
808000 -- [-1241.037] (-1241.225) (-1243.535) (-1240.785) * (-1242.911) (-1241.589) [-1242.738] (-1240.162) -- 0:00:13
808500 -- (-1242.691) (-1241.662) (-1242.213) [-1240.950] * (-1243.453) (-1244.085) (-1242.620) [-1240.944] -- 0:00:13
809000 -- (-1242.344) [-1242.400] (-1241.984) (-1243.894) * (-1244.610) (-1244.078) (-1243.315) [-1239.310] -- 0:00:12
809500 -- (-1242.592) [-1245.668] (-1241.990) (-1243.513) * (-1247.015) [-1242.497] (-1244.339) (-1241.532) -- 0:00:12
810000 -- [-1240.742] (-1241.371) (-1242.089) (-1242.577) * (-1249.080) (-1239.983) [-1241.248] (-1241.767) -- 0:00:12
Average standard deviation of split frequencies: 0.008723
810500 -- (-1242.185) (-1241.845) (-1242.155) [-1243.560] * (-1242.180) [-1244.242] (-1244.875) (-1243.791) -- 0:00:12
811000 -- [-1240.542] (-1241.131) (-1241.748) (-1244.432) * (-1242.041) (-1242.971) [-1242.061] (-1242.313) -- 0:00:12
811500 -- [-1241.459] (-1241.415) (-1242.654) (-1246.630) * (-1242.965) (-1243.223) [-1242.364] (-1242.929) -- 0:00:12
812000 -- (-1244.648) (-1242.905) (-1242.191) [-1243.020] * (-1239.755) [-1242.290] (-1242.139) (-1242.666) -- 0:00:12
812500 -- (-1241.300) [-1240.519] (-1240.206) (-1242.502) * (-1239.884) [-1240.442] (-1240.662) (-1239.361) -- 0:00:12
813000 -- (-1243.238) (-1240.975) (-1242.866) [-1241.555] * (-1242.852) (-1243.894) [-1241.129] (-1241.488) -- 0:00:12
813500 -- (-1242.099) (-1246.401) (-1244.257) [-1243.503] * [-1242.602] (-1244.424) (-1241.223) (-1241.927) -- 0:00:12
814000 -- [-1242.295] (-1244.198) (-1242.305) (-1242.940) * (-1240.367) (-1243.164) [-1241.121] (-1242.884) -- 0:00:12
814500 -- (-1243.616) (-1239.846) (-1242.826) [-1244.888] * (-1250.120) (-1243.081) (-1241.619) [-1245.134] -- 0:00:12
815000 -- (-1243.337) [-1243.795] (-1242.157) (-1241.927) * (-1243.508) (-1241.656) (-1241.502) [-1248.863] -- 0:00:12
Average standard deviation of split frequencies: 0.008483
815500 -- (-1241.781) [-1245.049] (-1243.252) (-1244.258) * [-1241.786] (-1242.510) (-1242.661) (-1240.339) -- 0:00:12
816000 -- [-1240.394] (-1242.193) (-1241.952) (-1240.741) * (-1243.532) (-1243.670) (-1240.935) [-1239.892] -- 0:00:12
816500 -- (-1241.104) (-1240.806) [-1242.892] (-1245.106) * [-1242.309] (-1244.958) (-1242.965) (-1245.950) -- 0:00:12
817000 -- [-1241.086] (-1245.602) (-1241.045) (-1243.222) * (-1242.595) (-1238.476) [-1244.791] (-1242.551) -- 0:00:12
817500 -- (-1242.214) (-1246.710) [-1242.807] (-1244.177) * (-1243.111) (-1242.400) [-1242.806] (-1240.488) -- 0:00:12
818000 -- (-1242.214) (-1242.943) [-1243.160] (-1243.172) * [-1243.814] (-1241.333) (-1243.699) (-1240.312) -- 0:00:12
818500 -- (-1243.039) (-1241.892) (-1244.163) [-1242.537] * (-1241.169) [-1242.130] (-1242.705) (-1240.963) -- 0:00:12
819000 -- (-1242.463) (-1241.343) [-1243.835] (-1245.442) * (-1240.284) (-1248.325) (-1246.373) [-1241.480] -- 0:00:12
819500 -- (-1243.252) (-1243.167) (-1243.028) [-1243.874] * (-1241.156) (-1247.519) (-1243.065) [-1242.641] -- 0:00:12
820000 -- (-1242.858) (-1241.847) [-1243.246] (-1244.683) * [-1242.334] (-1243.480) (-1245.651) (-1241.456) -- 0:00:12
Average standard deviation of split frequencies: 0.008314
820500 -- [-1243.354] (-1240.775) (-1243.164) (-1242.770) * (-1241.180) (-1241.432) (-1243.299) [-1241.238] -- 0:00:12
821000 -- (-1244.445) (-1241.183) (-1243.645) [-1240.825] * [-1240.810] (-1240.040) (-1240.165) (-1241.724) -- 0:00:12
821500 -- (-1241.678) (-1241.168) (-1243.266) [-1239.725] * (-1240.600) [-1241.090] (-1242.784) (-1241.620) -- 0:00:12
822000 -- (-1241.544) [-1241.133] (-1240.417) (-1241.419) * (-1245.600) (-1241.819) [-1242.066] (-1244.904) -- 0:00:12
822500 -- (-1242.046) (-1242.411) (-1242.928) [-1239.136] * [-1242.064] (-1243.761) (-1242.102) (-1242.131) -- 0:00:12
823000 -- (-1241.795) (-1243.484) [-1243.360] (-1241.008) * (-1241.070) [-1247.748] (-1241.677) (-1242.659) -- 0:00:12
823500 -- (-1241.371) [-1243.416] (-1240.679) (-1240.340) * (-1242.028) [-1245.738] (-1241.210) (-1243.127) -- 0:00:12
824000 -- (-1242.221) (-1250.076) (-1241.430) [-1241.577] * (-1242.542) (-1241.530) (-1243.568) [-1243.008] -- 0:00:11
824500 -- (-1241.611) (-1244.631) (-1241.129) [-1243.494] * (-1241.318) (-1242.810) [-1241.540] (-1243.747) -- 0:00:11
825000 -- (-1242.052) (-1241.266) (-1243.335) [-1242.170] * [-1242.946] (-1241.294) (-1241.792) (-1243.495) -- 0:00:11
Average standard deviation of split frequencies: 0.008320
825500 -- (-1244.873) (-1241.667) [-1242.581] (-1241.619) * (-1246.021) (-1242.726) (-1240.981) [-1240.604] -- 0:00:11
826000 -- (-1241.649) [-1241.891] (-1242.704) (-1239.885) * [-1242.662] (-1243.839) (-1242.862) (-1242.098) -- 0:00:11
826500 -- (-1241.460) (-1244.669) [-1241.609] (-1241.188) * [-1244.965] (-1244.752) (-1241.366) (-1242.051) -- 0:00:11
827000 -- [-1241.936] (-1243.891) (-1240.237) (-1242.649) * (-1243.695) (-1244.367) [-1241.299] (-1243.919) -- 0:00:11
827500 -- (-1243.165) [-1240.960] (-1241.248) (-1243.415) * (-1242.430) [-1243.856] (-1240.975) (-1240.370) -- 0:00:11
828000 -- (-1244.065) (-1243.886) (-1242.439) [-1241.305] * [-1242.137] (-1241.747) (-1241.502) (-1242.864) -- 0:00:11
828500 -- [-1242.101] (-1245.159) (-1241.998) (-1243.866) * (-1241.829) [-1243.199] (-1243.457) (-1241.960) -- 0:00:11
829000 -- (-1243.179) [-1246.863] (-1243.549) (-1240.738) * (-1243.529) (-1241.714) [-1241.233] (-1242.962) -- 0:00:11
829500 -- (-1248.172) (-1241.022) (-1242.358) [-1241.176] * (-1244.161) (-1241.204) (-1243.380) [-1243.883] -- 0:00:11
830000 -- (-1242.968) (-1242.238) (-1243.337) [-1242.054] * (-1251.736) [-1241.519] (-1242.256) (-1243.293) -- 0:00:11
Average standard deviation of split frequencies: 0.008542
830500 -- (-1243.325) (-1243.159) [-1241.075] (-1242.425) * (-1246.277) (-1241.731) [-1239.239] (-1242.107) -- 0:00:11
831000 -- [-1243.314] (-1244.456) (-1241.695) (-1241.796) * (-1242.511) (-1241.585) (-1245.795) [-1241.880] -- 0:00:11
831500 -- (-1245.404) (-1243.995) [-1244.404] (-1244.861) * (-1243.564) (-1242.733) [-1240.288] (-1246.470) -- 0:00:11
832000 -- (-1242.134) [-1246.417] (-1243.226) (-1240.762) * (-1241.213) (-1244.719) [-1240.894] (-1246.010) -- 0:00:11
832500 -- (-1247.011) [-1240.352] (-1244.789) (-1245.309) * (-1241.657) [-1243.264] (-1241.598) (-1241.904) -- 0:00:11
833000 -- [-1241.772] (-1241.183) (-1241.979) (-1245.554) * [-1240.173] (-1243.451) (-1240.893) (-1242.749) -- 0:00:11
833500 -- (-1244.079) (-1240.673) [-1243.242] (-1242.017) * [-1241.572] (-1243.039) (-1241.054) (-1245.356) -- 0:00:11
834000 -- (-1241.139) (-1244.383) (-1242.432) [-1242.081] * (-1241.870) (-1243.879) [-1246.337] (-1241.437) -- 0:00:11
834500 -- (-1243.146) (-1240.121) (-1241.848) [-1242.115] * (-1242.241) (-1246.476) [-1245.541] (-1242.114) -- 0:00:11
835000 -- (-1241.859) (-1242.267) (-1242.214) [-1242.214] * (-1243.772) (-1241.981) [-1241.137] (-1241.556) -- 0:00:11
Average standard deviation of split frequencies: 0.008399
835500 -- [-1240.574] (-1241.663) (-1242.284) (-1239.622) * (-1240.949) [-1241.918] (-1244.201) (-1241.024) -- 0:00:11
836000 -- [-1241.426] (-1241.719) (-1241.424) (-1242.786) * (-1242.837) (-1241.680) [-1242.590] (-1242.609) -- 0:00:11
836500 -- (-1244.346) (-1242.028) [-1240.170] (-1242.473) * (-1245.374) (-1244.080) (-1243.797) [-1242.917] -- 0:00:11
837000 -- (-1246.066) [-1241.652] (-1243.615) (-1244.699) * [-1240.418] (-1242.437) (-1242.115) (-1244.094) -- 0:00:11
837500 -- [-1239.992] (-1241.326) (-1244.181) (-1242.076) * [-1239.505] (-1241.331) (-1240.305) (-1242.910) -- 0:00:11
838000 -- (-1241.711) (-1242.067) (-1242.553) [-1242.613] * (-1244.667) [-1242.640] (-1241.271) (-1243.891) -- 0:00:11
838500 -- (-1241.547) [-1242.198] (-1244.049) (-1244.348) * (-1244.858) [-1241.878] (-1248.665) (-1242.990) -- 0:00:10
839000 -- [-1239.032] (-1242.872) (-1241.100) (-1243.225) * (-1241.257) [-1242.252] (-1241.738) (-1241.245) -- 0:00:10
839500 -- (-1244.618) (-1244.749) [-1242.365] (-1241.827) * [-1243.366] (-1245.038) (-1240.917) (-1241.307) -- 0:00:10
840000 -- [-1239.866] (-1241.204) (-1242.397) (-1239.477) * (-1240.491) (-1242.074) (-1242.548) [-1241.552] -- 0:00:10
Average standard deviation of split frequencies: 0.008441
840500 -- (-1241.519) [-1241.178] (-1241.815) (-1240.720) * (-1244.270) (-1245.769) (-1241.501) [-1241.774] -- 0:00:10
841000 -- (-1241.790) [-1241.914] (-1241.665) (-1247.172) * (-1241.958) (-1241.658) (-1242.424) [-1242.782] -- 0:00:10
841500 -- (-1243.318) (-1244.233) [-1242.001] (-1246.739) * (-1241.297) [-1241.506] (-1241.320) (-1241.976) -- 0:00:10
842000 -- (-1243.808) (-1242.266) (-1239.778) [-1242.382] * (-1244.297) (-1243.761) [-1244.634] (-1242.596) -- 0:00:10
842500 -- (-1245.787) (-1244.076) (-1240.839) [-1242.459] * (-1243.995) (-1241.595) [-1246.156] (-1246.029) -- 0:00:10
843000 -- (-1243.380) (-1243.059) (-1242.899) [-1241.503] * (-1241.203) (-1242.970) [-1243.526] (-1239.657) -- 0:00:10
843500 -- (-1252.044) [-1240.922] (-1241.426) (-1243.261) * (-1244.154) (-1246.481) (-1242.892) [-1242.049] -- 0:00:10
844000 -- [-1246.521] (-1243.532) (-1242.879) (-1242.319) * (-1245.199) (-1246.284) [-1241.065] (-1242.411) -- 0:00:10
844500 -- [-1242.902] (-1240.155) (-1241.655) (-1247.366) * (-1244.541) (-1249.045) [-1240.976] (-1242.496) -- 0:00:10
845000 -- [-1242.297] (-1242.367) (-1242.096) (-1244.424) * (-1240.663) [-1246.090] (-1242.361) (-1244.165) -- 0:00:10
Average standard deviation of split frequencies: 0.008241
845500 -- [-1241.810] (-1243.261) (-1247.356) (-1241.904) * (-1240.579) (-1245.052) (-1243.895) [-1241.916] -- 0:00:10
846000 -- [-1240.355] (-1242.489) (-1242.130) (-1242.752) * (-1243.026) (-1240.253) [-1239.656] (-1240.868) -- 0:00:10
846500 -- [-1242.724] (-1245.864) (-1243.680) (-1241.147) * (-1244.706) (-1242.315) [-1241.982] (-1243.170) -- 0:00:10
847000 -- [-1242.385] (-1245.499) (-1243.845) (-1241.307) * (-1242.769) (-1243.623) (-1241.489) [-1242.102] -- 0:00:10
847500 -- (-1243.504) (-1242.532) [-1243.691] (-1242.868) * [-1241.268] (-1241.541) (-1242.917) (-1244.638) -- 0:00:10
848000 -- (-1243.488) (-1240.857) [-1242.275] (-1242.651) * (-1242.802) (-1242.707) [-1241.225] (-1241.769) -- 0:00:10
848500 -- [-1240.261] (-1243.771) (-1243.098) (-1242.763) * [-1243.853] (-1242.875) (-1241.582) (-1243.184) -- 0:00:10
849000 -- (-1243.373) (-1241.154) [-1244.767] (-1242.987) * [-1245.414] (-1243.658) (-1243.563) (-1241.709) -- 0:00:10
849500 -- (-1238.740) (-1240.318) (-1242.406) [-1241.361] * [-1243.690] (-1241.501) (-1242.971) (-1242.358) -- 0:00:10
850000 -- [-1240.132] (-1243.376) (-1241.665) (-1246.353) * (-1243.343) [-1242.350] (-1243.545) (-1245.294) -- 0:00:10
Average standard deviation of split frequencies: 0.008429
850500 -- [-1243.274] (-1242.200) (-1243.331) (-1241.777) * [-1243.358] (-1240.504) (-1243.403) (-1244.004) -- 0:00:10
851000 -- (-1239.562) [-1242.850] (-1242.642) (-1245.028) * [-1242.972] (-1242.556) (-1241.125) (-1241.442) -- 0:00:10
851500 -- [-1238.584] (-1241.997) (-1243.127) (-1248.562) * [-1242.227] (-1243.313) (-1243.533) (-1243.020) -- 0:00:10
852000 -- (-1241.677) [-1242.142] (-1242.661) (-1247.367) * [-1241.869] (-1242.149) (-1243.585) (-1247.139) -- 0:00:10
852500 -- [-1241.369] (-1246.807) (-1244.138) (-1242.766) * [-1241.250] (-1243.257) (-1243.600) (-1245.323) -- 0:00:10
853000 -- (-1241.280) (-1245.348) [-1241.525] (-1241.757) * [-1246.433] (-1242.787) (-1242.057) (-1246.492) -- 0:00:09
853500 -- (-1242.170) (-1244.739) (-1242.641) [-1242.403] * (-1243.001) (-1243.763) (-1240.461) [-1241.309] -- 0:00:09
854000 -- [-1240.806] (-1242.344) (-1243.756) (-1243.386) * (-1242.694) (-1242.282) (-1243.872) [-1241.906] -- 0:00:09
854500 -- [-1240.522] (-1245.756) (-1244.663) (-1242.005) * (-1240.962) [-1241.901] (-1241.823) (-1243.219) -- 0:00:09
855000 -- (-1245.023) (-1242.785) (-1242.927) [-1242.110] * (-1240.115) (-1241.188) [-1241.822] (-1243.343) -- 0:00:09
Average standard deviation of split frequencies: 0.008492
855500 -- (-1241.026) [-1242.541] (-1248.823) (-1244.900) * (-1241.312) (-1240.330) (-1241.733) [-1242.051] -- 0:00:09
856000 -- (-1240.195) (-1241.916) (-1243.353) [-1244.447] * (-1241.849) [-1241.064] (-1241.227) (-1240.800) -- 0:00:09
856500 -- (-1241.277) [-1246.498] (-1241.770) (-1244.527) * (-1242.081) [-1241.984] (-1241.337) (-1244.209) -- 0:00:09
857000 -- (-1242.049) (-1240.274) (-1242.524) [-1240.464] * (-1240.787) [-1237.537] (-1241.156) (-1241.446) -- 0:00:09
857500 -- (-1245.658) [-1241.903] (-1241.108) (-1243.396) * (-1243.551) [-1241.164] (-1246.042) (-1244.273) -- 0:00:09
858000 -- (-1244.863) [-1242.888] (-1244.155) (-1244.139) * (-1246.548) (-1240.337) (-1242.346) [-1241.517] -- 0:00:09
858500 -- (-1244.040) (-1242.832) (-1243.445) [-1244.048] * (-1243.057) (-1243.640) [-1244.289] (-1243.524) -- 0:00:09
859000 -- (-1241.805) (-1242.014) [-1240.539] (-1243.129) * [-1242.379] (-1240.215) (-1241.517) (-1243.883) -- 0:00:09
859500 -- (-1241.162) (-1240.854) (-1241.704) [-1242.633] * (-1240.196) (-1242.817) (-1238.930) [-1243.794] -- 0:00:09
860000 -- (-1241.918) [-1240.663] (-1241.934) (-1239.931) * (-1241.219) (-1242.497) (-1241.031) [-1243.566] -- 0:00:09
Average standard deviation of split frequencies: 0.008273
860500 -- (-1245.805) [-1242.430] (-1242.119) (-1242.553) * (-1241.109) (-1243.072) [-1241.996] (-1244.993) -- 0:00:09
861000 -- (-1245.719) (-1240.651) (-1242.721) [-1243.069] * (-1246.838) (-1242.083) (-1241.042) [-1241.575] -- 0:00:09
861500 -- (-1242.486) (-1240.968) (-1241.434) [-1243.414] * [-1239.581] (-1241.015) (-1243.549) (-1244.578) -- 0:00:09
862000 -- (-1240.220) (-1240.732) (-1243.546) [-1242.586] * [-1238.535] (-1242.171) (-1246.772) (-1243.119) -- 0:00:09
862500 -- (-1241.789) [-1242.669] (-1241.952) (-1242.478) * (-1242.886) (-1246.546) [-1239.811] (-1241.567) -- 0:00:09
863000 -- (-1241.936) (-1241.914) [-1241.466] (-1245.842) * (-1242.318) [-1243.594] (-1242.104) (-1243.334) -- 0:00:09
863500 -- (-1241.636) [-1241.964] (-1241.420) (-1243.828) * (-1242.353) (-1244.129) [-1241.118] (-1242.589) -- 0:00:09
864000 -- (-1243.154) (-1241.032) [-1241.512] (-1242.324) * [-1244.595] (-1243.177) (-1243.066) (-1241.639) -- 0:00:09
864500 -- (-1241.297) (-1243.233) [-1241.312] (-1241.566) * (-1241.490) (-1241.017) [-1239.575] (-1242.282) -- 0:00:09
865000 -- [-1241.032] (-1246.230) (-1241.938) (-1245.211) * (-1244.198) (-1242.325) (-1240.871) [-1243.756] -- 0:00:09
Average standard deviation of split frequencies: 0.008251
865500 -- (-1240.923) (-1240.800) (-1243.493) [-1244.050] * (-1240.984) [-1244.664] (-1240.910) (-1241.271) -- 0:00:09
866000 -- [-1243.391] (-1242.616) (-1244.394) (-1241.340) * (-1241.469) (-1242.711) [-1246.657] (-1244.533) -- 0:00:09
866500 -- (-1243.369) (-1242.031) (-1244.389) [-1242.708] * (-1243.828) (-1244.622) (-1245.465) [-1241.428] -- 0:00:09
867000 -- (-1246.740) [-1241.940] (-1243.875) (-1244.985) * [-1241.941] (-1242.572) (-1242.910) (-1241.052) -- 0:00:09
867500 -- (-1243.413) [-1241.896] (-1242.011) (-1243.541) * (-1240.123) (-1240.873) [-1241.082] (-1243.144) -- 0:00:09
868000 -- (-1238.956) [-1241.289] (-1241.245) (-1245.668) * (-1243.230) (-1243.213) [-1245.524] (-1243.879) -- 0:00:08
868500 -- [-1239.941] (-1241.339) (-1243.301) (-1241.901) * [-1243.155] (-1241.769) (-1241.372) (-1242.737) -- 0:00:08
869000 -- (-1240.908) (-1241.467) (-1243.949) [-1240.500] * (-1242.780) (-1241.886) (-1241.770) [-1241.277] -- 0:00:08
869500 -- (-1242.780) (-1243.423) (-1243.523) [-1241.938] * (-1244.166) (-1242.621) [-1241.883] (-1242.505) -- 0:00:08
870000 -- [-1241.648] (-1240.964) (-1243.396) (-1241.393) * (-1243.178) [-1244.021] (-1242.978) (-1241.983) -- 0:00:08
Average standard deviation of split frequencies: 0.008378
870500 -- (-1240.240) (-1242.375) (-1242.537) [-1238.672] * (-1238.975) [-1243.730] (-1240.899) (-1241.633) -- 0:00:08
871000 -- (-1250.100) (-1241.610) [-1242.853] (-1243.363) * (-1244.265) [-1242.800] (-1241.226) (-1243.940) -- 0:00:08
871500 -- (-1242.680) (-1240.771) [-1246.770] (-1247.572) * (-1243.246) (-1241.477) (-1241.950) [-1241.239] -- 0:00:08
872000 -- (-1242.445) [-1240.594] (-1242.723) (-1242.304) * (-1241.976) (-1256.197) [-1242.844] (-1240.849) -- 0:00:08
872500 -- [-1241.026] (-1245.913) (-1244.970) (-1243.983) * (-1242.625) [-1244.098] (-1241.988) (-1242.292) -- 0:00:08
873000 -- (-1239.833) [-1240.188] (-1242.457) (-1242.935) * (-1241.193) [-1243.455] (-1242.734) (-1249.383) -- 0:00:08
873500 -- (-1241.206) (-1240.115) [-1242.797] (-1247.965) * (-1243.500) [-1246.379] (-1243.320) (-1244.066) -- 0:00:08
874000 -- (-1241.589) [-1240.744] (-1242.887) (-1242.628) * [-1240.948] (-1245.075) (-1245.190) (-1240.911) -- 0:00:08
874500 -- (-1238.515) (-1243.584) [-1241.478] (-1242.171) * [-1240.118] (-1244.167) (-1242.002) (-1242.405) -- 0:00:08
875000 -- (-1240.234) [-1243.104] (-1241.834) (-1241.211) * (-1248.849) (-1244.082) [-1240.144] (-1241.157) -- 0:00:08
Average standard deviation of split frequencies: 0.008299
875500 -- (-1241.449) (-1241.603) [-1242.956] (-1241.786) * (-1241.681) (-1241.255) (-1241.739) [-1242.443] -- 0:00:08
876000 -- (-1244.244) (-1242.154) (-1242.329) [-1241.914] * (-1241.372) (-1242.956) (-1241.952) [-1243.086] -- 0:00:08
876500 -- (-1243.827) [-1242.250] (-1242.207) (-1242.426) * (-1243.579) (-1240.219) [-1241.731] (-1244.946) -- 0:00:08
877000 -- (-1241.940) [-1241.601] (-1242.769) (-1243.048) * (-1243.469) (-1242.402) [-1243.935] (-1244.309) -- 0:00:08
877500 -- (-1242.236) (-1243.860) [-1244.203] (-1244.257) * (-1243.088) [-1243.630] (-1242.663) (-1240.777) -- 0:00:08
878000 -- (-1243.122) [-1243.101] (-1245.414) (-1239.625) * (-1242.640) [-1243.514] (-1241.255) (-1246.239) -- 0:00:08
878500 -- [-1243.632] (-1242.436) (-1242.656) (-1242.356) * (-1246.570) (-1243.116) [-1244.854] (-1241.966) -- 0:00:08
879000 -- (-1243.103) (-1242.004) (-1240.924) [-1243.299] * (-1246.166) [-1241.730] (-1243.759) (-1242.779) -- 0:00:08
879500 -- [-1242.597] (-1242.664) (-1242.188) (-1241.892) * (-1242.175) [-1240.085] (-1241.917) (-1240.343) -- 0:00:08
880000 -- (-1244.856) [-1246.114] (-1238.903) (-1242.586) * (-1243.060) (-1243.672) [-1241.077] (-1241.136) -- 0:00:08
Average standard deviation of split frequencies: 0.007860
880500 -- (-1244.609) (-1241.660) (-1244.671) [-1238.676] * (-1241.436) [-1244.744] (-1241.870) (-1241.219) -- 0:00:08
881000 -- (-1241.868) (-1242.229) (-1249.015) [-1240.655] * (-1248.741) (-1245.337) [-1245.359] (-1244.107) -- 0:00:08
881500 -- [-1241.254] (-1245.022) (-1247.006) (-1242.646) * (-1241.524) (-1248.502) [-1244.932] (-1242.555) -- 0:00:08
882000 -- (-1242.367) (-1242.562) (-1241.278) [-1239.403] * (-1241.619) (-1243.700) [-1240.185] (-1244.219) -- 0:00:08
882500 -- (-1242.343) (-1242.835) (-1243.026) [-1241.618] * (-1241.716) (-1241.294) [-1244.782] (-1246.761) -- 0:00:07
883000 -- (-1242.005) (-1242.768) (-1246.424) [-1242.455] * (-1242.990) [-1241.746] (-1241.571) (-1244.638) -- 0:00:07
883500 -- (-1242.124) [-1248.300] (-1247.458) (-1241.773) * [-1241.781] (-1241.733) (-1246.175) (-1242.559) -- 0:00:07
884000 -- (-1241.325) (-1243.523) (-1241.554) [-1241.471] * (-1244.340) [-1240.868] (-1243.531) (-1242.186) -- 0:00:07
884500 -- (-1241.688) (-1243.223) [-1240.728] (-1246.050) * [-1240.410] (-1242.356) (-1244.128) (-1242.930) -- 0:00:07
885000 -- (-1243.255) (-1240.377) [-1239.395] (-1243.719) * [-1243.162] (-1242.658) (-1240.356) (-1244.156) -- 0:00:07
Average standard deviation of split frequencies: 0.007477
885500 -- (-1241.715) (-1242.344) [-1241.786] (-1243.143) * (-1241.572) (-1239.456) (-1241.065) [-1242.726] -- 0:00:07
886000 -- (-1239.518) (-1241.812) [-1241.398] (-1239.663) * (-1243.992) [-1241.938] (-1242.016) (-1244.358) -- 0:00:07
886500 -- (-1245.414) (-1242.545) [-1242.025] (-1240.183) * (-1247.763) (-1242.061) (-1242.385) [-1242.366] -- 0:00:07
887000 -- [-1240.090] (-1246.108) (-1250.530) (-1239.076) * (-1241.336) (-1243.266) (-1241.379) [-1241.521] -- 0:00:07
887500 -- (-1245.551) (-1237.488) [-1244.586] (-1239.865) * (-1243.638) (-1242.179) (-1241.694) [-1241.523] -- 0:00:07
888000 -- (-1246.369) (-1246.857) (-1243.872) [-1240.557] * [-1241.914] (-1240.389) (-1243.065) (-1243.221) -- 0:00:07
888500 -- (-1248.511) (-1240.703) [-1240.956] (-1242.328) * (-1242.138) (-1246.814) (-1243.755) [-1241.495] -- 0:00:07
889000 -- [-1246.430] (-1243.020) (-1243.522) (-1244.452) * (-1241.440) [-1242.195] (-1242.903) (-1240.753) -- 0:00:07
889500 -- (-1241.947) [-1242.743] (-1241.135) (-1245.120) * (-1242.136) (-1242.714) [-1241.442] (-1243.097) -- 0:00:07
890000 -- (-1241.635) (-1241.933) [-1242.408] (-1245.156) * (-1242.158) [-1241.443] (-1239.365) (-1241.635) -- 0:00:07
Average standard deviation of split frequencies: 0.007382
890500 -- (-1241.437) [-1242.347] (-1241.052) (-1245.994) * (-1241.845) [-1241.901] (-1241.964) (-1244.632) -- 0:00:07
891000 -- (-1244.262) (-1241.887) [-1240.168] (-1244.046) * (-1241.883) [-1242.593] (-1242.035) (-1241.792) -- 0:00:07
891500 -- [-1242.525] (-1242.293) (-1245.546) (-1242.440) * [-1240.860] (-1248.089) (-1242.172) (-1241.622) -- 0:00:07
892000 -- [-1246.834] (-1241.333) (-1242.604) (-1246.639) * (-1243.633) (-1243.410) (-1243.819) [-1241.684] -- 0:00:07
892500 -- (-1245.716) [-1243.744] (-1242.246) (-1242.303) * (-1243.259) (-1243.116) [-1241.911] (-1242.867) -- 0:00:07
893000 -- (-1240.830) [-1241.533] (-1243.355) (-1241.892) * (-1241.890) [-1242.420] (-1244.600) (-1243.656) -- 0:00:07
893500 -- (-1241.889) (-1241.534) (-1241.783) [-1239.039] * (-1240.475) [-1241.546] (-1245.220) (-1241.116) -- 0:00:07
894000 -- (-1240.014) [-1241.346] (-1241.990) (-1242.336) * (-1241.590) (-1241.090) (-1243.192) [-1242.579] -- 0:00:07
894500 -- (-1243.218) [-1241.414] (-1243.705) (-1242.228) * [-1239.937] (-1241.149) (-1240.974) (-1243.334) -- 0:00:07
895000 -- [-1239.337] (-1242.942) (-1243.354) (-1241.409) * [-1245.448] (-1242.155) (-1246.699) (-1242.359) -- 0:00:07
Average standard deviation of split frequencies: 0.007587
895500 -- (-1241.472) [-1245.322] (-1242.135) (-1242.658) * (-1243.927) (-1241.042) [-1244.398] (-1241.566) -- 0:00:07
896000 -- (-1246.498) (-1248.306) (-1241.810) [-1242.136] * (-1243.579) (-1245.888) (-1246.352) [-1244.005] -- 0:00:07
896500 -- [-1244.601] (-1242.739) (-1244.198) (-1243.693) * (-1239.661) [-1241.983] (-1242.436) (-1242.224) -- 0:00:07
897000 -- [-1244.769] (-1243.634) (-1243.673) (-1242.523) * [-1241.724] (-1242.198) (-1242.231) (-1244.115) -- 0:00:07
897500 -- [-1244.635] (-1247.147) (-1244.241) (-1244.803) * [-1241.142] (-1240.085) (-1240.530) (-1244.198) -- 0:00:06
898000 -- (-1244.055) (-1244.434) [-1241.075] (-1243.095) * (-1242.550) (-1242.091) [-1240.753] (-1242.172) -- 0:00:06
898500 -- (-1242.386) (-1244.518) (-1242.742) [-1242.170] * [-1242.089] (-1244.531) (-1243.327) (-1242.546) -- 0:00:06
899000 -- (-1239.117) (-1242.282) [-1243.333] (-1240.205) * [-1241.728] (-1244.195) (-1243.289) (-1241.582) -- 0:00:06
899500 -- [-1243.580] (-1248.906) (-1246.087) (-1241.312) * (-1242.025) (-1242.535) [-1242.212] (-1245.378) -- 0:00:06
900000 -- (-1242.252) (-1246.451) [-1242.304] (-1243.174) * [-1243.153] (-1243.924) (-1248.775) (-1244.607) -- 0:00:06
Average standard deviation of split frequencies: 0.007383
900500 -- [-1243.561] (-1245.885) (-1244.066) (-1241.057) * (-1244.541) (-1243.005) (-1241.598) [-1241.320] -- 0:00:06
901000 -- [-1241.493] (-1242.548) (-1242.515) (-1238.653) * (-1242.556) [-1242.947] (-1241.233) (-1242.981) -- 0:00:06
901500 -- [-1241.318] (-1242.395) (-1247.082) (-1240.353) * [-1242.479] (-1243.092) (-1243.104) (-1242.451) -- 0:00:06
902000 -- (-1241.787) (-1244.084) [-1243.114] (-1242.307) * (-1241.956) (-1243.437) [-1244.744] (-1241.886) -- 0:00:06
902500 -- (-1240.874) (-1244.155) (-1242.560) [-1241.925] * (-1242.621) (-1240.659) [-1241.236] (-1241.620) -- 0:00:06
903000 -- (-1240.780) (-1245.210) (-1242.504) [-1238.644] * (-1241.192) [-1240.920] (-1241.829) (-1240.748) -- 0:00:06
903500 -- (-1240.930) (-1241.838) (-1244.084) [-1242.518] * (-1244.241) (-1247.326) [-1240.832] (-1245.698) -- 0:00:06
904000 -- (-1244.890) (-1242.455) [-1243.151] (-1240.342) * (-1241.686) [-1241.262] (-1241.052) (-1244.628) -- 0:00:06
904500 -- (-1241.620) (-1240.719) [-1241.797] (-1241.431) * (-1242.266) [-1241.131] (-1237.919) (-1245.286) -- 0:00:06
905000 -- (-1244.115) (-1241.317) (-1241.410) [-1240.329] * [-1242.238] (-1241.437) (-1243.378) (-1242.407) -- 0:00:06
Average standard deviation of split frequencies: 0.007284
905500 -- (-1242.998) (-1246.424) (-1245.890) [-1242.463] * (-1243.250) [-1242.823] (-1242.313) (-1239.639) -- 0:00:06
906000 -- (-1242.900) (-1246.056) [-1242.969] (-1244.972) * [-1241.216] (-1241.921) (-1247.241) (-1244.442) -- 0:00:06
906500 -- (-1245.193) (-1248.798) (-1242.081) [-1240.798] * (-1241.316) (-1241.155) (-1245.776) [-1241.773] -- 0:00:06
907000 -- (-1246.963) [-1243.463] (-1243.948) (-1241.899) * (-1241.523) (-1240.063) (-1240.825) [-1242.158] -- 0:00:06
907500 -- (-1242.079) [-1246.855] (-1244.168) (-1241.483) * (-1240.759) (-1241.387) (-1240.501) [-1241.202] -- 0:00:06
908000 -- (-1241.669) (-1244.708) (-1248.444) [-1240.699] * (-1241.569) [-1238.439] (-1245.708) (-1238.838) -- 0:00:06
908500 -- (-1241.782) (-1243.423) [-1248.620] (-1242.312) * (-1242.199) (-1243.083) [-1242.428] (-1241.080) -- 0:00:06
909000 -- [-1241.861] (-1245.858) (-1245.550) (-1242.966) * (-1243.924) (-1243.688) (-1239.675) [-1240.945] -- 0:00:06
909500 -- (-1243.644) (-1240.888) [-1244.090] (-1240.601) * (-1241.663) [-1246.990] (-1241.573) (-1241.638) -- 0:00:06
910000 -- (-1241.710) (-1239.955) (-1241.331) [-1243.375] * (-1244.865) (-1240.775) [-1241.572] (-1241.631) -- 0:00:06
Average standard deviation of split frequencies: 0.007520
910500 -- [-1241.624] (-1240.062) (-1239.035) (-1242.638) * (-1244.198) (-1243.919) [-1242.622] (-1239.374) -- 0:00:06
911000 -- (-1244.666) (-1244.048) [-1241.175] (-1238.965) * (-1246.797) (-1246.727) [-1241.460] (-1241.697) -- 0:00:06
911500 -- (-1243.577) (-1242.861) [-1241.193] (-1243.204) * (-1242.855) (-1242.386) [-1244.203] (-1242.217) -- 0:00:06
912000 -- (-1241.678) (-1241.232) [-1243.559] (-1242.057) * (-1241.438) (-1242.501) [-1242.375] (-1244.328) -- 0:00:05
912500 -- (-1243.890) (-1240.657) (-1241.021) [-1240.296] * (-1241.216) [-1242.221] (-1239.176) (-1244.429) -- 0:00:05
913000 -- (-1242.864) (-1241.437) (-1243.182) [-1241.633] * (-1239.171) [-1240.122] (-1240.689) (-1242.356) -- 0:00:05
913500 -- (-1243.265) [-1242.624] (-1243.668) (-1240.894) * (-1241.963) (-1242.270) (-1241.548) [-1241.754] -- 0:00:05
914000 -- (-1240.353) (-1242.025) (-1244.475) [-1241.909] * (-1241.541) (-1247.028) [-1241.121] (-1242.291) -- 0:00:05
914500 -- [-1243.890] (-1242.113) (-1243.972) (-1241.998) * (-1243.266) [-1243.138] (-1240.469) (-1242.204) -- 0:00:05
915000 -- (-1246.871) (-1241.925) [-1240.471] (-1241.922) * (-1241.611) (-1241.693) [-1241.012] (-1242.148) -- 0:00:05
Average standard deviation of split frequencies: 0.007313
915500 -- (-1244.214) (-1244.851) (-1241.007) [-1241.903] * (-1244.989) (-1241.958) (-1242.404) [-1240.483] -- 0:00:05
916000 -- [-1244.054] (-1242.303) (-1241.937) (-1241.343) * (-1244.434) (-1243.514) (-1242.043) [-1241.335] -- 0:00:05
916500 -- (-1242.616) (-1241.464) [-1241.695] (-1241.728) * (-1242.258) (-1243.555) (-1243.608) [-1241.220] -- 0:00:05
917000 -- [-1240.735] (-1243.380) (-1244.103) (-1241.718) * (-1241.233) [-1243.755] (-1242.305) (-1241.674) -- 0:00:05
917500 -- (-1240.841) (-1244.082) [-1242.773] (-1242.264) * (-1241.150) (-1242.586) [-1244.159] (-1243.737) -- 0:00:05
918000 -- (-1246.084) (-1245.216) [-1242.449] (-1241.332) * [-1246.022] (-1244.305) (-1246.675) (-1244.830) -- 0:00:05
918500 -- (-1242.513) (-1243.843) (-1245.193) [-1244.536] * (-1239.547) (-1243.705) (-1247.045) [-1245.023] -- 0:00:05
919000 -- (-1245.217) (-1242.831) [-1244.143] (-1245.703) * (-1243.275) [-1242.610] (-1245.282) (-1243.880) -- 0:00:05
919500 -- (-1243.047) [-1243.000] (-1242.520) (-1242.495) * (-1244.672) [-1241.475] (-1241.971) (-1242.948) -- 0:00:05
920000 -- (-1241.292) (-1246.667) [-1239.956] (-1243.347) * (-1241.614) [-1241.913] (-1242.397) (-1244.850) -- 0:00:05
Average standard deviation of split frequencies: 0.007546
920500 -- (-1241.013) (-1241.777) (-1240.255) [-1243.465] * (-1242.435) (-1242.143) [-1240.866] (-1241.343) -- 0:00:05
921000 -- (-1242.750) [-1240.198] (-1242.744) (-1243.454) * (-1240.258) (-1244.293) [-1248.159] (-1242.651) -- 0:00:05
921500 -- (-1239.696) (-1241.138) [-1241.639] (-1245.731) * (-1242.730) [-1242.055] (-1242.805) (-1243.841) -- 0:00:05
922000 -- (-1243.669) [-1240.671] (-1240.687) (-1241.434) * (-1244.031) [-1244.448] (-1242.897) (-1246.537) -- 0:00:05
922500 -- (-1243.746) [-1242.114] (-1239.953) (-1240.632) * [-1240.053] (-1246.808) (-1243.872) (-1242.445) -- 0:00:05
923000 -- (-1241.783) (-1241.448) [-1242.165] (-1240.626) * (-1243.260) (-1247.849) [-1243.258] (-1242.812) -- 0:00:05
923500 -- [-1240.027] (-1240.506) (-1242.397) (-1241.304) * [-1241.555] (-1244.867) (-1240.890) (-1241.728) -- 0:00:05
924000 -- [-1243.562] (-1241.690) (-1246.620) (-1242.932) * [-1242.322] (-1242.932) (-1244.153) (-1239.621) -- 0:00:05
924500 -- [-1242.196] (-1240.949) (-1244.335) (-1241.980) * (-1241.686) (-1242.505) [-1242.717] (-1241.105) -- 0:00:05
925000 -- (-1245.083) (-1242.607) (-1240.418) [-1239.885] * (-1241.927) (-1247.881) [-1243.223] (-1239.706) -- 0:00:05
Average standard deviation of split frequencies: 0.007395
925500 -- (-1241.171) (-1241.793) (-1244.792) [-1241.674] * (-1241.985) [-1246.479] (-1245.057) (-1244.932) -- 0:00:05
926000 -- (-1241.464) [-1243.499] (-1244.438) (-1242.498) * (-1242.594) [-1242.602] (-1241.560) (-1241.793) -- 0:00:05
926500 -- (-1242.081) (-1241.041) (-1241.583) [-1241.459] * (-1245.288) (-1241.032) [-1241.590] (-1242.401) -- 0:00:04
927000 -- (-1241.961) (-1242.091) [-1241.765] (-1240.284) * (-1240.990) (-1240.797) [-1241.435] (-1241.701) -- 0:00:04
927500 -- (-1244.008) (-1241.013) [-1239.253] (-1238.866) * [-1240.717] (-1241.240) (-1241.250) (-1241.258) -- 0:00:04
928000 -- (-1249.950) (-1243.050) (-1243.522) [-1240.671] * (-1240.587) (-1240.976) [-1241.868] (-1241.939) -- 0:00:04
928500 -- [-1241.762] (-1242.891) (-1243.910) (-1245.450) * (-1242.480) [-1242.455] (-1241.751) (-1240.892) -- 0:00:04
929000 -- (-1241.717) (-1243.355) (-1241.092) [-1239.015] * (-1243.379) [-1242.114] (-1242.204) (-1245.971) -- 0:00:04
929500 -- (-1243.812) (-1245.416) (-1243.344) [-1237.977] * (-1241.557) [-1241.656] (-1246.123) (-1241.150) -- 0:00:04
930000 -- [-1241.385] (-1243.716) (-1245.499) (-1244.399) * (-1241.493) (-1241.571) [-1238.487] (-1241.638) -- 0:00:04
Average standard deviation of split frequencies: 0.007598
930500 -- (-1242.517) [-1242.143] (-1239.936) (-1241.516) * (-1242.124) (-1242.204) (-1245.028) [-1241.281] -- 0:00:04
931000 -- (-1241.399) [-1244.476] (-1243.267) (-1242.633) * (-1245.332) [-1240.326] (-1241.910) (-1242.694) -- 0:00:04
931500 -- (-1242.717) (-1243.083) [-1240.030] (-1241.104) * [-1241.022] (-1243.244) (-1241.349) (-1241.600) -- 0:00:04
932000 -- (-1242.055) (-1242.104) [-1241.868] (-1240.104) * (-1244.800) (-1242.717) (-1246.008) [-1241.818] -- 0:00:04
932500 -- (-1247.287) (-1243.287) [-1241.159] (-1241.069) * (-1243.894) [-1243.182] (-1244.478) (-1245.865) -- 0:00:04
933000 -- [-1244.838] (-1246.473) (-1241.158) (-1241.533) * (-1247.431) [-1244.136] (-1244.282) (-1244.232) -- 0:00:04
933500 -- (-1243.843) (-1247.476) (-1244.143) [-1241.573] * (-1244.730) (-1247.574) (-1244.339) [-1240.873] -- 0:00:04
934000 -- (-1245.690) (-1242.099) (-1240.727) [-1241.691] * (-1248.913) (-1244.012) [-1243.400] (-1240.429) -- 0:00:04
934500 -- [-1239.467] (-1242.583) (-1243.299) (-1243.725) * (-1241.699) (-1241.206) (-1241.208) [-1238.668] -- 0:00:04
935000 -- (-1240.069) (-1242.435) [-1241.815] (-1242.053) * (-1242.825) (-1241.130) [-1243.099] (-1244.096) -- 0:00:04
Average standard deviation of split frequencies: 0.007555
935500 -- (-1242.128) [-1242.432] (-1247.524) (-1243.050) * (-1242.012) [-1241.096] (-1242.039) (-1241.725) -- 0:00:04
936000 -- [-1240.356] (-1241.309) (-1243.503) (-1241.277) * (-1241.498) (-1242.167) [-1243.308] (-1241.496) -- 0:00:04
936500 -- [-1241.482] (-1240.964) (-1242.365) (-1241.120) * (-1241.409) (-1243.782) (-1243.289) [-1246.597] -- 0:00:04
937000 -- [-1241.341] (-1240.304) (-1240.120) (-1241.181) * [-1241.230] (-1242.145) (-1242.146) (-1239.964) -- 0:00:04
937500 -- (-1241.285) (-1241.659) [-1240.177] (-1244.438) * (-1241.318) (-1247.660) (-1241.569) [-1239.294] -- 0:00:04
938000 -- (-1240.730) (-1244.757) [-1240.942] (-1240.059) * (-1244.224) (-1245.475) [-1243.561] (-1244.155) -- 0:00:04
938500 -- (-1242.874) (-1240.911) [-1240.565] (-1242.268) * (-1242.640) (-1244.613) (-1241.719) [-1239.394] -- 0:00:04
939000 -- (-1243.908) [-1240.175] (-1241.875) (-1242.589) * (-1239.922) (-1241.724) [-1241.391] (-1242.088) -- 0:00:04
939500 -- (-1242.687) (-1241.477) [-1241.032] (-1240.810) * (-1242.131) (-1241.929) [-1241.879] (-1241.340) -- 0:00:04
940000 -- (-1242.851) [-1241.771] (-1242.920) (-1242.450) * [-1240.843] (-1242.840) (-1242.420) (-1242.450) -- 0:00:04
Average standard deviation of split frequencies: 0.007675
940500 -- (-1242.295) [-1243.692] (-1241.991) (-1241.271) * [-1242.110] (-1246.770) (-1248.179) (-1241.590) -- 0:00:04
941000 -- [-1241.198] (-1244.422) (-1242.253) (-1241.514) * (-1240.188) [-1243.425] (-1246.937) (-1241.826) -- 0:00:04
941500 -- [-1239.853] (-1244.078) (-1242.646) (-1242.425) * (-1246.740) (-1244.027) [-1241.418] (-1239.502) -- 0:00:03
942000 -- [-1244.665] (-1242.285) (-1244.254) (-1243.587) * (-1243.049) [-1243.948] (-1240.455) (-1241.702) -- 0:00:03
942500 -- (-1245.585) [-1242.521] (-1245.919) (-1242.839) * (-1243.254) (-1246.342) (-1239.909) [-1241.232] -- 0:00:03
943000 -- (-1243.770) (-1243.316) [-1241.111] (-1241.906) * [-1241.112] (-1243.796) (-1239.597) (-1242.825) -- 0:00:03
943500 -- (-1243.374) (-1244.166) (-1249.533) [-1243.075] * (-1241.636) (-1244.806) [-1240.139] (-1241.851) -- 0:00:03
944000 -- [-1242.028] (-1244.079) (-1247.212) (-1240.840) * [-1244.120] (-1241.218) (-1238.728) (-1243.426) -- 0:00:03
944500 -- (-1239.064) [-1244.246] (-1243.856) (-1242.532) * (-1244.589) (-1241.152) [-1240.102] (-1243.920) -- 0:00:03
945000 -- (-1241.792) (-1241.216) (-1242.160) [-1242.110] * (-1248.628) (-1241.514) [-1239.141] (-1241.162) -- 0:00:03
Average standard deviation of split frequencies: 0.007344
945500 -- [-1242.134] (-1239.298) (-1239.481) (-1244.492) * (-1243.339) (-1243.077) (-1241.079) [-1240.202] -- 0:00:03
946000 -- [-1242.445] (-1242.252) (-1242.820) (-1245.153) * (-1241.460) [-1241.650] (-1245.134) (-1238.878) -- 0:00:03
946500 -- (-1248.023) [-1243.342] (-1244.309) (-1242.506) * (-1242.590) [-1240.980] (-1244.955) (-1241.207) -- 0:00:03
947000 -- (-1244.343) (-1242.761) (-1242.845) [-1240.807] * [-1241.055] (-1240.879) (-1241.948) (-1242.397) -- 0:00:03
947500 -- [-1243.734] (-1244.675) (-1242.380) (-1241.958) * [-1242.092] (-1240.956) (-1240.739) (-1242.840) -- 0:00:03
948000 -- (-1244.505) [-1241.826] (-1246.892) (-1240.675) * (-1240.835) [-1240.549] (-1241.041) (-1242.895) -- 0:00:03
948500 -- (-1241.822) [-1241.232] (-1245.217) (-1242.532) * (-1241.481) (-1241.192) [-1242.348] (-1243.692) -- 0:00:03
949000 -- [-1244.951] (-1243.567) (-1240.783) (-1243.460) * (-1239.575) [-1241.833] (-1241.889) (-1243.721) -- 0:00:03
949500 -- (-1243.167) (-1243.850) [-1242.740] (-1243.428) * [-1241.798] (-1241.828) (-1239.903) (-1241.180) -- 0:00:03
950000 -- (-1241.386) [-1240.842] (-1242.605) (-1241.909) * [-1242.180] (-1244.340) (-1242.895) (-1243.720) -- 0:00:03
Average standard deviation of split frequencies: 0.007073
950500 -- (-1244.592) (-1241.097) (-1242.406) [-1242.579] * (-1241.644) (-1243.121) [-1241.167] (-1242.818) -- 0:00:03
951000 -- (-1243.707) [-1240.546] (-1243.411) (-1245.812) * (-1241.782) [-1243.203] (-1242.222) (-1241.749) -- 0:00:03
951500 -- (-1241.990) (-1241.314) (-1241.190) [-1241.475] * (-1240.913) [-1241.466] (-1239.626) (-1241.132) -- 0:00:03
952000 -- (-1243.742) (-1240.583) (-1241.957) [-1241.659] * [-1241.527] (-1246.135) (-1241.281) (-1242.697) -- 0:00:03
952500 -- (-1241.691) [-1241.744] (-1242.264) (-1241.820) * (-1241.658) [-1239.865] (-1241.244) (-1243.730) -- 0:00:03
953000 -- [-1237.813] (-1241.910) (-1249.265) (-1241.803) * (-1241.639) [-1242.925] (-1242.518) (-1241.852) -- 0:00:03
953500 -- (-1240.468) (-1240.343) [-1241.399] (-1243.532) * (-1243.589) (-1242.007) [-1241.837] (-1243.196) -- 0:00:03
954000 -- [-1241.910] (-1241.050) (-1243.220) (-1243.956) * (-1242.916) (-1242.807) [-1242.704] (-1244.802) -- 0:00:03
954500 -- [-1243.860] (-1245.091) (-1240.815) (-1244.098) * (-1241.477) [-1241.416] (-1243.916) (-1242.685) -- 0:00:03
955000 -- (-1241.640) (-1243.126) (-1243.357) [-1241.687] * (-1240.108) (-1241.124) [-1243.364] (-1240.929) -- 0:00:03
Average standard deviation of split frequencies: 0.007241
955500 -- (-1242.666) (-1242.510) [-1242.193] (-1241.484) * [-1243.395] (-1241.652) (-1243.069) (-1240.894) -- 0:00:03
956000 -- (-1243.180) [-1241.631] (-1242.580) (-1242.022) * (-1242.727) (-1241.526) (-1243.178) [-1241.431] -- 0:00:02
956500 -- (-1247.986) (-1241.868) [-1242.887] (-1243.437) * (-1242.821) (-1240.846) [-1245.444] (-1241.549) -- 0:00:02
957000 -- (-1247.233) (-1248.248) [-1241.356] (-1243.504) * (-1242.539) (-1242.283) [-1242.767] (-1239.401) -- 0:00:02
957500 -- (-1240.500) [-1245.457] (-1242.271) (-1241.119) * [-1241.599] (-1243.704) (-1241.580) (-1243.213) -- 0:00:02
958000 -- (-1244.551) (-1243.292) (-1245.370) [-1241.146] * (-1246.283) [-1241.054] (-1241.567) (-1244.750) -- 0:00:02
958500 -- (-1240.535) (-1242.673) (-1242.660) [-1241.756] * [-1241.099] (-1240.804) (-1243.855) (-1242.566) -- 0:00:02
959000 -- (-1243.378) (-1241.030) (-1241.300) [-1241.377] * (-1242.796) [-1240.194] (-1249.336) (-1241.204) -- 0:00:02
959500 -- [-1243.711] (-1240.875) (-1243.046) (-1241.794) * [-1242.391] (-1240.812) (-1241.559) (-1239.427) -- 0:00:02
960000 -- (-1244.479) (-1241.585) (-1243.220) [-1240.341] * (-1239.783) (-1240.695) [-1245.531] (-1239.677) -- 0:00:02
Average standard deviation of split frequencies: 0.006999
960500 -- (-1246.047) [-1246.177] (-1244.690) (-1247.608) * (-1241.784) (-1242.080) [-1244.535] (-1241.899) -- 0:00:02
961000 -- (-1248.553) (-1241.692) (-1242.712) [-1241.543] * (-1244.101) (-1243.245) (-1247.696) [-1240.818] -- 0:00:02
961500 -- (-1246.362) (-1241.204) [-1241.205] (-1242.303) * [-1243.896] (-1241.508) (-1241.700) (-1241.778) -- 0:00:02
962000 -- (-1245.248) (-1246.868) (-1241.162) [-1242.039] * (-1244.622) (-1243.664) [-1242.318] (-1241.683) -- 0:00:02
962500 -- (-1244.973) [-1244.220] (-1241.097) (-1241.266) * [-1245.075] (-1247.785) (-1241.236) (-1243.667) -- 0:00:02
963000 -- (-1241.255) (-1242.991) (-1244.605) [-1240.167] * [-1242.207] (-1245.985) (-1241.345) (-1244.002) -- 0:00:02
963500 -- [-1243.084] (-1243.470) (-1241.520) (-1242.482) * (-1241.625) [-1240.598] (-1240.745) (-1244.181) -- 0:00:02
964000 -- (-1242.918) [-1244.419] (-1239.107) (-1241.003) * (-1240.724) [-1240.346] (-1244.673) (-1241.927) -- 0:00:02
964500 -- [-1242.715] (-1242.852) (-1243.045) (-1241.133) * (-1242.432) [-1239.327] (-1242.870) (-1245.622) -- 0:00:02
965000 -- (-1241.242) (-1240.554) (-1246.401) [-1243.284] * (-1243.348) [-1240.595] (-1242.125) (-1241.916) -- 0:00:02
Average standard deviation of split frequencies: 0.007114
965500 -- (-1241.259) [-1241.158] (-1242.876) (-1243.291) * [-1242.560] (-1242.149) (-1243.373) (-1244.639) -- 0:00:02
966000 -- (-1241.933) (-1241.619) (-1243.955) [-1241.739] * (-1240.998) (-1243.530) [-1241.151] (-1243.405) -- 0:00:02
966500 -- [-1241.801] (-1244.337) (-1245.195) (-1238.856) * (-1240.566) (-1242.668) [-1239.645] (-1241.578) -- 0:00:02
967000 -- (-1242.467) (-1244.076) (-1241.369) [-1239.662] * (-1243.065) (-1240.491) (-1242.082) [-1240.935] -- 0:00:02
967500 -- (-1243.398) (-1243.994) [-1242.070] (-1241.436) * [-1242.251] (-1238.772) (-1242.317) (-1242.121) -- 0:00:02
968000 -- (-1243.399) (-1243.655) (-1242.993) [-1243.146] * [-1241.211] (-1240.568) (-1241.273) (-1241.136) -- 0:00:02
968500 -- (-1244.049) [-1242.267] (-1239.658) (-1245.978) * (-1244.514) (-1241.986) [-1240.342] (-1243.581) -- 0:00:02
969000 -- [-1242.768] (-1244.878) (-1244.340) (-1242.563) * (-1242.683) (-1241.768) [-1239.488] (-1243.107) -- 0:00:02
969500 -- (-1246.796) (-1242.265) (-1242.024) [-1240.703] * (-1242.676) [-1241.587] (-1244.930) (-1242.328) -- 0:00:02
970000 -- (-1244.702) (-1241.689) (-1243.175) [-1241.222] * [-1243.239] (-1243.351) (-1241.086) (-1243.968) -- 0:00:02
Average standard deviation of split frequencies: 0.007131
970500 -- [-1242.792] (-1241.986) (-1242.176) (-1239.052) * (-1245.771) [-1242.564] (-1242.433) (-1245.793) -- 0:00:02
971000 -- (-1241.221) [-1240.963] (-1241.937) (-1242.015) * (-1241.534) (-1243.488) (-1245.403) [-1241.822] -- 0:00:01
971500 -- (-1242.660) (-1241.629) (-1241.236) [-1243.998] * (-1240.814) (-1242.810) (-1243.103) [-1243.075] -- 0:00:01
972000 -- (-1246.512) [-1242.076] (-1241.316) (-1243.872) * (-1241.960) (-1244.042) [-1242.753] (-1248.462) -- 0:00:01
972500 -- (-1242.406) [-1246.386] (-1243.020) (-1241.576) * (-1242.073) (-1242.018) [-1244.785] (-1241.630) -- 0:00:01
973000 -- (-1243.021) (-1244.078) [-1243.045] (-1240.620) * (-1246.824) (-1241.525) [-1245.046] (-1241.304) -- 0:00:01
973500 -- (-1239.977) [-1242.278] (-1243.181) (-1241.293) * (-1245.471) (-1241.459) [-1240.856] (-1242.843) -- 0:00:01
974000 -- [-1246.715] (-1241.960) (-1242.535) (-1240.124) * (-1243.362) (-1240.706) (-1239.196) [-1243.713] -- 0:00:01
974500 -- (-1244.175) (-1240.890) (-1241.209) [-1242.560] * (-1245.457) [-1239.552] (-1239.282) (-1241.749) -- 0:00:01
975000 -- (-1242.363) [-1243.137] (-1246.042) (-1241.908) * [-1241.996] (-1244.087) (-1242.798) (-1241.989) -- 0:00:01
Average standard deviation of split frequencies: 0.006940
975500 -- (-1240.877) (-1240.866) [-1241.765] (-1242.179) * (-1242.607) (-1244.824) [-1242.717] (-1242.898) -- 0:00:01
976000 -- [-1244.202] (-1240.781) (-1242.949) (-1240.964) * (-1241.184) (-1243.190) (-1243.158) [-1243.195] -- 0:00:01
976500 -- (-1250.290) [-1242.055] (-1243.486) (-1243.688) * [-1239.914] (-1241.818) (-1240.718) (-1244.452) -- 0:00:01
977000 -- [-1244.319] (-1241.692) (-1246.075) (-1242.696) * (-1243.293) (-1242.842) [-1242.216] (-1248.783) -- 0:00:01
977500 -- (-1242.019) (-1245.391) (-1245.403) [-1241.484] * (-1241.064) [-1240.170] (-1243.073) (-1244.614) -- 0:00:01
978000 -- (-1244.107) (-1243.493) [-1242.510] (-1241.170) * (-1242.031) [-1241.069] (-1241.944) (-1242.151) -- 0:00:01
978500 -- (-1244.013) (-1242.460) [-1245.197] (-1241.185) * (-1241.918) (-1241.051) [-1241.232] (-1242.083) -- 0:00:01
979000 -- [-1245.068] (-1242.302) (-1244.123) (-1240.236) * (-1241.139) [-1239.880] (-1245.199) (-1243.827) -- 0:00:01
979500 -- [-1243.090] (-1243.303) (-1243.817) (-1246.727) * [-1239.582] (-1242.108) (-1241.675) (-1241.955) -- 0:00:01
980000 -- (-1243.008) [-1240.124] (-1242.677) (-1245.438) * (-1242.951) (-1241.612) [-1241.743] (-1243.654) -- 0:00:01
Average standard deviation of split frequencies: 0.006730
980500 -- (-1241.395) (-1240.874) [-1243.027] (-1245.104) * (-1244.433) [-1240.790] (-1243.735) (-1243.747) -- 0:00:01
981000 -- (-1241.613) (-1242.203) [-1241.093] (-1240.826) * (-1242.613) (-1237.709) (-1245.030) [-1241.551] -- 0:00:01
981500 -- (-1243.706) [-1238.765] (-1241.274) (-1241.722) * (-1244.509) (-1239.787) [-1241.066] (-1242.593) -- 0:00:01
982000 -- (-1243.139) (-1245.990) [-1241.479] (-1242.230) * (-1239.637) (-1242.772) (-1242.053) [-1244.555] -- 0:00:01
982500 -- (-1244.640) (-1240.599) (-1243.557) [-1241.040] * [-1241.660] (-1241.515) (-1244.254) (-1243.929) -- 0:00:01
983000 -- (-1241.831) (-1241.148) [-1242.704] (-1241.763) * (-1243.142) (-1242.229) [-1242.725] (-1243.574) -- 0:00:01
983500 -- (-1245.709) (-1242.547) (-1240.626) [-1241.661] * (-1245.526) (-1242.708) [-1242.080] (-1245.347) -- 0:00:01
984000 -- [-1243.880] (-1242.970) (-1243.033) (-1245.200) * (-1241.474) [-1241.151] (-1243.043) (-1243.579) -- 0:00:01
984500 -- (-1247.869) [-1239.355] (-1240.751) (-1246.032) * (-1241.369) (-1241.687) [-1242.177] (-1242.120) -- 0:00:01
985000 -- (-1242.374) (-1242.873) (-1242.446) [-1242.745] * [-1245.849] (-1242.967) (-1242.929) (-1242.720) -- 0:00:01
Average standard deviation of split frequencies: 0.006995
985500 -- (-1241.473) [-1242.537] (-1242.704) (-1245.243) * (-1244.085) [-1242.557] (-1244.817) (-1242.627) -- 0:00:00
986000 -- [-1242.247] (-1241.975) (-1241.042) (-1243.288) * [-1241.497] (-1241.522) (-1241.040) (-1242.553) -- 0:00:00
986500 -- (-1241.969) [-1242.004] (-1241.423) (-1238.692) * (-1242.698) (-1242.301) (-1244.815) [-1242.255] -- 0:00:00
987000 -- [-1242.597] (-1242.395) (-1248.769) (-1241.973) * (-1245.052) (-1241.311) (-1243.775) [-1243.245] -- 0:00:00
987500 -- (-1242.781) (-1242.641) [-1246.248] (-1242.381) * (-1241.488) (-1242.952) (-1241.728) [-1240.902] -- 0:00:00
988000 -- [-1248.056] (-1241.356) (-1243.822) (-1241.396) * (-1241.020) [-1241.278] (-1241.151) (-1241.322) -- 0:00:00
988500 -- (-1247.162) [-1241.418] (-1242.489) (-1247.628) * (-1249.075) (-1243.925) (-1243.056) [-1244.197] -- 0:00:00
989000 -- (-1242.878) [-1242.318] (-1243.808) (-1245.725) * (-1242.381) (-1242.123) [-1242.856] (-1242.243) -- 0:00:00
989500 -- (-1241.877) (-1241.925) [-1242.664] (-1244.278) * [-1242.319] (-1242.201) (-1242.917) (-1241.717) -- 0:00:00
990000 -- (-1249.956) (-1243.493) [-1242.264] (-1241.319) * (-1242.612) [-1241.263] (-1243.436) (-1241.378) -- 0:00:00
Average standard deviation of split frequencies: 0.006873
990500 -- (-1242.208) (-1240.230) (-1241.373) [-1242.288] * (-1239.062) (-1243.929) [-1243.411] (-1243.744) -- 0:00:00
991000 -- (-1242.567) [-1242.120] (-1241.107) (-1243.018) * [-1242.756] (-1242.586) (-1242.062) (-1240.526) -- 0:00:00
991500 -- (-1239.821) (-1244.323) (-1239.904) [-1240.633] * [-1244.328] (-1248.511) (-1242.074) (-1242.203) -- 0:00:00
992000 -- (-1240.993) [-1239.394] (-1245.201) (-1241.336) * [-1242.889] (-1243.944) (-1243.253) (-1241.165) -- 0:00:00
992500 -- (-1241.554) [-1242.435] (-1242.388) (-1243.908) * (-1242.309) [-1243.441] (-1244.860) (-1242.057) -- 0:00:00
993000 -- [-1244.027] (-1241.573) (-1240.970) (-1243.413) * (-1242.578) (-1242.605) [-1244.932] (-1242.651) -- 0:00:00
993500 -- (-1243.173) [-1242.142] (-1243.324) (-1242.250) * (-1241.827) [-1245.691] (-1241.704) (-1242.979) -- 0:00:00
994000 -- (-1241.570) (-1242.033) [-1245.977] (-1245.637) * (-1245.777) (-1241.607) (-1241.523) [-1244.965] -- 0:00:00
994500 -- [-1241.639] (-1241.286) (-1243.464) (-1245.109) * (-1241.730) (-1241.383) (-1242.043) [-1242.113] -- 0:00:00
995000 -- (-1241.453) (-1241.667) (-1243.849) [-1240.894] * [-1240.783] (-1240.296) (-1243.138) (-1244.565) -- 0:00:00
Average standard deviation of split frequencies: 0.006377
995500 -- (-1241.740) (-1241.095) [-1241.064] (-1241.480) * [-1242.899] (-1242.976) (-1242.411) (-1242.829) -- 0:00:00
996000 -- [-1243.237] (-1241.690) (-1243.459) (-1239.556) * (-1242.560) [-1241.455] (-1242.527) (-1241.432) -- 0:00:00
996500 -- (-1242.956) [-1240.599] (-1241.349) (-1244.730) * (-1243.317) (-1238.467) [-1239.608] (-1240.776) -- 0:00:00
997000 -- (-1242.799) [-1240.791] (-1247.081) (-1241.758) * (-1242.732) [-1243.342] (-1242.858) (-1245.428) -- 0:00:00
997500 -- (-1245.168) (-1240.677) [-1241.898] (-1243.066) * (-1247.820) (-1241.823) (-1241.357) [-1242.138] -- 0:00:00
998000 -- (-1242.042) [-1241.692] (-1240.795) (-1240.302) * [-1240.784] (-1241.849) (-1241.031) (-1243.286) -- 0:00:00
998500 -- (-1240.559) (-1241.238) [-1240.866] (-1243.392) * (-1244.359) (-1245.362) (-1242.349) [-1240.174] -- 0:00:00
999000 -- (-1240.986) (-1240.431) (-1244.545) [-1239.828] * [-1243.812] (-1247.311) (-1245.153) (-1240.635) -- 0:00:00
999500 -- (-1241.386) (-1243.187) [-1240.595] (-1245.505) * (-1244.506) [-1243.532] (-1242.203) (-1242.122) -- 0:00:00
1000000 -- (-1243.599) (-1242.362) [-1242.167] (-1242.014) * (-1242.902) (-1242.315) (-1241.132) [-1243.253] -- 0:00:00
Average standard deviation of split frequencies: 0.006543
Analysis completed in 1 mins 8 seconds
Analysis used 66.12 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1236.91
Likelihood of best state for "cold" chain of run 2 was -1236.90
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 74 %) Dirichlet(Revmat{all})
98.9 % ( 97 %) Slider(Revmat{all})
26.4 % ( 25 %) Dirichlet(Pi{all})
27.9 % ( 23 %) Slider(Pi{all})
71.6 % ( 52 %) Multiplier(Alpha{1,2})
79.8 % ( 48 %) Multiplier(Alpha{3})
24.9 % ( 22 %) Slider(Pinvar{all})
91.2 % ( 92 %) ExtSPR(Tau{all},V{all})
62.8 % ( 59 %) ExtTBR(Tau{all},V{all})
91.1 % ( 92 %) NNI(Tau{all},V{all})
80.4 % ( 83 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
94.1 % ( 96 %) Nodeslider(V{all})
30.5 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 78 %) Dirichlet(Revmat{all})
98.7 % (100 %) Slider(Revmat{all})
26.0 % ( 27 %) Dirichlet(Pi{all})
27.4 % ( 26 %) Slider(Pi{all})
71.2 % ( 40 %) Multiplier(Alpha{1,2})
79.3 % ( 58 %) Multiplier(Alpha{3})
23.3 % ( 26 %) Slider(Pinvar{all})
91.8 % ( 91 %) ExtSPR(Tau{all},V{all})
63.5 % ( 69 %) ExtTBR(Tau{all},V{all})
91.8 % ( 93 %) NNI(Tau{all},V{all})
81.1 % ( 75 %) ParsSPR(Tau{all},V{all})
28.1 % ( 25 %) Multiplier(V{all})
94.4 % ( 93 %) Nodeslider(V{all})
30.7 % ( 33 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166747 0.82 0.66
3 | 166658 166971 0.83
4 | 166048 166518 167058
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.50
2 | 166742 0.82 0.66
3 | 166819 166823 0.83
4 | 166712 166278 166626
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1241.32
| 1 12 |
| |
| 1 |
| 2 2 2 2 |
| 21 11 1 1 1 1 2 |
|1 * 1 1 22 2 2 2 1 2 |
| 2 2 2 22211 1 1 2 |
| 11 2 1 22 1 *1 1 1 2121 |
| 2 1 2 1 1 *1 1 12 12 1 * * 1|
| 2 222 2 2*2 2 2 2 1 |
| 1 1 1 2 1 1 1 |
| 1 2 1 2 2 12 |
| 111 1 1 1 2|
| 2 2 2 12 2 1 |
|2 2 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1242.90
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1241.11 -1244.02
2 -1241.10 -1244.44
--------------------------------------
TOTAL -1241.10 -1244.25
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.883563 0.090213 0.339266 1.458836 0.853578 1459.78 1480.39 1.000
r(A<->C){all} 0.159357 0.018953 0.000152 0.435069 0.127730 227.42 259.16 1.000
r(A<->G){all} 0.175886 0.022400 0.000023 0.481242 0.137223 156.88 226.35 1.005
r(A<->T){all} 0.176030 0.021145 0.000009 0.463421 0.139570 214.01 270.21 1.003
r(C<->G){all} 0.148266 0.018592 0.000041 0.435925 0.106179 133.08 234.94 1.005
r(C<->T){all} 0.188184 0.024711 0.000042 0.488147 0.149998 199.79 271.48 1.000
r(G<->T){all} 0.152276 0.017988 0.000007 0.421353 0.113307 187.90 261.27 1.008
pi(A){all} 0.192414 0.000171 0.168058 0.218645 0.192280 1333.60 1417.30 1.002
pi(C){all} 0.273708 0.000221 0.244906 0.302453 0.273287 1328.43 1355.23 1.000
pi(G){all} 0.281420 0.000223 0.250556 0.308676 0.281219 1096.23 1213.99 1.000
pi(T){all} 0.252458 0.000204 0.225635 0.281342 0.252063 1187.39 1229.84 1.000
alpha{1,2} 0.396227 0.181071 0.000142 1.298777 0.246990 989.97 1100.13 1.000
alpha{3} 0.416430 0.222341 0.000114 1.389022 0.249504 1183.56 1257.68 1.000
pinvar{all} 0.996541 0.000010 0.990967 0.999935 0.997396 1215.57 1290.70 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- .*...*
9 -- .*..*.
10 -- .***.*
11 -- ....**
12 -- .****.
13 -- ..****
14 -- .**.**
15 -- .**...
16 -- .*.*..
17 -- .*..**
18 -- ..*..*
19 -- ..*.*.
20 -- .*.***
21 -- .***..
22 -- ...**.
23 -- ...*.*
24 -- ..***.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 812 0.270486 0.010364 0.263158 0.277815 2
8 480 0.159893 0.009422 0.153231 0.166556 2
9 476 0.158561 0.000942 0.157895 0.159227 2
10 475 0.158228 0.008009 0.152565 0.163891 2
11 474 0.157895 0.014133 0.147901 0.167888 2
12 473 0.157562 0.009893 0.150566 0.164557 2
13 445 0.148235 0.009893 0.141239 0.155230 2
14 382 0.127249 0.004711 0.123917 0.130580 2
15 364 0.121252 0.007537 0.115923 0.126582 2
16 355 0.118254 0.002355 0.116589 0.119920 2
17 355 0.118254 0.008009 0.112592 0.123917 2
18 352 0.117255 0.002827 0.115256 0.119254 2
19 350 0.116589 0.000942 0.115923 0.117255 2
20 344 0.114590 0.001884 0.113258 0.115923 2
21 336 0.111925 0.002827 0.109927 0.113924 2
22 336 0.111925 0.010364 0.104597 0.119254 2
23 333 0.110926 0.006124 0.106596 0.115256 2
24 326 0.108594 0.007537 0.103264 0.113924 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.093185 0.008969 0.000012 0.282079 0.063917 1.000 2
length{all}[2] 0.095072 0.009219 0.000005 0.290474 0.065776 1.000 2
length{all}[3] 0.104241 0.010643 0.000001 0.305615 0.074209 1.000 2
length{all}[4] 0.100075 0.009943 0.000020 0.287967 0.070528 1.000 2
length{all}[5] 0.095711 0.009712 0.000011 0.291024 0.063444 1.000 2
length{all}[6] 0.093996 0.009749 0.000017 0.290326 0.062929 1.000 2
length{all}[7] 0.138399 0.016114 0.000478 0.402370 0.100204 1.004 2
length{all}[8] 0.099265 0.010504 0.000302 0.293940 0.068545 1.010 2
length{all}[9] 0.090496 0.008218 0.000417 0.270067 0.063907 1.001 2
length{all}[10] 0.091022 0.008795 0.000013 0.273167 0.057584 0.998 2
length{all}[11] 0.087217 0.007928 0.000071 0.257926 0.061435 0.998 2
length{all}[12] 0.093378 0.008698 0.000410 0.268189 0.065093 0.998 2
length{all}[13] 0.099333 0.009988 0.000000 0.287227 0.071105 1.001 2
length{all}[14] 0.096058 0.008382 0.000989 0.283794 0.071295 0.998 2
length{all}[15] 0.091610 0.008822 0.000060 0.286679 0.062277 0.998 2
length{all}[16] 0.100174 0.009608 0.000213 0.311329 0.073607 0.997 2
length{all}[17] 0.102259 0.009884 0.000112 0.277334 0.075721 0.998 2
length{all}[18] 0.093026 0.008266 0.000192 0.271980 0.063327 0.997 2
length{all}[19] 0.103648 0.010531 0.000450 0.308227 0.070662 1.001 2
length{all}[20] 0.097615 0.009697 0.000519 0.296857 0.063006 1.002 2
length{all}[21] 0.104226 0.011108 0.000004 0.285362 0.073446 1.001 2
length{all}[22] 0.098628 0.007888 0.000179 0.268064 0.079153 1.000 2
length{all}[23] 0.100801 0.012074 0.000009 0.306177 0.061839 0.999 2
length{all}[24] 0.095769 0.008598 0.000332 0.287956 0.067759 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006543
Maximum standard deviation of split frequencies = 0.014133
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 37 trees
90 % credible set contains 88 trees
95 % credible set contains 96 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 891
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 297 / 297 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 297 / 297 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.071065 0.084361 0.038581 0.092543 0.098586 0.067223 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1317.609975
Iterating by ming2
Initial: fx= 1317.609975
x= 0.07106 0.08436 0.03858 0.09254 0.09859 0.06722 0.30000 1.30000
1 h-m-p 0.0000 0.0001 696.1485 ++ 1255.290493 m 0.0001 13 | 0/8
2 h-m-p 0.0000 0.0000 4413.1453 ++ 1219.592753 m 0.0000 24 | 1/8
3 h-m-p 0.0000 0.0000 8186.4630 ++ 1215.797899 m 0.0000 35 | 2/8
4 h-m-p 0.0000 0.0000 13416.4294 ++ 1206.620419 m 0.0000 46 | 3/8
5 h-m-p 0.0000 0.0000 393.8043 ++ 1202.035346 m 0.0000 57 | 4/8
6 h-m-p 0.0003 0.1682 5.7919 ++++CYYYC 1196.344500 4 0.1461 78 | 4/8
7 h-m-p 0.4220 6.1622 2.0047 CCCC 1196.077514 3 0.0969 95 | 4/8
8 h-m-p 0.4524 2.6804 0.4294 +YYYYCCCCC 1194.165967 8 1.8802 119 | 4/8
9 h-m-p 0.0833 0.4163 0.0690 --------------.. | 4/8
10 h-m-p 0.0000 0.0002 330038.6496 ---CYCYYCC 1190.623093 6 0.0000 174 | 4/8
11 h-m-p 0.0003 0.1742 286.9756 --CYYC 1190.435465 3 0.0000 191 | 4/8
12 h-m-p 0.0160 8.0000 0.5862 +++++ 1189.373168 m 8.0000 205 | 4/8
13 h-m-p 1.6000 8.0000 0.8953 ++ 1188.993128 m 8.0000 220 | 4/8
14 h-m-p 1.6000 8.0000 3.1274 ++ 1188.700748 m 8.0000 235 | 4/8
15 h-m-p 1.6000 8.0000 4.6862 ++ 1188.608794 m 8.0000 246 | 4/8
16 h-m-p 1.6000 8.0000 14.3903 ++ 1188.547938 m 8.0000 257 | 4/8
17 h-m-p 1.6000 8.0000 22.7682 ++ 1188.527633 m 8.0000 268 | 4/8
18 h-m-p 1.6000 8.0000 63.3046 ++ 1188.514957 m 8.0000 279 | 4/8
19 h-m-p 0.2983 1.4916 110.5453 ++ 1188.513476 m 1.4916 290 | 5/8
20 h-m-p 0.4084 5.8330 118.4843 ++ 1188.511928 m 5.8330 301 | 6/8
21 h-m-p 1.2177 8.0000 0.0001 CC 1188.511295 1 1.0014 314 | 6/8
22 h-m-p 1.6000 8.0000 0.0000 Y 1188.511295 0 3.2563 327
Out..
lnL = -1188.511295
328 lfun, 328 eigenQcodon, 1968 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.063603 0.096020 0.053170 0.032644 0.016670 0.032035 999.000000 0.563886 0.287576
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.025337
np = 9
lnL0 = -1266.728236
Iterating by ming2
Initial: fx= 1266.728236
x= 0.06360 0.09602 0.05317 0.03264 0.01667 0.03203 951.42857 0.56389 0.28758
1 h-m-p 0.0000 0.0001 663.2536 ++ 1240.788869 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 385945.3481 ++ 1221.843620 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0001 410.2213 +YCYYCYCYC 1211.879721 8 0.0001 50 | 2/9
4 h-m-p 0.0000 0.0001 451.9996 ++ 1199.507712 m 0.0001 62 | 3/9
5 h-m-p 0.0000 0.0000 34649.7978 ++ 1189.941069 m 0.0000 74 | 4/9
6 h-m-p 0.0204 0.1019 0.8283 CYCCC 1189.784228 4 0.0335 93 | 4/9
7 h-m-p 0.0273 0.5661 1.0148 ++YC 1189.385614 1 0.4973 113 | 4/9
8 h-m-p 0.0576 0.2879 0.2138 ++ 1189.344865 m 0.2879 125 | 5/9
9 h-m-p 0.0057 0.0917 9.4762 +YYCYCYC 1189.188228 6 0.0447 151 | 5/9
10 h-m-p 1.6000 8.0000 0.0080 YCC 1189.174050 2 3.1225 166 | 5/9
11 h-m-p 1.1776 8.0000 0.0213 CC 1189.169570 1 1.8470 184 | 5/9
12 h-m-p 1.1307 8.0000 0.0348 CYC 1189.162593 2 1.5536 203 | 5/9
13 h-m-p 1.6000 8.0000 0.0009 Y 1189.162555 0 1.1134 219 | 5/9
14 h-m-p 1.6000 8.0000 0.0003 Y 1189.162555 0 1.0022 235 | 5/9
15 h-m-p 1.6000 8.0000 0.0001 C 1189.162555 0 0.4253 251 | 5/9
16 h-m-p 0.6936 8.0000 0.0000 Y 1189.162555 0 0.1264 267
Out..
lnL = -1189.162555
268 lfun, 804 eigenQcodon, 3216 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.050083 0.074267 0.093058 0.052254 0.057151 0.072864 951.428650 1.244432 0.353988 0.262548 1118.498245
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000163
np = 11
lnL0 = -1225.393776
Iterating by ming2
Initial: fx= 1225.393776
x= 0.05008 0.07427 0.09306 0.05225 0.05715 0.07286 951.42865 1.24443 0.35399 0.26255 951.42857
1 h-m-p 0.0000 0.0012 93.0854 ++++ 1207.836973 m 0.0012 18 | 1/11
2 h-m-p 0.0022 0.0112 27.7063 ++ 1200.268330 m 0.0112 32 | 2/11
3 h-m-p 0.0000 0.0000 16291.6665 ++ 1196.686019 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0000 3692.6772 ++ 1196.604676 m 0.0000 60 | 4/11
5 h-m-p 0.0000 0.0011 364.4472 +++YCYYCYYYC 1186.790218 8 0.0011 88 | 4/11
6 h-m-p 0.0002 0.0011 62.1831 C 1186.788908 0 0.0001 102 | 4/11
7 h-m-p 0.0072 1.1087 0.4743 +++YCYYYCC 1186.015218 6 0.7368 127 | 4/11
8 h-m-p 0.8063 7.3533 0.4334 ++ 1184.447531 m 7.3533 148 | 5/11
9 h-m-p 0.7863 3.9313 1.2440 YCCC 1184.324960 3 0.3943 174 | 5/11
10 h-m-p 1.6000 8.0000 0.0050 CYCCC 1184.264533 4 3.4827 195 | 5/11
11 h-m-p 0.1187 6.1823 0.1473 +YCC 1184.251317 2 1.0152 219 | 5/11
12 h-m-p 1.6000 8.0000 0.0528 C 1184.250092 0 0.4000 239 | 5/11
13 h-m-p 1.6000 8.0000 0.0073 YC 1184.250055 1 0.9220 260 | 5/11
14 h-m-p 1.6000 8.0000 0.0023 C 1184.250051 0 1.9075 280 | 5/11
15 h-m-p 1.6000 8.0000 0.0022 ++ 1184.250022 m 8.0000 300 | 5/11
16 h-m-p 0.0486 8.0000 0.3586 +++YC 1184.249506 1 2.0010 324 | 5/11
17 h-m-p 1.6000 8.0000 0.2005 +YC 1184.248775 1 4.6297 346 | 5/11
18 h-m-p 1.6000 8.0000 0.3890 YC 1184.248516 1 3.2925 367 | 5/11
19 h-m-p 1.6000 8.0000 0.4311 C 1184.248411 0 2.2648 387 | 5/11
20 h-m-p 1.6000 8.0000 0.4743 +YC 1184.248336 1 4.2978 409 | 5/11
21 h-m-p 1.6000 8.0000 1.0922 +Y 1184.248214 0 5.0738 430 | 5/11
22 h-m-p 1.1718 8.0000 4.7292 ++ 1184.247198 m 8.0000 444 | 5/11
23 h-m-p 0.0176 0.0878 575.6468 ++ 1184.245944 m 0.0878 458 | 5/11
24 h-m-p -0.0000 -0.0000 1464.5586
h-m-p: -0.00000000e+00 -0.00000000e+00 1.46455861e+03 1184.245944
.. | 5/11
25 h-m-p 0.0000 0.0125 0.7127 C 1184.245938 0 0.0000 483 | 5/11
26 h-m-p 0.0160 8.0000 0.1013 ----C 1184.245938 0 0.0000 507 | 5/11
27 h-m-p 0.0160 8.0000 0.0063 +++C 1184.245911 0 1.3274 530 | 5/11
28 h-m-p 1.6000 8.0000 0.0002 C 1184.245911 0 1.6104 550 | 5/11
29 h-m-p 0.9806 8.0000 0.0003 ++ 1184.245911 m 8.0000 570 | 5/11
30 h-m-p 0.0160 8.0000 0.1747 +++Y 1184.245882 0 2.0462 593 | 5/11
31 h-m-p 1.6000 8.0000 0.1787 ++ 1184.245644 m 8.0000 613 | 5/11
32 h-m-p 0.0030 0.0637 481.9951 +++ 1184.240677 m 0.0637 634 | 6/11
33 h-m-p 1.6000 8.0000 0.1078 Y 1184.240640 0 1.0671 648 | 6/11
34 h-m-p 0.3228 8.0000 0.3564 C 1184.240639 0 0.5082 667 | 6/11
35 h-m-p 1.3162 8.0000 0.1376 Y 1184.240637 0 2.6691 686 | 6/11
36 h-m-p 1.3351 8.0000 0.2750 ++ 1184.240624 m 8.0000 705 | 6/11
37 h-m-p 0.0219 0.4322 100.6263 +++ 1184.240409 m 0.4322 725 | 7/11
38 h-m-p 1.1668 8.0000 0.0046 C 1184.240392 0 1.0053 739 | 7/11
39 h-m-p 1.6000 8.0000 0.0000 -----------N 1184.240392 0 0.0000 768
Out..
lnL = -1184.240392
769 lfun, 3076 eigenQcodon, 13842 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1188.805214 S = -1185.606126 -4.982455
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:05
did 20 / 57 patterns 0:05
did 30 / 57 patterns 0:05
did 40 / 57 patterns 0:05
did 50 / 57 patterns 0:05
did 57 / 57 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.053098 0.031592 0.070388 0.075141 0.041131 0.083018 999.000000 0.848598 1.049447
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.029644
np = 9
lnL0 = -1283.208053
Iterating by ming2
Initial: fx= 1283.208053
x= 0.05310 0.03159 0.07039 0.07514 0.04113 0.08302 951.42857 0.84860 1.04945
1 h-m-p 0.0000 0.0001 666.7724 ++ 1232.431171 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 424.9884 +YCYYCYYCCC 1218.844284 9 0.0001 41 | 1/9
3 h-m-p 0.0000 0.0001 248.8550 +YYCYCC 1217.724418 5 0.0000 61 | 1/9
4 h-m-p 0.0004 0.0314 27.8874 +++YYCYCC 1217.396751 5 0.0185 83 | 1/9
5 h-m-p 0.0019 0.0094 19.2751 ------------.. | 1/9
6 h-m-p 0.0000 0.0001 507.0135 ++ 1207.029751 m 0.0001 117 | 1/9
7 h-m-p 0.0000 0.0000 26613.3303 ++ 1199.265481 m 0.0000 129 | 2/9
8 h-m-p 0.0000 0.0000 112745.2840 ++ 1198.081911 m 0.0000 141 | 2/9
9 h-m-p -0.0000 -0.0000 35284.6317
h-m-p: -0.00000000e+00 -0.00000000e+00 3.52846317e+04 1198.081911
.. | 2/9
10 h-m-p 0.0000 0.0000 236610.5387 CYYCYYCCC 1192.348339 8 0.0000 176 | 2/9
11 h-m-p 0.0000 0.0000 851.4824 ++ 1191.486745 m 0.0000 188 | 3/9
12 h-m-p 0.0000 0.0000 349.5936 ++ 1189.793810 m 0.0000 200 | 4/9
13 h-m-p 0.0006 0.2854 1.3972 ++YCCC 1189.759152 3 0.0065 219 | 4/9
14 h-m-p 0.0268 2.8129 0.3386 ++++ 1189.163370 m 2.8129 233 | 4/9
15 h-m-p 0.0000 0.0000 0.0026
h-m-p: 3.93496876e-16 1.96748438e-15 2.64331862e-03 1189.163370
.. | 4/9
16 h-m-p 0.0029 1.4461 9.9976 ---C 1189.162832 0 0.0000 267 | 4/9
17 h-m-p 0.0055 0.1646 0.0204 -----Y 1189.162832 0 0.0000 284 | 4/9
18 h-m-p 0.0033 1.6261 0.0001 +++Y 1189.162831 0 0.4985 304 | 4/9
19 h-m-p 0.2503 1.2516 0.0001 ++ 1189.162831 m 1.2516 321 | 4/9
20 h-m-p -0.0000 -0.0000 0.0001
h-m-p: -0.00000000e+00 -0.00000000e+00 9.80930911e-05 1189.162831
.. | 4/9
21 h-m-p 0.0001 0.0261 0.1823 C 1189.162831 0 0.0000 352 | 4/9
22 h-m-p 0.0421 2.2488 0.0001 Y 1189.162831 0 0.1046 369 | 4/9
23 h-m-p 0.0000 0.0002 0.6637 Y 1189.162831 0 0.0000 386 | 4/9
24 h-m-p 0.0583 5.8181 0.0000 ---C 1189.162831 0 0.0002 406 | 4/9
25 h-m-p 0.0038 1.9117 0.0001 -Y 1189.162831 0 0.0002 424
Out..
lnL = -1189.162831
425 lfun, 4675 eigenQcodon, 25500 P(t)
Time used: 0:12
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.035325 0.101681 0.046211 0.037057 0.079217 0.067021 951.428596 0.900000 0.236619 1.254252 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000276
np = 11
lnL0 = -1211.312678
Iterating by ming2
Initial: fx= 1211.312678
x= 0.03533 0.10168 0.04621 0.03706 0.07922 0.06702 951.42860 0.90000 0.23662 1.25425 951.42857
1 h-m-p 0.0000 0.0005 210.7673 ++CYYCYYYYYY 1194.706198 10 0.0004 29 | 0/11
2 h-m-p 0.0005 0.0026 26.0986 +YCYCCC 1193.646774 5 0.0022 52 | 0/11
3 h-m-p 0.0001 0.0006 49.6351 ++ 1192.566690 m 0.0006 66 | 1/11
4 h-m-p 0.0000 0.0001 427.9632 YCYCCC 1192.390503 5 0.0000 88 | 1/11
5 h-m-p 0.0002 0.0012 33.0726 YCYCCC 1192.176780 5 0.0007 111 | 1/11
6 h-m-p 0.0002 0.0010 36.9658 YCYCYC 1191.977867 5 0.0006 133 | 0/11
7 h-m-p 0.0000 0.0000 960.6307 ++ 1191.820530 m 0.0000 147 | 0/11
8 h-m-p 0.0000 0.0000 9.7932
h-m-p: 1.62711254e-20 8.13556269e-20 9.79323212e+00 1191.820530
.. | 0/11
9 h-m-p 0.0000 0.0000 718.5433 ++ 1189.234308 m 0.0000 172 | 1/11
10 h-m-p 0.0000 0.0000 188.6740 ++ 1188.602593 m 0.0000 186 | 2/11
11 h-m-p 0.0000 0.0001 250.2027 +YYYYYC 1187.848197 5 0.0000 206 | 2/11
12 h-m-p 0.0001 0.0006 36.9840 ++ 1186.377236 m 0.0006 220 | 3/11
13 h-m-p 0.0000 0.0002 75.4688 ++ 1186.011052 m 0.0002 234 | 4/11
14 h-m-p 0.0016 0.0080 2.8393 +YCYCCC 1185.729676 5 0.0049 258 | 4/11
15 h-m-p 0.0053 0.0746 2.5885 ++ 1185.448230 m 0.0746 272 | 5/11
16 h-m-p 0.0733 0.3663 0.2507 +YYYYYYYC 1184.588634 7 0.2912 294 | 5/11
17 h-m-p 0.0372 8.0000 1.9642 --------------.. | 5/11
18 h-m-p 0.0000 0.0002 189.6933 YYCCC 1184.362577 4 0.0000 346 | 5/11
19 h-m-p 0.0000 0.0001 67.2817 CYCCC 1184.283538 4 0.0000 367 | 5/11
20 h-m-p 0.0000 0.0002 34.3967 YCCCC 1184.263893 4 0.0000 388 | 5/11
21 h-m-p 1.0342 5.1711 0.0011 YYY 1184.250517 2 1.0342 404 | 5/11
22 h-m-p 1.6000 8.0000 0.0002 CC 1184.248774 1 1.9810 426 | 5/11
23 h-m-p 1.4704 8.0000 0.0003 YC 1184.248469 1 0.8685 447 | 5/11
24 h-m-p 1.6000 8.0000 0.0002 Y 1184.248468 0 0.9448 467 | 5/11
25 h-m-p 0.8878 8.0000 0.0002 ++ 1184.248468 m 8.0000 487 | 5/11
26 h-m-p 0.6624 8.0000 0.0021 ++ 1184.248466 m 8.0000 507 | 5/11
27 h-m-p 0.0428 8.0000 0.3957 +++Y 1184.248397 0 2.1949 530 | 5/11
28 h-m-p 1.6000 8.0000 0.4276 ++ 1184.247810 m 8.0000 550 | 5/11
29 h-m-p 0.0078 0.0988 438.1678 ++ 1184.240728 m 0.0988 570 | 6/11
30 h-m-p 0.8677 4.9248 1.6525 Y 1184.240658 0 0.6428 584 | 6/11
31 h-m-p 1.6000 8.0000 0.6406 Y 1184.240642 0 0.6471 598 | 6/11
32 h-m-p 1.6000 8.0000 0.0789 ++ 1184.240640 m 8.0000 617 | 6/11
33 h-m-p 0.1649 8.0000 3.8273 +
QuantileBeta(0.15, 0.00500, 3.39716) = 7.072839e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 7.21726) = 3.064061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48274) = 6.871927e-161 2000 rounds
C 1184.240615 0 2.7588 638
QuantileBeta(0.15, 0.00500, 3.48274) = 6.871927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48274) = 6.871927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48274) = 6.871927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48274) = 6.871927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48274) = 6.871927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48274) = 6.871927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48274) = 6.871927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48274) = 6.871927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48274) = 7.111823e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48274) = 6.871922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48274) = 6.871927e-161 2000 rounds
| 6/11
34 h-m-p 1.3190 6.5952 5.5038
QuantileBeta(0.15, 0.00500, 4.83431) = 4.741617e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.88903) = 2.454443e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 10.24060) = 2.114282e-161 2000 rounds
+ 1184.240414 m 6.5952 652
QuantileBeta(0.15, 0.00500, 10.24060) = 2.114282e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24060) = 2.114282e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24060) = 2.114282e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24060) = 2.114282e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24060) = 2.114282e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24060) = 2.114282e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24060) = 2.114282e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24060) = 2.114282e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24060) = 2.188091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24061) = 2.114281e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24060) = 2.114282e-161 2000 rounds
| 7/11
35 h-m-p 0.2811 3.6919 24.0418
QuantileBeta(0.15, 0.00500, 16.99847) = 1.248747e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 37.27206) = 4.514761e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 34.81862) = 4.837477e-162 2000 rounds
C 1184.240392 0 1.0223 667
QuantileBeta(0.15, 0.00500, 34.81862) = 4.837477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.81862) = 4.837477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.81862) = 4.837477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.81862) = 4.837477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.81862) = 4.837477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.81862) = 4.837477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.81862) = 4.837477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.81862) = 4.837477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.81862) = 5.002901e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.81863) = 4.837474e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.81862) = 4.837477e-162 2000 rounds
| 7/11
36 h-m-p 1.6000 8.0000 0.6923
QuantileBeta(0.15, 0.00500, 33.71093) = 4.998798e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.38786) = 6.894442e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.02775) = 4.951569e-162 2000 rounds
Y 1184.240392 0 1.1424 681
QuantileBeta(0.15, 0.00500, 34.02775) = 4.951569e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.02775) = 4.951569e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.02775) = 4.951569e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.02775) = 4.951569e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.02775) = 4.951569e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.02775) = 4.951569e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.02775) = 4.951569e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.02775) = 4.951569e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.02775) = 4.951569e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.02775) = 4.951569e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.02775) = 4.951569e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.02775) = 5.120895e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.02835) = 4.951480e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.02714) = 4.951659e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.02775) = 4.951569e-162 2000 rounds
| 7/11
37 h-m-p 1.6000 8.0000 0.4245
QuantileBeta(0.15, 0.00500, 33.34857) = 5.053931e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.85795) = 4.976769e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.98530) = 4.957845e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97315) = 4.959644e-162 2000 rounds
C 1184.240392 0 0.1286 700
QuantileBeta(0.15, 0.00500, 33.97315) = 4.959644e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97315) = 4.959644e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97315) = 4.959644e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97315) = 4.959644e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97315) = 4.959644e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97315) = 4.959644e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97315) = 4.959644e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97315) = 4.959644e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97315) = 4.959644e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97315) = 4.959644e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97315) = 4.959644e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97315) = 5.129246e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97376) = 4.959554e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97255) = 4.959734e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97315) = 4.959644e-162 2000 rounds
| 7/11
38 h-m-p 0.1622 8.0000 0.3366
QuantileBeta(0.15, 0.00500, 33.91856) = 4.967745e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.95950) = 4.961667e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.96974) = 4.960149e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97230) = 4.959770e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97294) = 4.959675e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97310) = 4.959652e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97309) = 4.959652e-162 2000 rounds
C 1184.240392 0 0.0002 722
QuantileBeta(0.15, 0.00500, 33.97310) = 4.959652e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97310) = 4.959652e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97310) = 4.959652e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97310) = 4.959652e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97310) = 4.959652e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97310) = 4.959652e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97310) = 4.959652e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97310) = 4.959652e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97310) = 4.959652e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97310) = 4.959652e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97310) = 4.959652e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97310) = 5.129254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97370) = 4.959562e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97249) = 4.959741e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97310) = 4.959652e-162 2000 rounds
| 7/11
39 h-m-p 0.0160 8.0000 0.2056
QuantileBeta(0.15, 0.00500, 33.96981) = 4.960139e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97227) = 4.959774e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97298) = 4.959669e-162 2000 rounds
Y 1184.240392 0 0.0010 741
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 5.129286e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97350) = 4.959593e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97229) = 4.959772e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
| 7/11
40 h-m-p 0.0160 8.0000 0.0265
QuantileBeta(0.15, 0.00500, 33.97247) = 4.959745e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97279) = 4.959698e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97287) = 4.959686e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97288) = 4.959683e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
N 1184.240392 0 0.0001 762
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 5.129286e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97350) = 4.959593e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97228) = 4.959772e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
| 7/11
41 h-m-p 0.0160 8.0000 0.0904
QuantileBeta(0.15, 0.00500, 33.97434) = 4.959468e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97325) = 4.959629e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
Y 1184.240392 0 0.0026 780
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 5.129249e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97373) = 4.959557e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97252) = 4.959737e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
| 7/11
42 h-m-p 0.0428 8.0000 0.0056
QuantileBeta(0.15, 0.00500, 33.97289) = 4.959682e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97307) = 4.959656e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97311) = 4.959649e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97312) = 4.959648e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
C 1184.240392 0 0.0002 801
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 5.129249e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97373) = 4.959558e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97252) = 4.959737e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
| 7/11
43 h-m-p 0.0160 8.0000 0.0056
QuantileBeta(0.15, 0.00500, 33.97304) = 4.959660e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97311) = 4.959651e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97312) = 4.959648e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
C 1184.240392 0 0.0001 822
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 5.129249e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97373) = 4.959558e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97252) = 4.959737e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
| 7/11
44 h-m-p 0.0028 1.4035 18.4434
QuantileBeta(0.15, 0.00500, 34.02490) = 4.951990e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.98607) = 4.957731e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97636) = 4.959168e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97394) = 4.959527e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97333) = 4.959617e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97318) = 4.959640e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97317) = 4.959642e-162 2000 rounds
Y 1184.240392 0 0.0000 844
QuantileBeta(0.15, 0.00500, 33.97318) = 4.959640e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97318) = 4.959640e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97318) = 4.959640e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97318) = 4.959640e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97318) = 4.959640e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97318) = 4.959640e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97318) = 4.959640e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97318) = 4.959640e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97318) = 5.129242e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97319) = 4.959637e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97318) = 4.959640e-162 2000 rounds
| 7/11
45 h-m-p 0.1306 8.0000 0.0004
QuantileBeta(0.15, 0.00500, 33.97313) = 4.959647e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97298) = 4.959670e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 33.97237) = 4.959760e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 33.97008) = 4.960098e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959788e-162 2000 rounds
C 1184.240392 0 2.5796 860
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959788e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959788e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959788e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959788e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959788e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959788e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959788e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959788e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959788e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959788e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959788e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97218) = 5.129395e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97278) = 4.959698e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97157) = 4.959877e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959788e-162 2000 rounds
| 7/11
46 h-m-p 1.6000 8.0000 0.0006
QuantileBeta(0.15, 0.00500, 33.97317) = 4.959640e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97243) = 4.959751e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97224) = 4.959778e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97220) = 4.959785e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959787e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959787e-162 2000 rounds
C 1184.240392 0 0.0063 881
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959787e-162 2000 rounds
Out..
lnL = -1184.240392
882 lfun, 10584 eigenQcodon, 58212 P(t)
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959787e-162 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1188.732559 S = -1185.606128 -4.374797
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:28
did 20 / 57 patterns 0:29
did 30 / 57 patterns 0:29
did 40 / 57 patterns 0:29
did 50 / 57 patterns 0:29
did 57 / 57 patterns 0:29
QuantileBeta(0.15, 0.00500, 33.97218) = 4.959787e-162 2000 rounds
Time used: 0:29
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=297
NC_011896_1_WP_010907867_1_700_MLBR_RS03320 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
NC_002677_1_NP_301543_1_415_ftsX VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS
**************************************************
NC_011896_1_WP_010907867_1_700_MLBR_RS03320 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
NC_002677_1_NP_301543_1_415_ftsX IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730 IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ
**************************************************
NC_011896_1_WP_010907867_1_700_MLBR_RS03320 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
NC_002677_1_NP_301543_1_415_ftsX DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730 DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL
**************************************************
NC_011896_1_WP_010907867_1_700_MLBR_RS03320 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
NC_002677_1_NP_301543_1_415_ftsX SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR
NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR
NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730 SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR
*********************************************.****
NC_011896_1_WP_010907867_1_700_MLBR_RS03320 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
NC_002677_1_NP_301543_1_415_ftsX TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730 TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA
**************************************************
NC_011896_1_WP_010907867_1_700_MLBR_RS03320 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
NC_002677_1_NP_301543_1_415_ftsX LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730 LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
***********************************************
>NC_011896_1_WP_010907867_1_700_MLBR_RS03320 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG >NC_002677_1_NP_301543_1_415_ftsX GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG >NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGTCTATACGCGGCGC ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG >NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGTCTATACGCGGCGC ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG >NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG >NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730 GTGCGCTTCGGCTTTCTGCTCAACGAGGTTGTGACTGGCCTCCGTCGCAA TGTCACGATGACGATAGCGATGATCTTGACGACCGCGATCTCGATTGGCT TGTTTGGTGGCGGGCTGCTGGTGGTCCGGTTGGCCGACAACTCCCGAAGC ATCTACCTGGATCGAGTCGAGACACAGGTCTTTCTCACCGATGACATCTC CGCCAACGATCTGACCTGCAACACAAACTTGTGTAAGGCGCTTCGGGGAA AGATCGAAGCTCGAGATGACGTCAAATCCTTACGGTTCCTTAACCGTCAG GACGCTTACGACGACGCTATCCGAAAATTCCCGCAGTACAGGGATGTTGC GGGCAAGGATTCTTTCCCCGCTTCGTTCATCATCAAGCTAGCTAACCCCG TTCAACACAAGGAATTTGACGCCGCGACGCAGGGCCAGCCCGGGGTGCTT TCCGTGCTCAATCAGAAGGAACTGATCGACCGTCTGTTCGCCGTGTTGGA CGGTTTGAGCGACGTCGCGTTCGTCATAGCTTTAGTGCAGGCTATCGGAG CAATCCTGCTAATTGCCAATATGGTTCAAGTCGCGGCCTATACGCGGCGC ACCGAGATCGGCATCATGCGACTGGTCGGCGCCAGCCGCTGGTATACTCA ACTTCCTTTTTTGCTGGAGGCAATGGTGGCTGCGACCGTAGGCGCCGTCA TCGCGATCGTTGGTCTGCTTGTGGCGCGAGCAATGTTTTTGAACAATGCA CTGAACCAGTTCTATCAAGCTAATCTGATTGCCCGGGTCGATTATGCCGA TGTCCTGTACGTTTCCCCGTGGTTGTTGTTGCTCGGCGTGGCGTTGGCCG CGTTGACCGGTTACGCAACATTGCGCATTTACGTGCGACGG
>NC_011896_1_WP_010907867_1_700_MLBR_RS03320 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR >NC_002677_1_NP_301543_1_415_ftsX VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR >NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR >NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAVYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR >NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR >NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730 VRFGFLLNEVVTGLRRNVTMTIAMILTTAISIGLFGGGLLVVRLADNSRS IYLDRVETQVFLTDDISANDLTCNTNLCKALRGKIEARDDVKSLRFLNRQ DAYDDAIRKFPQYRDVAGKDSFPASFIIKLANPVQHKEFDAATQGQPGVL SVLNQKELIDRLFAVLDGLSDVAFVIALVQAIGAILLIANMVQVAAYTRR TEIGIMRLVGASRWYTQLPFLLEAMVAATVGAVIAIVGLLVARAMFLNNA LNQFYQANLIARVDYADVLYVSPWLLLLGVALAALTGYATLRIYVRR
#NEXUS
[ID: 0330019407]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907867_1_700_MLBR_RS03320
NC_002677_1_NP_301543_1_415_ftsX
NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415
NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360
NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655
NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907867_1_700_MLBR_RS03320,
2 NC_002677_1_NP_301543_1_415_ftsX,
3 NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415,
4 NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360,
5 NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655,
6 NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06391721,2:0.06577569,3:0.07420869,4:0.07052829,5:0.06344421,6:0.06292875);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06391721,2:0.06577569,3:0.07420869,4:0.07052829,5:0.06344421,6:0.06292875);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1241.11 -1244.02
2 -1241.10 -1244.44
--------------------------------------
TOTAL -1241.10 -1244.25
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/ftsX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.883563 0.090213 0.339266 1.458836 0.853578 1459.78 1480.39 1.000
r(A<->C){all} 0.159357 0.018953 0.000152 0.435069 0.127730 227.42 259.16 1.000
r(A<->G){all} 0.175886 0.022400 0.000023 0.481242 0.137223 156.88 226.35 1.005
r(A<->T){all} 0.176030 0.021145 0.000009 0.463421 0.139570 214.01 270.21 1.003
r(C<->G){all} 0.148266 0.018592 0.000041 0.435925 0.106179 133.08 234.94 1.005
r(C<->T){all} 0.188184 0.024711 0.000042 0.488147 0.149998 199.79 271.48 1.000
r(G<->T){all} 0.152276 0.017988 0.000007 0.421353 0.113307 187.90 261.27 1.008
pi(A){all} 0.192414 0.000171 0.168058 0.218645 0.192280 1333.60 1417.30 1.002
pi(C){all} 0.273708 0.000221 0.244906 0.302453 0.273287 1328.43 1355.23 1.000
pi(G){all} 0.281420 0.000223 0.250556 0.308676 0.281219 1096.23 1213.99 1.000
pi(T){all} 0.252458 0.000204 0.225635 0.281342 0.252063 1187.39 1229.84 1.000
alpha{1,2} 0.396227 0.181071 0.000142 1.298777 0.246990 989.97 1100.13 1.000
alpha{3} 0.416430 0.222341 0.000114 1.389022 0.249504 1183.56 1257.68 1.000
pinvar{all} 0.996541 0.000010 0.990967 0.999935 0.997396 1215.57 1290.70 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/2res/ftsX/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 297
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 6 6 6 6 6 6 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 1 1 1 1 1 1
TTC 8 8 8 8 8 8 | TCC 5 5 5 5 5 5 | TAC 6 6 6 6 6 6 | TGC 1 1 1 1 1 1
Leu TTA 2 2 2 2 2 2 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 14 14 14 14 14 14 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 5 5 5 5 5 5 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 3 3 3 3 3 3
CTC 5 5 5 5 5 5 | CCC 3 3 3 3 3 3 | CAC 1 1 1 1 1 1 | CGC 5 5 5 5 5 5
CTA 2 2 2 2 2 2 | CCA 0 0 0 0 0 0 | Gln CAA 4 4 4 4 4 4 | CGA 7 7 7 7 7 7
CTG 14 14 14 14 14 14 | CCG 2 2 2 2 2 2 | CAG 8 8 8 8 8 8 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 2 2 2 2 2 2 | Asn AAT 5 5 5 5 5 5 | Ser AGT 0 0 0 0 0 0
ATC 15 15 15 15 15 15 | ACC 6 6 6 6 6 6 | AAC 9 9 9 9 9 9 | AGC 3 3 3 3 3 3
ATA 2 2 2 2 2 2 | ACA 3 3 3 3 3 3 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 6 6 6 6 6 6 | ACG 5 5 5 5 5 5 | AAG 6 6 6 6 6 6 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 6 6 6 6 6 6 | Ala GCT 9 9 9 9 9 9 | Asp GAT 8 8 8 8 8 8 | Gly GGT 4 4 4 4 4 4
GTC 12 12 13 13 12 12 | GCC 11 11 10 10 11 11 | GAC 10 10 10 10 10 10 | GGC 10 10 10 10 10 10
GTA 1 1 1 1 1 1 | GCA 5 5 5 5 5 5 | Glu GAA 3 3 3 3 3 3 | GGA 2 2 2 2 2 2
GTG 11 11 11 11 11 11 | GCG 12 12 12 12 12 12 | GAG 4 4 4 4 4 4 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907867_1_700_MLBR_RS03320
position 1: T:0.17508 C:0.22222 A:0.23232 G:0.37037
position 2: T:0.38047 C:0.22559 A:0.23569 G:0.15825
position 3: T:0.19865 C:0.37037 A:0.11111 G:0.31987
Average T:0.25140 C:0.27273 A:0.19304 G:0.28283
#2: NC_002677_1_NP_301543_1_415_ftsX
position 1: T:0.17508 C:0.22222 A:0.23232 G:0.37037
position 2: T:0.38047 C:0.22559 A:0.23569 G:0.15825
position 3: T:0.19865 C:0.37037 A:0.11111 G:0.31987
Average T:0.25140 C:0.27273 A:0.19304 G:0.28283
#3: NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415
position 1: T:0.17508 C:0.22222 A:0.23232 G:0.37037
position 2: T:0.38384 C:0.22222 A:0.23569 G:0.15825
position 3: T:0.19865 C:0.37037 A:0.11111 G:0.31987
Average T:0.25253 C:0.27160 A:0.19304 G:0.28283
#4: NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360
position 1: T:0.17508 C:0.22222 A:0.23232 G:0.37037
position 2: T:0.38384 C:0.22222 A:0.23569 G:0.15825
position 3: T:0.19865 C:0.37037 A:0.11111 G:0.31987
Average T:0.25253 C:0.27160 A:0.19304 G:0.28283
#5: NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655
position 1: T:0.17508 C:0.22222 A:0.23232 G:0.37037
position 2: T:0.38047 C:0.22559 A:0.23569 G:0.15825
position 3: T:0.19865 C:0.37037 A:0.11111 G:0.31987
Average T:0.25140 C:0.27273 A:0.19304 G:0.28283
#6: NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730
position 1: T:0.17508 C:0.22222 A:0.23232 G:0.37037
position 2: T:0.38047 C:0.22559 A:0.23569 G:0.15825
position 3: T:0.19865 C:0.37037 A:0.11111 G:0.31987
Average T:0.25140 C:0.27273 A:0.19304 G:0.28283
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 36 | Ser S TCT 6 | Tyr Y TAT 24 | Cys C TGT 6
TTC 48 | TCC 30 | TAC 36 | TGC 6
Leu L TTA 12 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 84 | TCG 12 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 30 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 18
CTC 30 | CCC 18 | CAC 6 | CGC 30
CTA 12 | CCA 0 | Gln Q CAA 24 | CGA 42
CTG 84 | CCG 12 | CAG 48 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 12 | Asn N AAT 30 | Ser S AGT 0
ATC 90 | ACC 36 | AAC 54 | AGC 18
ATA 12 | ACA 18 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 36 | ACG 30 | AAG 36 | AGG 6
------------------------------------------------------------------------------
Val V GTT 36 | Ala A GCT 54 | Asp D GAT 48 | Gly G GGT 24
GTC 74 | GCC 64 | GAC 60 | GGC 60
GTA 6 | GCA 30 | Glu E GAA 18 | GGA 12
GTG 66 | GCG 72 | GAG 24 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17508 C:0.22222 A:0.23232 G:0.37037
position 2: T:0.38159 C:0.22447 A:0.23569 G:0.15825
position 3: T:0.19865 C:0.37037 A:0.11111 G:0.31987
Average T:0.25178 C:0.27235 A:0.19304 G:0.28283
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 8): -1188.511295 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.003482 0.003482 0.000004 0.000004 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006981
(1: 0.000004, 2: 0.000004, 3: 0.003482, 4: 0.003482, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907867_1_700_MLBR_RS03320: 0.000004, NC_002677_1_NP_301543_1_415_ftsX: 0.000004, NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415: 0.003482, NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360: 0.003482, NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655: 0.000004, NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 616.7 274.3 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 616.7 274.3 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.003 616.7 274.3 999.0000 0.0017 0.0000 1.0 0.0
7..4 0.003 616.7 274.3 999.0000 0.0017 0.0000 1.0 0.0
7..5 0.000 616.7 274.3 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 616.7 274.3 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0034
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 9): -1189.162555 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.003360 0.003360 0.000004 0.000004 951.428650 0.516281 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006736
(1: 0.000004, 2: 0.000004, 3: 0.003360, 4: 0.003360, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907867_1_700_MLBR_RS03320: 0.000004, NC_002677_1_NP_301543_1_415_ftsX: 0.000004, NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415: 0.003360, NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360: 0.003360, NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655: 0.000004, NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42865
MLEs of dN/dS (w) for site classes (K=2)
p: 0.51628 0.48372
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 616.7 274.3 0.4837 0.0000 0.0000 0.0 0.0
7..2 0.000 616.7 274.3 0.4837 0.0000 0.0000 0.0 0.0
7..3 0.003 616.7 274.3 0.4837 0.0008 0.0017 0.5 0.5
7..4 0.003 616.7 274.3 0.4837 0.0008 0.0017 0.5 0.5
7..5 0.000 616.7 274.3 0.4837 0.0000 0.0000 0.0 0.0
7..6 0.000 616.7 274.3 0.4837 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 11): -1184.240392 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.003735 0.003735 0.000004 0.000004 999.000000 0.993916 0.000000 0.000001 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.007487
(1: 0.000004, 2: 0.000004, 3: 0.003735, 4: 0.003735, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907867_1_700_MLBR_RS03320: 0.000004, NC_002677_1_NP_301543_1_415_ftsX: 0.000004, NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415: 0.003735, NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360: 0.003735, NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655: 0.000004, NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99392 0.00000 0.00608
w: 0.00000 1.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 616.7 274.3 6.0776 0.0000 0.0000 0.0 0.0
7..2 0.000 616.7 274.3 6.0776 0.0000 0.0000 0.0 0.0
7..3 0.004 616.7 274.3 6.0776 0.0017 0.0003 1.0 0.1
7..4 0.004 616.7 274.3 6.0776 0.0017 0.0003 1.0 0.1
7..5 0.000 616.7 274.3 6.0776 0.0000 0.0000 0.0 0.0
7..6 0.000 616.7 274.3 6.0776 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320)
Pr(w>1) post mean +- SE for w
196 A 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320)
Pr(w>1) post mean +- SE for w
196 A 0.945 7.212 +- 2.751
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.103 0.102 0.101 0.101 0.100 0.099 0.099 0.098 0.098 0.098
w2: 0.019 0.035 0.054 0.074 0.094 0.112 0.130 0.146 0.161 0.174
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.004
0.008 0.006 0.004
0.011 0.009 0.008 0.005 0.004
0.012 0.011 0.011 0.009 0.008 0.005 0.004
0.012 0.012 0.012 0.011 0.011 0.009 0.008 0.005 0.004
0.012 0.012 0.013 0.012 0.012 0.012 0.011 0.010 0.008 0.005 0.003
0.012 0.012 0.012 0.013 0.013 0.013 0.012 0.012 0.011 0.010 0.008 0.005 0.003
0.011 0.012 0.012 0.012 0.013 0.013 0.013 0.013 0.013 0.012 0.011 0.010 0.009 0.005 0.003
0.010 0.011 0.011 0.012 0.012 0.012 0.013 0.013 0.013 0.013 0.013 0.012 0.011 0.010 0.009 0.005 0.003
0.010 0.010 0.010 0.011 0.011 0.012 0.012 0.013 0.013 0.013 0.013 0.013 0.013 0.012 0.012 0.010 0.009 0.005 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 9): -1189.162831 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.003362 0.003362 0.000004 0.000004 951.428596 0.005005 0.005098
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006740
(1: 0.000004, 2: 0.000004, 3: 0.003362, 4: 0.003362, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907867_1_700_MLBR_RS03320: 0.000004, NC_002677_1_NP_301543_1_415_ftsX: 0.000004, NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415: 0.003362, NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360: 0.003362, NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655: 0.000004, NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42860
Parameters in M7 (beta):
p = 0.00500 q = 0.00510
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 616.7 274.3 0.5000 0.0000 0.0000 0.0 0.0
7..2 0.000 616.7 274.3 0.5000 0.0000 0.0000 0.0 0.0
7..3 0.003 616.7 274.3 0.5000 0.0009 0.0017 0.5 0.5
7..4 0.003 616.7 274.3 0.5000 0.0009 0.0017 0.5 0.5
7..5 0.000 616.7 274.3 0.5000 0.0000 0.0000 0.0 0.0
7..6 0.000 616.7 274.3 0.5000 0.0000 0.0000 0.0 0.0
Time used: 0:12
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 11): -1184.240392 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.003735 0.003735 0.000004 0.000004 999.000000 0.993916 0.005000 33.972184 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.007487
(1: 0.000004, 2: 0.000004, 3: 0.003735, 4: 0.003735, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907867_1_700_MLBR_RS03320: 0.000004, NC_002677_1_NP_301543_1_415_ftsX: 0.000004, NZ_LVXE01000001_1_WP_064430262_1_86_A3216_RS00415: 0.003735, NZ_LYPH01000001_1_WP_064430262_1_74_A8144_RS00360: 0.003735, NZ_CP029543_1_WP_010907867_1_718_DIJ64_RS03655: 0.000004, NZ_AP014567_1_WP_010907867_1_733_JK2ML_RS03730: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
Parameters in M8 (beta&w>1):
p0 = 0.99392 p = 0.00500 q = 33.97218
(p1 = 0.00608) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09939 0.09939 0.09939 0.09939 0.09939 0.09939 0.09939 0.09939 0.09939 0.09939 0.00608
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 616.7 274.3 6.0775 0.0000 0.0000 0.0 0.0
7..2 0.000 616.7 274.3 6.0775 0.0000 0.0000 0.0 0.0
7..3 0.004 616.7 274.3 6.0775 0.0017 0.0003 1.0 0.1
7..4 0.004 616.7 274.3 6.0775 0.0017 0.0003 1.0 0.1
7..5 0.000 616.7 274.3 6.0775 0.0000 0.0000 0.0 0.0
7..6 0.000 616.7 274.3 6.0775 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320)
Pr(w>1) post mean +- SE for w
196 A 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320)
Pr(w>1) post mean +- SE for w
1 V 0.520 3.906 +- 3.746
2 R 0.521 3.914 +- 3.747
3 F 0.520 3.909 +- 3.747
4 G 0.520 3.909 +- 3.747
5 F 0.521 3.915 +- 3.748
6 L 0.521 3.917 +- 3.748
7 L 0.520 3.910 +- 3.747
8 N 0.520 3.909 +- 3.747
9 E 0.520 3.912 +- 3.747
10 V 0.520 3.912 +- 3.747
11 V 0.520 3.906 +- 3.746
12 T 0.520 3.912 +- 3.747
13 G 0.520 3.909 +- 3.747
14 L 0.520 3.910 +- 3.747
15 R 0.521 3.917 +- 3.748
16 R 0.521 3.914 +- 3.747
17 N 0.521 3.915 +- 3.748
18 V 0.519 3.904 +- 3.746
19 T 0.520 3.906 +- 3.746
20 M 0.519 3.902 +- 3.745
21 T 0.520 3.906 +- 3.746
22 I 0.520 3.908 +- 3.746
23 A 0.519 3.904 +- 3.746
24 M 0.519 3.902 +- 3.745
25 I 0.519 3.902 +- 3.745
26 L 0.521 3.918 +- 3.748
27 T 0.520 3.906 +- 3.746
28 T 0.519 3.904 +- 3.746
29 A 0.519 3.904 +- 3.746
30 I 0.519 3.902 +- 3.745
31 S 0.520 3.911 +- 3.747
32 I 0.520 3.911 +- 3.747
33 G 0.520 3.909 +- 3.747
34 L 0.521 3.918 +- 3.748
35 F 0.521 3.915 +- 3.748
36 G 0.521 3.915 +- 3.748
37 G 0.520 3.909 +- 3.747
38 G 0.520 3.911 +- 3.747
39 L 0.521 3.917 +- 3.748
40 L 0.521 3.917 +- 3.748
41 V 0.520 3.906 +- 3.746
42 V 0.519 3.904 +- 3.746
43 R 0.521 3.915 +- 3.748
44 L 0.521 3.918 +- 3.748
45 A 0.519 3.902 +- 3.745
46 D 0.520 3.910 +- 3.747
47 N 0.520 3.909 +- 3.747
48 S 0.520 3.910 +- 3.747
49 R 0.521 3.920 +- 3.749
50 S 0.520 3.910 +- 3.747
51 I 0.519 3.902 +- 3.745
52 Y 0.521 3.914 +- 3.747
53 L 0.521 3.917 +- 3.748
54 D 0.521 3.916 +- 3.748
55 R 0.521 3.920 +- 3.749
56 V 0.519 3.904 +- 3.746
57 E 0.520 3.912 +- 3.747
58 T 0.521 3.917 +- 3.748
59 Q 0.521 3.919 +- 3.748
60 V 0.519 3.904 +- 3.746
61 F 0.521 3.915 +- 3.748
62 L 0.520 3.910 +- 3.747
63 T 0.519 3.904 +- 3.746
64 D 0.521 3.916 +- 3.748
65 D 0.520 3.910 +- 3.747
66 I 0.519 3.902 +- 3.745
67 S 0.520 3.910 +- 3.747
68 A 0.519 3.902 +- 3.745
69 N 0.520 3.909 +- 3.747
70 D 0.521 3.916 +- 3.748
71 L 0.521 3.917 +- 3.748
72 T 0.519 3.904 +- 3.746
73 C 0.521 3.914 +- 3.748
74 N 0.520 3.909 +- 3.747
75 T 0.521 3.917 +- 3.748
76 N 0.520 3.909 +- 3.747
77 L 0.521 3.918 +- 3.748
78 C 0.521 3.918 +- 3.748
79 K 0.520 3.911 +- 3.747
80 A 0.519 3.904 +- 3.746
81 L 0.521 3.915 +- 3.748
82 R 0.521 3.915 +- 3.748
83 G 0.521 3.918 +- 3.748
84 K 0.520 3.911 +- 3.747
85 I 0.519 3.902 +- 3.745
86 E 0.521 3.918 +- 3.748
87 A 0.520 3.911 +- 3.747
88 R 0.521 3.920 +- 3.749
89 D 0.521 3.916 +- 3.748
90 D 0.520 3.910 +- 3.747
91 V 0.519 3.904 +- 3.746
92 K 0.521 3.918 +- 3.748
93 S 0.520 3.910 +- 3.747
94 L 0.522 3.921 +- 3.749
95 R 0.521 3.915 +- 3.748
96 F 0.520 3.909 +- 3.747
97 L 0.521 3.915 +- 3.748
98 N 0.520 3.909 +- 3.747
99 R 0.521 3.917 +- 3.748
100 Q 0.521 3.919 +- 3.748
101 D 0.520 3.910 +- 3.747
102 A 0.520 3.911 +- 3.747
103 Y 0.521 3.914 +- 3.747
104 D 0.520 3.910 +- 3.747
105 D 0.520 3.910 +- 3.747
106 A 0.520 3.911 +- 3.747
107 I 0.519 3.902 +- 3.745
108 R 0.521 3.920 +- 3.749
109 K 0.521 3.918 +- 3.748
110 F 0.520 3.909 +- 3.747
111 P 0.520 3.911 +- 3.747
112 Q 0.521 3.919 +- 3.748
113 Y 0.521 3.914 +- 3.747
114 R 0.520 3.912 +- 3.747
115 D 0.521 3.916 +- 3.748
116 V 0.520 3.912 +- 3.747
117 A 0.519 3.904 +- 3.746
118 G 0.520 3.909 +- 3.747
119 K 0.520 3.911 +- 3.747
120 D 0.521 3.916 +- 3.748
121 S 0.521 3.915 +- 3.748
122 F 0.520 3.909 +- 3.747
123 P 0.520 3.909 +- 3.747
124 A 0.520 3.911 +- 3.747
125 S 0.520 3.911 +- 3.747
126 F 0.520 3.909 +- 3.747
127 I 0.519 3.902 +- 3.745
128 I 0.519 3.902 +- 3.745
129 K 0.520 3.911 +- 3.747
130 L 0.521 3.920 +- 3.749
131 A 0.520 3.911 +- 3.747
132 N 0.520 3.909 +- 3.747
133 P 0.520 3.909 +- 3.747
134 V 0.520 3.912 +- 3.747
135 Q 0.522 3.921 +- 3.749
136 H 0.521 3.914 +- 3.748
137 K 0.520 3.911 +- 3.747
138 E 0.521 3.918 +- 3.748
139 F 0.521 3.915 +- 3.748
140 D 0.520 3.910 +- 3.747
141 A 0.519 3.902 +- 3.745
142 A 0.519 3.904 +- 3.746
143 T 0.520 3.906 +- 3.746
144 Q 0.521 3.919 +- 3.748
145 G 0.520 3.909 +- 3.747
146 Q 0.521 3.919 +- 3.748
147 P 0.520 3.909 +- 3.747
148 G 0.520 3.911 +- 3.747
149 V 0.520 3.906 +- 3.746
150 L 0.521 3.915 +- 3.748
151 S 0.520 3.910 +- 3.747
152 V 0.520 3.906 +- 3.746
153 L 0.520 3.910 +- 3.747
154 N 0.521 3.915 +- 3.748
155 Q 0.521 3.919 +- 3.748
156 K 0.520 3.911 +- 3.747
157 E 0.521 3.918 +- 3.748
158 L 0.521 3.917 +- 3.748
159 I 0.519 3.902 +- 3.745
160 D 0.520 3.910 +- 3.747
161 R 0.521 3.917 +- 3.748
162 L 0.521 3.917 +- 3.748
163 F 0.520 3.909 +- 3.747
164 A 0.519 3.902 +- 3.745
165 V 0.520 3.906 +- 3.746
166 L 0.521 3.918 +- 3.748
167 D 0.520 3.910 +- 3.747
168 G 0.521 3.915 +- 3.748
169 L 0.521 3.918 +- 3.748
170 S 0.520 3.910 +- 3.747
171 D 0.520 3.910 +- 3.747
172 V 0.519 3.904 +- 3.746
173 A 0.519 3.904 +- 3.746
174 F 0.520 3.909 +- 3.747
175 V 0.519 3.904 +- 3.746
176 I 0.520 3.908 +- 3.746
177 A 0.520 3.911 +- 3.747
178 L 0.522 3.921 +- 3.749
179 V 0.520 3.906 +- 3.746
180 Q 0.521 3.919 +- 3.748
181 A 0.520 3.911 +- 3.747
182 I 0.519 3.902 +- 3.745
183 G 0.521 3.918 +- 3.748
184 A 0.521 3.916 +- 3.748
185 I 0.519 3.902 +- 3.745
186 L 0.521 3.917 +- 3.748
187 L 0.521 3.920 +- 3.749
188 I 0.520 3.911 +- 3.747
189 A 0.519 3.902 +- 3.745
190 N 0.521 3.915 +- 3.748
191 M 0.519 3.902 +- 3.745
192 V 0.520 3.912 +- 3.747
193 Q 0.522 3.921 +- 3.749
194 V 0.519 3.904 +- 3.746
195 A 0.519 3.904 +- 3.746
196 A 0.980* 7.193 +- 2.575
197 Y 0.521 3.917 +- 3.748
198 T 0.520 3.906 +- 3.746
199 R 0.521 3.915 +- 3.748
200 R 0.521 3.914 +- 3.747
201 T 0.519 3.904 +- 3.746
202 E 0.520 3.912 +- 3.747
203 I 0.519 3.902 +- 3.745
204 G 0.520 3.909 +- 3.747
205 I 0.519 3.902 +- 3.745
206 M 0.519 3.902 +- 3.745
207 R 0.521 3.920 +- 3.749
208 L 0.521 3.917 +- 3.748
209 V 0.519 3.904 +- 3.746
210 G 0.520 3.909 +- 3.747
211 A 0.519 3.902 +- 3.745
212 S 0.520 3.910 +- 3.747
213 R 0.521 3.914 +- 3.747
214 W 0.521 3.919 +- 3.748
215 Y 0.521 3.917 +- 3.748
216 T 0.520 3.912 +- 3.747
217 Q 0.522 3.921 +- 3.749
218 L 0.521 3.915 +- 3.748
219 P 0.521 3.915 +- 3.748
220 F 0.521 3.915 +- 3.748
221 L 0.521 3.918 +- 3.748
222 L 0.521 3.917 +- 3.748
223 E 0.520 3.912 +- 3.747
224 A 0.521 3.916 +- 3.748
225 M 0.519 3.902 +- 3.745
226 V 0.520 3.906 +- 3.746
227 A 0.520 3.911 +- 3.747
228 A 0.519 3.904 +- 3.746
229 T 0.519 3.904 +- 3.746
230 V 0.521 3.917 +- 3.748
231 G 0.520 3.909 +- 3.747
232 A 0.519 3.902 +- 3.745
233 V 0.519 3.904 +- 3.746
234 I 0.519 3.902 +- 3.745
235 A 0.519 3.904 +- 3.746
236 I 0.519 3.902 +- 3.745
237 V 0.520 3.912 +- 3.747
238 G 0.521 3.915 +- 3.748
239 L 0.521 3.917 +- 3.748
240 L 0.521 3.915 +- 3.748
241 V 0.520 3.906 +- 3.746
242 A 0.519 3.904 +- 3.746
243 R 0.521 3.920 +- 3.749
244 A 0.521 3.916 +- 3.748
245 M 0.519 3.902 +- 3.745
246 F 0.521 3.915 +- 3.748
247 L 0.521 3.918 +- 3.748
248 N 0.520 3.909 +- 3.747
249 N 0.521 3.915 +- 3.748
250 A 0.521 3.916 +- 3.748
251 L 0.521 3.917 +- 3.748
252 N 0.520 3.909 +- 3.747
253 Q 0.521 3.919 +- 3.748
254 F 0.520 3.909 +- 3.747
255 Y 0.521 3.917 +- 3.748
256 Q 0.522 3.921 +- 3.749
257 A 0.520 3.911 +- 3.747
258 N 0.521 3.915 +- 3.748
259 L 0.521 3.917 +- 3.748
260 I 0.520 3.911 +- 3.747
261 A 0.519 3.902 +- 3.745
262 R 0.521 3.915 +- 3.748
263 V 0.519 3.904 +- 3.746
264 D 0.521 3.916 +- 3.748
265 Y 0.521 3.917 +- 3.748
266 A 0.519 3.902 +- 3.745
267 D 0.521 3.916 +- 3.748
268 V 0.519 3.904 +- 3.746
269 L 0.521 3.917 +- 3.748
270 Y 0.521 3.914 +- 3.747
271 V 0.520 3.912 +- 3.747
272 S 0.520 3.910 +- 3.747
273 P 0.520 3.911 +- 3.747
274 W 0.521 3.919 +- 3.748
275 L 0.521 3.918 +- 3.748
276 L 0.521 3.918 +- 3.748
277 L 0.521 3.918 +- 3.748
278 L 0.520 3.910 +- 3.747
279 G 0.520 3.909 +- 3.747
280 V 0.520 3.906 +- 3.746
281 A 0.519 3.904 +- 3.746
282 L 0.521 3.918 +- 3.748
283 A 0.519 3.902 +- 3.745
284 A 0.519 3.904 +- 3.746
285 L 0.521 3.918 +- 3.748
286 T 0.519 3.904 +- 3.746
287 G 0.521 3.915 +- 3.748
288 Y 0.521 3.914 +- 3.747
289 A 0.521 3.916 +- 3.748
290 T 0.521 3.917 +- 3.748
291 L 0.521 3.918 +- 3.748
292 R 0.521 3.914 +- 3.747
293 I 0.520 3.911 +- 3.747
294 Y 0.521 3.914 +- 3.747
295 V 0.520 3.906 +- 3.746
296 R 0.521 3.920 +- 3.749
297 R 0.521 3.915 +- 3.748
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.088 0.096 0.104 0.112 0.119 0.122 0.121 0.110 0.086 0.041
p : 0.104 0.102 0.101 0.100 0.100 0.099 0.099 0.099 0.098 0.098
q : 0.097 0.098 0.099 0.100 0.100 0.101 0.101 0.101 0.101 0.102
ws: 0.019 0.040 0.062 0.083 0.101 0.117 0.131 0.141 0.150 0.157
Time used: 0:29
Model 1: NearlyNeutral -1189.162555
Model 2: PositiveSelection -1184.240392
Model 0: one-ratio -1188.511295
Model 7: beta -1189.162831
Model 8: beta&w>1 -1184.240392
Model 0 vs 1 1.302520000000186
Model 2 vs 1 9.844326000000365
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320)
Pr(w>1) post mean +- SE for w
196 A 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320)
Pr(w>1) post mean +- SE for w
196 A 0.945 7.212 +- 2.751
Model 8 vs 7 9.844878000000335
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320)
Pr(w>1) post mean +- SE for w
196 A 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907867_1_700_MLBR_RS03320)
Pr(w>1) post mean +- SE for w
1 V 0.520 3.906 +- 3.746
2 R 0.521 3.914 +- 3.747
3 F 0.520 3.909 +- 3.747
4 G 0.520 3.909 +- 3.747
5 F 0.521 3.915 +- 3.748
6 L 0.521 3.917 +- 3.748
7 L 0.520 3.910 +- 3.747
8 N 0.520 3.909 +- 3.747
9 E 0.520 3.912 +- 3.747
10 V 0.520 3.912 +- 3.747
11 V 0.520 3.906 +- 3.746
12 T 0.520 3.912 +- 3.747
13 G 0.520 3.909 +- 3.747
14 L 0.520 3.910 +- 3.747
15 R 0.521 3.917 +- 3.748
16 R 0.521 3.914 +- 3.747
17 N 0.521 3.915 +- 3.748
18 V 0.519 3.904 +- 3.746
19 T 0.520 3.906 +- 3.746
20 M 0.519 3.902 +- 3.745
21 T 0.520 3.906 +- 3.746
22 I 0.520 3.908 +- 3.746
23 A 0.519 3.904 +- 3.746
24 M 0.519 3.902 +- 3.745
25 I 0.519 3.902 +- 3.745
26 L 0.521 3.918 +- 3.748
27 T 0.520 3.906 +- 3.746
28 T 0.519 3.904 +- 3.746
29 A 0.519 3.904 +- 3.746
30 I 0.519 3.902 +- 3.745
31 S 0.520 3.911 +- 3.747
32 I 0.520 3.911 +- 3.747
33 G 0.520 3.909 +- 3.747
34 L 0.521 3.918 +- 3.748
35 F 0.521 3.915 +- 3.748
36 G 0.521 3.915 +- 3.748
37 G 0.520 3.909 +- 3.747
38 G 0.520 3.911 +- 3.747
39 L 0.521 3.917 +- 3.748
40 L 0.521 3.917 +- 3.748
41 V 0.520 3.906 +- 3.746
42 V 0.519 3.904 +- 3.746
43 R 0.521 3.915 +- 3.748
44 L 0.521 3.918 +- 3.748
45 A 0.519 3.902 +- 3.745
46 D 0.520 3.910 +- 3.747
47 N 0.520 3.909 +- 3.747
48 S 0.520 3.910 +- 3.747
49 R 0.521 3.920 +- 3.749
50 S 0.520 3.910 +- 3.747
51 I 0.519 3.902 +- 3.745
52 Y 0.521 3.914 +- 3.747
53 L 0.521 3.917 +- 3.748
54 D 0.521 3.916 +- 3.748
55 R 0.521 3.920 +- 3.749
56 V 0.519 3.904 +- 3.746
57 E 0.520 3.912 +- 3.747
58 T 0.521 3.917 +- 3.748
59 Q 0.521 3.919 +- 3.748
60 V 0.519 3.904 +- 3.746
61 F 0.521 3.915 +- 3.748
62 L 0.520 3.910 +- 3.747
63 T 0.519 3.904 +- 3.746
64 D 0.521 3.916 +- 3.748
65 D 0.520 3.910 +- 3.747
66 I 0.519 3.902 +- 3.745
67 S 0.520 3.910 +- 3.747
68 A 0.519 3.902 +- 3.745
69 N 0.520 3.909 +- 3.747
70 D 0.521 3.916 +- 3.748
71 L 0.521 3.917 +- 3.748
72 T 0.519 3.904 +- 3.746
73 C 0.521 3.914 +- 3.748
74 N 0.520 3.909 +- 3.747
75 T 0.521 3.917 +- 3.748
76 N 0.520 3.909 +- 3.747
77 L 0.521 3.918 +- 3.748
78 C 0.521 3.918 +- 3.748
79 K 0.520 3.911 +- 3.747
80 A 0.519 3.904 +- 3.746
81 L 0.521 3.915 +- 3.748
82 R 0.521 3.915 +- 3.748
83 G 0.521 3.918 +- 3.748
84 K 0.520 3.911 +- 3.747
85 I 0.519 3.902 +- 3.745
86 E 0.521 3.918 +- 3.748
87 A 0.520 3.911 +- 3.747
88 R 0.521 3.920 +- 3.749
89 D 0.521 3.916 +- 3.748
90 D 0.520 3.910 +- 3.747
91 V 0.519 3.904 +- 3.746
92 K 0.521 3.918 +- 3.748
93 S 0.520 3.910 +- 3.747
94 L 0.522 3.921 +- 3.749
95 R 0.521 3.915 +- 3.748
96 F 0.520 3.909 +- 3.747
97 L 0.521 3.915 +- 3.748
98 N 0.520 3.909 +- 3.747
99 R 0.521 3.917 +- 3.748
100 Q 0.521 3.919 +- 3.748
101 D 0.520 3.910 +- 3.747
102 A 0.520 3.911 +- 3.747
103 Y 0.521 3.914 +- 3.747
104 D 0.520 3.910 +- 3.747
105 D 0.520 3.910 +- 3.747
106 A 0.520 3.911 +- 3.747
107 I 0.519 3.902 +- 3.745
108 R 0.521 3.920 +- 3.749
109 K 0.521 3.918 +- 3.748
110 F 0.520 3.909 +- 3.747
111 P 0.520 3.911 +- 3.747
112 Q 0.521 3.919 +- 3.748
113 Y 0.521 3.914 +- 3.747
114 R 0.520 3.912 +- 3.747
115 D 0.521 3.916 +- 3.748
116 V 0.520 3.912 +- 3.747
117 A 0.519 3.904 +- 3.746
118 G 0.520 3.909 +- 3.747
119 K 0.520 3.911 +- 3.747
120 D 0.521 3.916 +- 3.748
121 S 0.521 3.915 +- 3.748
122 F 0.520 3.909 +- 3.747
123 P 0.520 3.909 +- 3.747
124 A 0.520 3.911 +- 3.747
125 S 0.520 3.911 +- 3.747
126 F 0.520 3.909 +- 3.747
127 I 0.519 3.902 +- 3.745
128 I 0.519 3.902 +- 3.745
129 K 0.520 3.911 +- 3.747
130 L 0.521 3.920 +- 3.749
131 A 0.520 3.911 +- 3.747
132 N 0.520 3.909 +- 3.747
133 P 0.520 3.909 +- 3.747
134 V 0.520 3.912 +- 3.747
135 Q 0.522 3.921 +- 3.749
136 H 0.521 3.914 +- 3.748
137 K 0.520 3.911 +- 3.747
138 E 0.521 3.918 +- 3.748
139 F 0.521 3.915 +- 3.748
140 D 0.520 3.910 +- 3.747
141 A 0.519 3.902 +- 3.745
142 A 0.519 3.904 +- 3.746
143 T 0.520 3.906 +- 3.746
144 Q 0.521 3.919 +- 3.748
145 G 0.520 3.909 +- 3.747
146 Q 0.521 3.919 +- 3.748
147 P 0.520 3.909 +- 3.747
148 G 0.520 3.911 +- 3.747
149 V 0.520 3.906 +- 3.746
150 L 0.521 3.915 +- 3.748
151 S 0.520 3.910 +- 3.747
152 V 0.520 3.906 +- 3.746
153 L 0.520 3.910 +- 3.747
154 N 0.521 3.915 +- 3.748
155 Q 0.521 3.919 +- 3.748
156 K 0.520 3.911 +- 3.747
157 E 0.521 3.918 +- 3.748
158 L 0.521 3.917 +- 3.748
159 I 0.519 3.902 +- 3.745
160 D 0.520 3.910 +- 3.747
161 R 0.521 3.917 +- 3.748
162 L 0.521 3.917 +- 3.748
163 F 0.520 3.909 +- 3.747
164 A 0.519 3.902 +- 3.745
165 V 0.520 3.906 +- 3.746
166 L 0.521 3.918 +- 3.748
167 D 0.520 3.910 +- 3.747
168 G 0.521 3.915 +- 3.748
169 L 0.521 3.918 +- 3.748
170 S 0.520 3.910 +- 3.747
171 D 0.520 3.910 +- 3.747
172 V 0.519 3.904 +- 3.746
173 A 0.519 3.904 +- 3.746
174 F 0.520 3.909 +- 3.747
175 V 0.519 3.904 +- 3.746
176 I 0.520 3.908 +- 3.746
177 A 0.520 3.911 +- 3.747
178 L 0.522 3.921 +- 3.749
179 V 0.520 3.906 +- 3.746
180 Q 0.521 3.919 +- 3.748
181 A 0.520 3.911 +- 3.747
182 I 0.519 3.902 +- 3.745
183 G 0.521 3.918 +- 3.748
184 A 0.521 3.916 +- 3.748
185 I 0.519 3.902 +- 3.745
186 L 0.521 3.917 +- 3.748
187 L 0.521 3.920 +- 3.749
188 I 0.520 3.911 +- 3.747
189 A 0.519 3.902 +- 3.745
190 N 0.521 3.915 +- 3.748
191 M 0.519 3.902 +- 3.745
192 V 0.520 3.912 +- 3.747
193 Q 0.522 3.921 +- 3.749
194 V 0.519 3.904 +- 3.746
195 A 0.519 3.904 +- 3.746
196 A 0.980* 7.193 +- 2.575
197 Y 0.521 3.917 +- 3.748
198 T 0.520 3.906 +- 3.746
199 R 0.521 3.915 +- 3.748
200 R 0.521 3.914 +- 3.747
201 T 0.519 3.904 +- 3.746
202 E 0.520 3.912 +- 3.747
203 I 0.519 3.902 +- 3.745
204 G 0.520 3.909 +- 3.747
205 I 0.519 3.902 +- 3.745
206 M 0.519 3.902 +- 3.745
207 R 0.521 3.920 +- 3.749
208 L 0.521 3.917 +- 3.748
209 V 0.519 3.904 +- 3.746
210 G 0.520 3.909 +- 3.747
211 A 0.519 3.902 +- 3.745
212 S 0.520 3.910 +- 3.747
213 R 0.521 3.914 +- 3.747
214 W 0.521 3.919 +- 3.748
215 Y 0.521 3.917 +- 3.748
216 T 0.520 3.912 +- 3.747
217 Q 0.522 3.921 +- 3.749
218 L 0.521 3.915 +- 3.748
219 P 0.521 3.915 +- 3.748
220 F 0.521 3.915 +- 3.748
221 L 0.521 3.918 +- 3.748
222 L 0.521 3.917 +- 3.748
223 E 0.520 3.912 +- 3.747
224 A 0.521 3.916 +- 3.748
225 M 0.519 3.902 +- 3.745
226 V 0.520 3.906 +- 3.746
227 A 0.520 3.911 +- 3.747
228 A 0.519 3.904 +- 3.746
229 T 0.519 3.904 +- 3.746
230 V 0.521 3.917 +- 3.748
231 G 0.520 3.909 +- 3.747
232 A 0.519 3.902 +- 3.745
233 V 0.519 3.904 +- 3.746
234 I 0.519 3.902 +- 3.745
235 A 0.519 3.904 +- 3.746
236 I 0.519 3.902 +- 3.745
237 V 0.520 3.912 +- 3.747
238 G 0.521 3.915 +- 3.748
239 L 0.521 3.917 +- 3.748
240 L 0.521 3.915 +- 3.748
241 V 0.520 3.906 +- 3.746
242 A 0.519 3.904 +- 3.746
243 R 0.521 3.920 +- 3.749
244 A 0.521 3.916 +- 3.748
245 M 0.519 3.902 +- 3.745
246 F 0.521 3.915 +- 3.748
247 L 0.521 3.918 +- 3.748
248 N 0.520 3.909 +- 3.747
249 N 0.521 3.915 +- 3.748
250 A 0.521 3.916 +- 3.748
251 L 0.521 3.917 +- 3.748
252 N 0.520 3.909 +- 3.747
253 Q 0.521 3.919 +- 3.748
254 F 0.520 3.909 +- 3.747
255 Y 0.521 3.917 +- 3.748
256 Q 0.522 3.921 +- 3.749
257 A 0.520 3.911 +- 3.747
258 N 0.521 3.915 +- 3.748
259 L 0.521 3.917 +- 3.748
260 I 0.520 3.911 +- 3.747
261 A 0.519 3.902 +- 3.745
262 R 0.521 3.915 +- 3.748
263 V 0.519 3.904 +- 3.746
264 D 0.521 3.916 +- 3.748
265 Y 0.521 3.917 +- 3.748
266 A 0.519 3.902 +- 3.745
267 D 0.521 3.916 +- 3.748
268 V 0.519 3.904 +- 3.746
269 L 0.521 3.917 +- 3.748
270 Y 0.521 3.914 +- 3.747
271 V 0.520 3.912 +- 3.747
272 S 0.520 3.910 +- 3.747
273 P 0.520 3.911 +- 3.747
274 W 0.521 3.919 +- 3.748
275 L 0.521 3.918 +- 3.748
276 L 0.521 3.918 +- 3.748
277 L 0.521 3.918 +- 3.748
278 L 0.520 3.910 +- 3.747
279 G 0.520 3.909 +- 3.747
280 V 0.520 3.906 +- 3.746
281 A 0.519 3.904 +- 3.746
282 L 0.521 3.918 +- 3.748
283 A 0.519 3.902 +- 3.745
284 A 0.519 3.904 +- 3.746
285 L 0.521 3.918 +- 3.748
286 T 0.519 3.904 +- 3.746
287 G 0.521 3.915 +- 3.748
288 Y 0.521 3.914 +- 3.747
289 A 0.521 3.916 +- 3.748
290 T 0.521 3.917 +- 3.748
291 L 0.521 3.918 +- 3.748
292 R 0.521 3.914 +- 3.747
293 I 0.520 3.911 +- 3.747
294 Y 0.521 3.914 +- 3.747
295 V 0.520 3.906 +- 3.746
296 R 0.521 3.920 +- 3.749
297 R 0.521 3.915 +- 3.748
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
