--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:27:39 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/gabT/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/2res/gabT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/gabT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/2res/gabT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1817.91         -1821.91
2      -1817.91         -1821.06
--------------------------------------
TOTAL    -1817.91         -1821.57
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/2res/gabT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/gabT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/gabT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.893632    0.090232    0.355728    1.478809    0.858168   1381.87   1441.44    1.000
r(A<->C){all}   0.164028    0.017907    0.000139    0.434961    0.133104    278.31    286.85    1.002
r(A<->G){all}   0.164165    0.020125    0.000007    0.455388    0.126146    216.08    246.07    1.000
r(A<->T){all}   0.165975    0.019752    0.000044    0.443381    0.129836    194.80    226.30    1.000
r(C<->G){all}   0.169693    0.020678    0.000028    0.457924    0.131776    167.89    250.19    1.001
r(C<->T){all}   0.168303    0.020447    0.000052    0.455338    0.130758    193.28    207.69    1.000
r(G<->T){all}   0.167835    0.019265    0.000081    0.446281    0.133827    182.94    196.92    1.000
pi(A){all}      0.199640    0.000115    0.179088    0.220716    0.199547   1164.34   1231.23    1.000
pi(C){all}      0.319334    0.000157    0.294851    0.343173    0.319114   1300.35   1307.48    1.000
pi(G){all}      0.298484    0.000159    0.272872    0.322296    0.298396   1238.69   1257.30    1.001
pi(T){all}      0.182542    0.000111    0.162381    0.202858    0.182509   1171.34   1275.40    1.000
alpha{1,2}      0.433840    0.247006    0.000283    1.441802    0.253508    899.06   1041.29    1.000
alpha{3}        0.470257    0.243899    0.000289    1.405817    0.318062   1157.14   1231.42    1.000
pinvar{all}     0.998905    0.000002    0.996548    1.000000    0.999288    989.32   1204.74    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1729.27667
Model 2: PositiveSelection	-1729.27667
Model 0: one-ratio	-1729.27667
Model 7: beta	-1729.27667
Model 8: beta&w>1	-1729.27667


Model 0 vs 1	0.0

Model 2 vs 1	0.0

Model 8 vs 7	0.0
>C1
VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
>C2
VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
>C3
VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
>C4
VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
>C5
VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
>C6
VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=446 

C1              VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
C2              VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
C3              VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
C4              VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
C5              VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
C6              VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
                **************************************************

C1              EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
C2              EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
C3              EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
C4              EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
C5              EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
C6              EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
                **************************************************

C1              YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
C2              YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
C3              YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
C4              YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
C5              YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
C6              YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
                **************************************************

C1              HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
C2              HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
C3              HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
C4              HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
C5              HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
C6              HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
                **************************************************

C1              TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
C2              TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
C3              TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
C4              TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
C5              TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
C6              TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
                **************************************************

C1              WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
C2              WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
C3              WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
C4              WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
C5              WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
C6              WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
                **************************************************

C1              AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
C2              AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
C3              AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
C4              AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
C5              AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
C6              AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
                **************************************************

C1              ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
C2              ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
C3              ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
C4              ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
C5              ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
C6              ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
                **************************************************

C1              AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
C2              AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
C3              AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
C4              AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
C5              AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
C6              AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
                **********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  446 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  446 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13380]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [13380]--->[13380]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.530 Mb, Max= 31.020 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
C2              VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
C3              VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
C4              VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
C5              VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
C6              VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
                **************************************************

C1              EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
C2              EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
C3              EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
C4              EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
C5              EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
C6              EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
                **************************************************

C1              YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
C2              YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
C3              YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
C4              YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
C5              YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
C6              YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
                **************************************************

C1              HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
C2              HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
C3              HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
C4              HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
C5              HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
C6              HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
                **************************************************

C1              TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
C2              TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
C3              TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
C4              TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
C5              TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
C6              TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
                **************************************************

C1              WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
C2              WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
C3              WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
C4              WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
C5              WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
C6              WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
                **************************************************

C1              AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
C2              AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
C3              AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
C4              AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
C5              AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
C6              AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
                **************************************************

C1              ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
C2              ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
C3              ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
C4              ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
C5              ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
C6              ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
                **************************************************

C1              AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
C2              AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
C3              AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
C4              AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
C5              AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
C6              AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
                **********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGACCAGCGTCGAGCAGAGCCGTCAGCTGGTCACTGAAATCCCCGGCCC
C2              GTGACCAGCGTCGAGCAGAGCCGTCAGCTGGTCACTGAAATCCCCGGCCC
C3              GTGACCAGCGTCGAGCAGAGCCGTCAGCTGGTCACTGAAATCCCCGGCCC
C4              GTGACCAGCGTCGAGCAGAGCCGTCAGCTGGTCACTGAAATCCCCGGCCC
C5              GTGACCAGCGTCGAGCAGAGCCGTCAGCTGGTCACTGAAATCCCCGGCCC
C6              GTGACCAGCGTCGAGCAGAGCCGTCAGCTGGTCACTGAAATCCCCGGCCC
                **************************************************

C1              CGTGTCACTTGAACTAGCCAAACGCCTCAACGCGGCGGTGCCTCGTGGGG
C2              CGTGTCACTTGAACTAGCCAAACGCCTCAACGCGGCGGTGCCTCGTGGGG
C3              CGTGTCACTTGAACTAGCCAAACGCCTCAACGCGGCGGTGCCTCGTGGGG
C4              CGTGTCACTTGAACTAGCCAAACGCCTCAACGCGGCGGTGCCTCGTGGGG
C5              CGTGTCACTTGAACTAGCCAAACGCCTCAACGCGGCGGTGCCTCGTGGGG
C6              CGTGTCACTTGAACTAGCCAAACGCCTCAACGCGGCGGTGCCTCGTGGGG
                **************************************************

C1              TGGGAGTCACCCTGCCAGTGTTTGTAACGCGCGCCGCCGGCGGCGTTATC
C2              TGGGAGTCACCCTGCCAGTGTTTGTAACGCGCGCCGCCGGCGGCGTTATC
C3              TGGGAGTCACCCTGCCAGTGTTTGTAACGCGCGCCGCCGGCGGCGTTATC
C4              TGGGAGTCACCCTGCCAGTGTTTGTAACGCGCGCCGCCGGCGGCGTTATC
C5              TGGGAGTCACCCTGCCAGTGTTTGTAACGCGCGCCGCCGGCGGCGTTATC
C6              TGGGAGTCACCCTGCCAGTGTTTGTAACGCGCGCCGCCGGCGGCGTTATC
                **************************************************

C1              GAGGACGTCGACGGGAACCGGCTTATCGACCTGGGTTCTGGAATCGCCGT
C2              GAGGACGTCGACGGGAACCGGCTTATCGACCTGGGTTCTGGAATCGCCGT
C3              GAGGACGTCGACGGGAACCGGCTTATCGACCTGGGTTCTGGAATCGCCGT
C4              GAGGACGTCGACGGGAACCGGCTTATCGACCTGGGTTCTGGAATCGCCGT
C5              GAGGACGTCGACGGGAACCGGCTTATCGACCTGGGTTCTGGAATCGCCGT
C6              GAGGACGTCGACGGGAACCGGCTTATCGACCTGGGTTCTGGAATCGCCGT
                **************************************************

C1              CACCACAATCGGCAACTCGTCGCCTCGCGTTGTGGACGCGGTGCGCGCCC
C2              CACCACAATCGGCAACTCGTCGCCTCGCGTTGTGGACGCGGTGCGCGCCC
C3              CACCACAATCGGCAACTCGTCGCCTCGCGTTGTGGACGCGGTGCGCGCCC
C4              CACCACAATCGGCAACTCGTCGCCTCGCGTTGTGGACGCGGTGCGCGCCC
C5              CACCACAATCGGCAACTCGTCGCCTCGCGTTGTGGACGCGGTGCGCGCCC
C6              CACCACAATCGGCAACTCGTCGCCTCGCGTTGTGGACGCGGTGCGCGCCC
                **************************************************

C1              AGGTGGCCGACTTTACCCACACCTGTTTCATAATCACACCTTACGAGGAG
C2              AGGTGGCCGACTTTACCCACACCTGTTTCATAATCACACCTTACGAGGAG
C3              AGGTGGCCGACTTTACCCACACCTGTTTCATAATCACACCTTACGAGGAG
C4              AGGTGGCCGACTTTACCCACACCTGTTTCATAATCACACCTTACGAGGAG
C5              AGGTGGCCGACTTTACCCACACCTGTTTCATAATCACACCTTACGAGGAG
C6              AGGTGGCCGACTTTACCCACACCTGTTTCATAATCACACCTTACGAGGAG
                **************************************************

C1              TACGTCGCCGTCACCGAGCAACTCAATCGAATTACCCCAGGATCCGGCGA
C2              TACGTCGCCGTCACCGAGCAACTCAATCGAATTACCCCAGGATCCGGCGA
C3              TACGTCGCCGTCACCGAGCAACTCAATCGAATTACCCCAGGATCCGGCGA
C4              TACGTCGCCGTCACCGAGCAACTCAATCGAATTACCCCAGGATCCGGCGA
C5              TACGTCGCCGTCACCGAGCAACTCAATCGAATTACCCCAGGATCCGGCGA
C6              TACGTCGCCGTCACCGAGCAACTCAATCGAATTACCCCAGGATCCGGCGA
                **************************************************

C1              GAAACGCTCGGTGCTGTTCAATTCCGGCGCCGAGGCAGTGGAGAATTCTA
C2              GAAACGCTCGGTGCTGTTCAATTCCGGCGCCGAGGCAGTGGAGAATTCTA
C3              GAAACGCTCGGTGCTGTTCAATTCCGGCGCCGAGGCAGTGGAGAATTCTA
C4              GAAACGCTCGGTGCTGTTCAATTCCGGCGCCGAGGCAGTGGAGAATTCTA
C5              GAAACGCTCGGTGCTGTTCAATTCCGGCGCCGAGGCAGTGGAGAATTCTA
C6              GAAACGCTCGGTGCTGTTCAATTCCGGCGCCGAGGCAGTGGAGAATTCTA
                **************************************************

C1              TCAAGGTCGCACGTTCGTACACCCGCAAGCCCGCAGTGGTCGCGTTCGAC
C2              TCAAGGTCGCACGTTCGTACACCCGCAAGCCCGCAGTGGTCGCGTTCGAC
C3              TCAAGGTCGCACGTTCGTACACCCGCAAGCCCGCAGTGGTCGCGTTCGAC
C4              TCAAGGTCGCACGTTCGTACACCCGCAAGCCCGCAGTGGTCGCGTTCGAC
C5              TCAAGGTCGCACGTTCGTACACCCGCAAGCCCGCAGTGGTCGCGTTCGAC
C6              TCAAGGTCGCACGTTCGTACACCCGCAAGCCCGCAGTGGTCGCGTTCGAC
                **************************************************

C1              CACGCCTACCACGGTCGCACCAACCTGACAATGGCACTGACCGCCAAGTC
C2              CACGCCTACCACGGTCGCACCAACCTGACAATGGCACTGACCGCCAAGTC
C3              CACGCCTACCACGGTCGCACCAACCTGACAATGGCACTGACCGCCAAGTC
C4              CACGCCTACCACGGTCGCACCAACCTGACAATGGCACTGACCGCCAAGTC
C5              CACGCCTACCACGGTCGCACCAACCTGACAATGGCACTGACCGCCAAGTC
C6              CACGCCTACCACGGTCGCACCAACCTGACAATGGCACTGACCGCCAAGTC
                **************************************************

C1              CATGCCGTACAAAAGCGGCTTTGGTCCTTTTGCGCCGGAGATCTACCGGG
C2              CATGCCGTACAAAAGCGGCTTTGGTCCTTTTGCGCCGGAGATCTACCGGG
C3              CATGCCGTACAAAAGCGGCTTTGGTCCTTTTGCGCCGGAGATCTACCGGG
C4              CATGCCGTACAAAAGCGGCTTTGGTCCTTTTGCGCCGGAGATCTACCGGG
C5              CATGCCGTACAAAAGCGGCTTTGGTCCTTTTGCGCCGGAGATCTACCGGG
C6              CATGCCGTACAAAAGCGGCTTTGGTCCTTTTGCGCCGGAGATCTACCGGG
                **************************************************

C1              CGCCGCTGTCCTACCCCTATCGGGACGGCCTGCTCAACAAAGACCTAGCC
C2              CGCCGCTGTCCTACCCCTATCGGGACGGCCTGCTCAACAAAGACCTAGCC
C3              CGCCGCTGTCCTACCCCTATCGGGACGGCCTGCTCAACAAAGACCTAGCC
C4              CGCCGCTGTCCTACCCCTATCGGGACGGCCTGCTCAACAAAGACCTAGCC
C5              CGCCGCTGTCCTACCCCTATCGGGACGGCCTGCTCAACAAAGACCTAGCC
C6              CGCCGCTGTCCTACCCCTATCGGGACGGCCTGCTCAACAAAGACCTAGCC
                **************************************************

C1              ACCGACGGCAAGTTGGCCGGCGCACGGGCCATCAACGTCATTGAGAAGCA
C2              ACCGACGGCAAGTTGGCCGGCGCACGGGCCATCAACGTCATTGAGAAGCA
C3              ACCGACGGCAAGTTGGCCGGCGCACGGGCCATCAACGTCATTGAGAAGCA
C4              ACCGACGGCAAGTTGGCCGGCGCACGGGCCATCAACGTCATTGAGAAGCA
C5              ACCGACGGCAAGTTGGCCGGCGCACGGGCCATCAACGTCATTGAGAAGCA
C6              ACCGACGGCAAGTTGGCCGGCGCACGGGCCATCAACGTCATTGAGAAGCA
                **************************************************

C1              GGTTGGCGCCGATGACCTGGCTGCCGTGATCATTGAGCCGATCCAGGGCG
C2              GGTTGGCGCCGATGACCTGGCTGCCGTGATCATTGAGCCGATCCAGGGCG
C3              GGTTGGCGCCGATGACCTGGCTGCCGTGATCATTGAGCCGATCCAGGGCG
C4              GGTTGGCGCCGATGACCTGGCTGCCGTGATCATTGAGCCGATCCAGGGCG
C5              GGTTGGCGCCGATGACCTGGCTGCCGTGATCATTGAGCCGATCCAGGGCG
C6              GGTTGGCGCCGATGACCTGGCTGCCGTGATCATTGAGCCGATCCAGGGCG
                **************************************************

C1              AAGGCGGTTTCATCGTCCCGGCCGAAGGGTTTTTAGCTACTTTGCTGGAT
C2              AAGGCGGTTTCATCGTCCCGGCCGAAGGGTTTTTAGCTACTTTGCTGGAT
C3              AAGGCGGTTTCATCGTCCCGGCCGAAGGGTTTTTAGCTACTTTGCTGGAT
C4              AAGGCGGTTTCATCGTCCCGGCCGAAGGGTTTTTAGCTACTTTGCTGGAT
C5              AAGGCGGTTTCATCGTCCCGGCCGAAGGGTTTTTAGCTACTTTGCTGGAT
C6              AAGGCGGTTTCATCGTCCCGGCCGAAGGGTTTTTAGCTACTTTGCTGGAT
                **************************************************

C1              TGGTGCCGCAAGAACAACGTGATGTTCATCGCCGATGAGGTGCAAACGGG
C2              TGGTGCCGCAAGAACAACGTGATGTTCATCGCCGATGAGGTGCAAACGGG
C3              TGGTGCCGCAAGAACAACGTGATGTTCATCGCCGATGAGGTGCAAACGGG
C4              TGGTGCCGCAAGAACAACGTGATGTTCATCGCCGATGAGGTGCAAACGGG
C5              TGGTGCCGCAAGAACAACGTGATGTTCATCGCCGATGAGGTGCAAACGGG
C6              TGGTGCCGCAAGAACAACGTGATGTTCATCGCCGATGAGGTGCAAACGGG
                **************************************************

C1              GTTTGCGCGTACCGGCGCCATGTTCGCCTGCGAGCACGATGGAATCGTGC
C2              GTTTGCGCGTACCGGCGCCATGTTCGCCTGCGAGCACGATGGAATCGTGC
C3              GTTTGCGCGTACCGGCGCCATGTTCGCCTGCGAGCACGATGGAATCGTGC
C4              GTTTGCGCGTACCGGCGCCATGTTCGCCTGCGAGCACGATGGAATCGTGC
C5              GTTTGCGCGTACCGGCGCCATGTTCGCCTGCGAGCACGATGGAATCGTGC
C6              GTTTGCGCGTACCGGCGCCATGTTCGCCTGCGAGCACGATGGAATCGTGC
                **************************************************

C1              CCGACCTGATCTGCACCGCCAAGGGCATCGCCGACGGATTGCCGCTGGCG
C2              CCGACCTGATCTGCACCGCCAAGGGCATCGCCGACGGATTGCCGCTGGCG
C3              CCGACCTGATCTGCACCGCCAAGGGCATCGCCGACGGATTGCCGCTGGCG
C4              CCGACCTGATCTGCACCGCCAAGGGCATCGCCGACGGATTGCCGCTGGCG
C5              CCGACCTGATCTGCACCGCCAAGGGCATCGCCGACGGATTGCCGCTGGCG
C6              CCGACCTGATCTGCACCGCCAAGGGCATCGCCGACGGATTGCCGCTGGCG
                **************************************************

C1              GCGGTAACCGGACGGGCTGAGATCATGAACGCCCCGCACGTCAGCGGCCT
C2              GCGGTAACCGGACGGGCTGAGATCATGAACGCCCCGCACGTCAGCGGCCT
C3              GCGGTAACCGGACGGGCTGAGATCATGAACGCCCCGCACGTCAGCGGCCT
C4              GCGGTAACCGGACGGGCTGAGATCATGAACGCCCCGCACGTCAGCGGCCT
C5              GCGGTAACCGGACGGGCTGAGATCATGAACGCCCCGCACGTCAGCGGCCT
C6              GCGGTAACCGGACGGGCTGAGATCATGAACGCCCCGCACGTCAGCGGCCT
                **************************************************

C1              CGGTGGCACTTTCGGCGGCAACCCGGTCGCCTGCGCGGCGGCTTTGGCAA
C2              CGGTGGCACTTTCGGCGGCAACCCGGTCGCCTGCGCGGCGGCTTTGGCAA
C3              CGGTGGCACTTTCGGCGGCAACCCGGTCGCCTGCGCGGCGGCTTTGGCAA
C4              CGGTGGCACTTTCGGCGGCAACCCGGTCGCCTGCGCGGCGGCTTTGGCAA
C5              CGGTGGCACTTTCGGCGGCAACCCGGTCGCCTGCGCGGCGGCTTTGGCAA
C6              CGGTGGCACTTTCGGCGGCAACCCGGTCGCCTGCGCGGCGGCTTTGGCAA
                **************************************************

C1              CCATCACGACCATCGAGAACGACGGCCTGATCCAGCGAGCCCAACAGATC
C2              CCATCACGACCATCGAGAACGACGGCCTGATCCAGCGAGCCCAACAGATC
C3              CCATCACGACCATCGAGAACGACGGCCTGATCCAGCGAGCCCAACAGATC
C4              CCATCACGACCATCGAGAACGACGGCCTGATCCAGCGAGCCCAACAGATC
C5              CCATCACGACCATCGAGAACGACGGCCTGATCCAGCGAGCCCAACAGATC
C6              CCATCACGACCATCGAGAACGACGGCCTGATCCAGCGAGCCCAACAGATC
                **************************************************

C1              GAACGGCTGATCACCGACCGGTTGTTGCGACTTCAGGACGCCGACGATCG
C2              GAACGGCTGATCACCGACCGGTTGTTGCGACTTCAGGACGCCGACGATCG
C3              GAACGGCTGATCACCGACCGGTTGTTGCGACTTCAGGACGCCGACGATCG
C4              GAACGGCTGATCACCGACCGGTTGTTGCGACTTCAGGACGCCGACGATCG
C5              GAACGGCTGATCACCGACCGGTTGTTGCGACTTCAGGACGCCGACGATCG
C6              GAACGGCTGATCACCGACCGGTTGTTGCGACTTCAGGACGCCGACGATCG
                **************************************************

C1              GATAGGTGACGTACGTGGCCGGGGTGCCATGATCGCCGTCGAATTGGTAA
C2              GATAGGTGACGTACGTGGCCGGGGTGCCATGATCGCCGTCGAATTGGTAA
C3              GATAGGTGACGTACGTGGCCGGGGTGCCATGATCGCCGTCGAATTGGTAA
C4              GATAGGTGACGTACGTGGCCGGGGTGCCATGATCGCCGTCGAATTGGTAA
C5              GATAGGTGACGTACGTGGCCGGGGTGCCATGATCGCCGTCGAATTGGTAA
C6              GATAGGTGACGTACGTGGCCGGGGTGCCATGATCGCCGTCGAATTGGTAA
                **************************************************

C1              AATCCGGCACGGCTGAGCCCGACCCCGAGCTGACCGAAAAAGTAGCCACC
C2              AATCCGGCACGGCTGAGCCCGACCCCGAGCTGACCGAAAAAGTAGCCACC
C3              AATCCGGCACGGCTGAGCCCGACCCCGAGCTGACCGAAAAAGTAGCCACC
C4              AATCCGGCACGGCTGAGCCCGACCCCGAGCTGACCGAAAAAGTAGCCACC
C5              AATCCGGCACGGCTGAGCCCGACCCCGAGCTGACCGAAAAAGTAGCCACC
C6              AATCCGGCACGGCTGAGCCCGACCCCGAGCTGACCGAAAAAGTAGCCACC
                **************************************************

C1              GCAGCACACGCTACCGGCGTCATCATCTTGACGTGTGGCATGTTCGGCAA
C2              GCAGCACACGCTACCGGCGTCATCATCTTGACGTGTGGCATGTTCGGCAA
C3              GCAGCACACGCTACCGGCGTCATCATCTTGACGTGTGGCATGTTCGGCAA
C4              GCAGCACACGCTACCGGCGTCATCATCTTGACGTGTGGCATGTTCGGCAA
C5              GCAGCACACGCTACCGGCGTCATCATCTTGACGTGTGGCATGTTCGGCAA
C6              GCAGCACACGCTACCGGCGTCATCATCTTGACGTGTGGCATGTTCGGCAA
                **************************************************

C1              CATCATCCGACTGCTGCCGCCTCTGACCATAAGCGACGAACTGTTGGCCG
C2              CATCATCCGACTGCTGCCGCCTCTGACCATAAGCGACGAACTGTTGGCCG
C3              CATCATCCGACTGCTGCCGCCTCTGACCATAAGCGACGAACTGTTGGCCG
C4              CATCATCCGACTGCTGCCGCCTCTGACCATAAGCGACGAACTGTTGGCCG
C5              CATCATCCGACTGCTGCCGCCTCTGACCATAAGCGACGAACTGTTGGCCG
C6              CATCATCCGACTGCTGCCGCCTCTGACCATAAGCGACGAACTGTTGGCCG
                **************************************************

C1              AAGGCCTTGACATCCTAAGCCGGATCCTGGGTGACTTC
C2              AAGGCCTTGACATCCTAAGCCGGATCCTGGGTGACTTC
C3              AAGGCCTTGACATCCTAAGCCGGATCCTGGGTGACTTC
C4              AAGGCCTTGACATCCTAAGCCGGATCCTGGGTGACTTC
C5              AAGGCCTTGACATCCTAAGCCGGATCCTGGGTGACTTC
C6              AAGGCCTTGACATCCTAAGCCGGATCCTGGGTGACTTC
                **************************************



>C1
GTGACCAGCGTCGAGCAGAGCCGTCAGCTGGTCACTGAAATCCCCGGCCC
CGTGTCACTTGAACTAGCCAAACGCCTCAACGCGGCGGTGCCTCGTGGGG
TGGGAGTCACCCTGCCAGTGTTTGTAACGCGCGCCGCCGGCGGCGTTATC
GAGGACGTCGACGGGAACCGGCTTATCGACCTGGGTTCTGGAATCGCCGT
CACCACAATCGGCAACTCGTCGCCTCGCGTTGTGGACGCGGTGCGCGCCC
AGGTGGCCGACTTTACCCACACCTGTTTCATAATCACACCTTACGAGGAG
TACGTCGCCGTCACCGAGCAACTCAATCGAATTACCCCAGGATCCGGCGA
GAAACGCTCGGTGCTGTTCAATTCCGGCGCCGAGGCAGTGGAGAATTCTA
TCAAGGTCGCACGTTCGTACACCCGCAAGCCCGCAGTGGTCGCGTTCGAC
CACGCCTACCACGGTCGCACCAACCTGACAATGGCACTGACCGCCAAGTC
CATGCCGTACAAAAGCGGCTTTGGTCCTTTTGCGCCGGAGATCTACCGGG
CGCCGCTGTCCTACCCCTATCGGGACGGCCTGCTCAACAAAGACCTAGCC
ACCGACGGCAAGTTGGCCGGCGCACGGGCCATCAACGTCATTGAGAAGCA
GGTTGGCGCCGATGACCTGGCTGCCGTGATCATTGAGCCGATCCAGGGCG
AAGGCGGTTTCATCGTCCCGGCCGAAGGGTTTTTAGCTACTTTGCTGGAT
TGGTGCCGCAAGAACAACGTGATGTTCATCGCCGATGAGGTGCAAACGGG
GTTTGCGCGTACCGGCGCCATGTTCGCCTGCGAGCACGATGGAATCGTGC
CCGACCTGATCTGCACCGCCAAGGGCATCGCCGACGGATTGCCGCTGGCG
GCGGTAACCGGACGGGCTGAGATCATGAACGCCCCGCACGTCAGCGGCCT
CGGTGGCACTTTCGGCGGCAACCCGGTCGCCTGCGCGGCGGCTTTGGCAA
CCATCACGACCATCGAGAACGACGGCCTGATCCAGCGAGCCCAACAGATC
GAACGGCTGATCACCGACCGGTTGTTGCGACTTCAGGACGCCGACGATCG
GATAGGTGACGTACGTGGCCGGGGTGCCATGATCGCCGTCGAATTGGTAA
AATCCGGCACGGCTGAGCCCGACCCCGAGCTGACCGAAAAAGTAGCCACC
GCAGCACACGCTACCGGCGTCATCATCTTGACGTGTGGCATGTTCGGCAA
CATCATCCGACTGCTGCCGCCTCTGACCATAAGCGACGAACTGTTGGCCG
AAGGCCTTGACATCCTAAGCCGGATCCTGGGTGACTTC
>C2
GTGACCAGCGTCGAGCAGAGCCGTCAGCTGGTCACTGAAATCCCCGGCCC
CGTGTCACTTGAACTAGCCAAACGCCTCAACGCGGCGGTGCCTCGTGGGG
TGGGAGTCACCCTGCCAGTGTTTGTAACGCGCGCCGCCGGCGGCGTTATC
GAGGACGTCGACGGGAACCGGCTTATCGACCTGGGTTCTGGAATCGCCGT
CACCACAATCGGCAACTCGTCGCCTCGCGTTGTGGACGCGGTGCGCGCCC
AGGTGGCCGACTTTACCCACACCTGTTTCATAATCACACCTTACGAGGAG
TACGTCGCCGTCACCGAGCAACTCAATCGAATTACCCCAGGATCCGGCGA
GAAACGCTCGGTGCTGTTCAATTCCGGCGCCGAGGCAGTGGAGAATTCTA
TCAAGGTCGCACGTTCGTACACCCGCAAGCCCGCAGTGGTCGCGTTCGAC
CACGCCTACCACGGTCGCACCAACCTGACAATGGCACTGACCGCCAAGTC
CATGCCGTACAAAAGCGGCTTTGGTCCTTTTGCGCCGGAGATCTACCGGG
CGCCGCTGTCCTACCCCTATCGGGACGGCCTGCTCAACAAAGACCTAGCC
ACCGACGGCAAGTTGGCCGGCGCACGGGCCATCAACGTCATTGAGAAGCA
GGTTGGCGCCGATGACCTGGCTGCCGTGATCATTGAGCCGATCCAGGGCG
AAGGCGGTTTCATCGTCCCGGCCGAAGGGTTTTTAGCTACTTTGCTGGAT
TGGTGCCGCAAGAACAACGTGATGTTCATCGCCGATGAGGTGCAAACGGG
GTTTGCGCGTACCGGCGCCATGTTCGCCTGCGAGCACGATGGAATCGTGC
CCGACCTGATCTGCACCGCCAAGGGCATCGCCGACGGATTGCCGCTGGCG
GCGGTAACCGGACGGGCTGAGATCATGAACGCCCCGCACGTCAGCGGCCT
CGGTGGCACTTTCGGCGGCAACCCGGTCGCCTGCGCGGCGGCTTTGGCAA
CCATCACGACCATCGAGAACGACGGCCTGATCCAGCGAGCCCAACAGATC
GAACGGCTGATCACCGACCGGTTGTTGCGACTTCAGGACGCCGACGATCG
GATAGGTGACGTACGTGGCCGGGGTGCCATGATCGCCGTCGAATTGGTAA
AATCCGGCACGGCTGAGCCCGACCCCGAGCTGACCGAAAAAGTAGCCACC
GCAGCACACGCTACCGGCGTCATCATCTTGACGTGTGGCATGTTCGGCAA
CATCATCCGACTGCTGCCGCCTCTGACCATAAGCGACGAACTGTTGGCCG
AAGGCCTTGACATCCTAAGCCGGATCCTGGGTGACTTC
>C3
GTGACCAGCGTCGAGCAGAGCCGTCAGCTGGTCACTGAAATCCCCGGCCC
CGTGTCACTTGAACTAGCCAAACGCCTCAACGCGGCGGTGCCTCGTGGGG
TGGGAGTCACCCTGCCAGTGTTTGTAACGCGCGCCGCCGGCGGCGTTATC
GAGGACGTCGACGGGAACCGGCTTATCGACCTGGGTTCTGGAATCGCCGT
CACCACAATCGGCAACTCGTCGCCTCGCGTTGTGGACGCGGTGCGCGCCC
AGGTGGCCGACTTTACCCACACCTGTTTCATAATCACACCTTACGAGGAG
TACGTCGCCGTCACCGAGCAACTCAATCGAATTACCCCAGGATCCGGCGA
GAAACGCTCGGTGCTGTTCAATTCCGGCGCCGAGGCAGTGGAGAATTCTA
TCAAGGTCGCACGTTCGTACACCCGCAAGCCCGCAGTGGTCGCGTTCGAC
CACGCCTACCACGGTCGCACCAACCTGACAATGGCACTGACCGCCAAGTC
CATGCCGTACAAAAGCGGCTTTGGTCCTTTTGCGCCGGAGATCTACCGGG
CGCCGCTGTCCTACCCCTATCGGGACGGCCTGCTCAACAAAGACCTAGCC
ACCGACGGCAAGTTGGCCGGCGCACGGGCCATCAACGTCATTGAGAAGCA
GGTTGGCGCCGATGACCTGGCTGCCGTGATCATTGAGCCGATCCAGGGCG
AAGGCGGTTTCATCGTCCCGGCCGAAGGGTTTTTAGCTACTTTGCTGGAT
TGGTGCCGCAAGAACAACGTGATGTTCATCGCCGATGAGGTGCAAACGGG
GTTTGCGCGTACCGGCGCCATGTTCGCCTGCGAGCACGATGGAATCGTGC
CCGACCTGATCTGCACCGCCAAGGGCATCGCCGACGGATTGCCGCTGGCG
GCGGTAACCGGACGGGCTGAGATCATGAACGCCCCGCACGTCAGCGGCCT
CGGTGGCACTTTCGGCGGCAACCCGGTCGCCTGCGCGGCGGCTTTGGCAA
CCATCACGACCATCGAGAACGACGGCCTGATCCAGCGAGCCCAACAGATC
GAACGGCTGATCACCGACCGGTTGTTGCGACTTCAGGACGCCGACGATCG
GATAGGTGACGTACGTGGCCGGGGTGCCATGATCGCCGTCGAATTGGTAA
AATCCGGCACGGCTGAGCCCGACCCCGAGCTGACCGAAAAAGTAGCCACC
GCAGCACACGCTACCGGCGTCATCATCTTGACGTGTGGCATGTTCGGCAA
CATCATCCGACTGCTGCCGCCTCTGACCATAAGCGACGAACTGTTGGCCG
AAGGCCTTGACATCCTAAGCCGGATCCTGGGTGACTTC
>C4
GTGACCAGCGTCGAGCAGAGCCGTCAGCTGGTCACTGAAATCCCCGGCCC
CGTGTCACTTGAACTAGCCAAACGCCTCAACGCGGCGGTGCCTCGTGGGG
TGGGAGTCACCCTGCCAGTGTTTGTAACGCGCGCCGCCGGCGGCGTTATC
GAGGACGTCGACGGGAACCGGCTTATCGACCTGGGTTCTGGAATCGCCGT
CACCACAATCGGCAACTCGTCGCCTCGCGTTGTGGACGCGGTGCGCGCCC
AGGTGGCCGACTTTACCCACACCTGTTTCATAATCACACCTTACGAGGAG
TACGTCGCCGTCACCGAGCAACTCAATCGAATTACCCCAGGATCCGGCGA
GAAACGCTCGGTGCTGTTCAATTCCGGCGCCGAGGCAGTGGAGAATTCTA
TCAAGGTCGCACGTTCGTACACCCGCAAGCCCGCAGTGGTCGCGTTCGAC
CACGCCTACCACGGTCGCACCAACCTGACAATGGCACTGACCGCCAAGTC
CATGCCGTACAAAAGCGGCTTTGGTCCTTTTGCGCCGGAGATCTACCGGG
CGCCGCTGTCCTACCCCTATCGGGACGGCCTGCTCAACAAAGACCTAGCC
ACCGACGGCAAGTTGGCCGGCGCACGGGCCATCAACGTCATTGAGAAGCA
GGTTGGCGCCGATGACCTGGCTGCCGTGATCATTGAGCCGATCCAGGGCG
AAGGCGGTTTCATCGTCCCGGCCGAAGGGTTTTTAGCTACTTTGCTGGAT
TGGTGCCGCAAGAACAACGTGATGTTCATCGCCGATGAGGTGCAAACGGG
GTTTGCGCGTACCGGCGCCATGTTCGCCTGCGAGCACGATGGAATCGTGC
CCGACCTGATCTGCACCGCCAAGGGCATCGCCGACGGATTGCCGCTGGCG
GCGGTAACCGGACGGGCTGAGATCATGAACGCCCCGCACGTCAGCGGCCT
CGGTGGCACTTTCGGCGGCAACCCGGTCGCCTGCGCGGCGGCTTTGGCAA
CCATCACGACCATCGAGAACGACGGCCTGATCCAGCGAGCCCAACAGATC
GAACGGCTGATCACCGACCGGTTGTTGCGACTTCAGGACGCCGACGATCG
GATAGGTGACGTACGTGGCCGGGGTGCCATGATCGCCGTCGAATTGGTAA
AATCCGGCACGGCTGAGCCCGACCCCGAGCTGACCGAAAAAGTAGCCACC
GCAGCACACGCTACCGGCGTCATCATCTTGACGTGTGGCATGTTCGGCAA
CATCATCCGACTGCTGCCGCCTCTGACCATAAGCGACGAACTGTTGGCCG
AAGGCCTTGACATCCTAAGCCGGATCCTGGGTGACTTC
>C5
GTGACCAGCGTCGAGCAGAGCCGTCAGCTGGTCACTGAAATCCCCGGCCC
CGTGTCACTTGAACTAGCCAAACGCCTCAACGCGGCGGTGCCTCGTGGGG
TGGGAGTCACCCTGCCAGTGTTTGTAACGCGCGCCGCCGGCGGCGTTATC
GAGGACGTCGACGGGAACCGGCTTATCGACCTGGGTTCTGGAATCGCCGT
CACCACAATCGGCAACTCGTCGCCTCGCGTTGTGGACGCGGTGCGCGCCC
AGGTGGCCGACTTTACCCACACCTGTTTCATAATCACACCTTACGAGGAG
TACGTCGCCGTCACCGAGCAACTCAATCGAATTACCCCAGGATCCGGCGA
GAAACGCTCGGTGCTGTTCAATTCCGGCGCCGAGGCAGTGGAGAATTCTA
TCAAGGTCGCACGTTCGTACACCCGCAAGCCCGCAGTGGTCGCGTTCGAC
CACGCCTACCACGGTCGCACCAACCTGACAATGGCACTGACCGCCAAGTC
CATGCCGTACAAAAGCGGCTTTGGTCCTTTTGCGCCGGAGATCTACCGGG
CGCCGCTGTCCTACCCCTATCGGGACGGCCTGCTCAACAAAGACCTAGCC
ACCGACGGCAAGTTGGCCGGCGCACGGGCCATCAACGTCATTGAGAAGCA
GGTTGGCGCCGATGACCTGGCTGCCGTGATCATTGAGCCGATCCAGGGCG
AAGGCGGTTTCATCGTCCCGGCCGAAGGGTTTTTAGCTACTTTGCTGGAT
TGGTGCCGCAAGAACAACGTGATGTTCATCGCCGATGAGGTGCAAACGGG
GTTTGCGCGTACCGGCGCCATGTTCGCCTGCGAGCACGATGGAATCGTGC
CCGACCTGATCTGCACCGCCAAGGGCATCGCCGACGGATTGCCGCTGGCG
GCGGTAACCGGACGGGCTGAGATCATGAACGCCCCGCACGTCAGCGGCCT
CGGTGGCACTTTCGGCGGCAACCCGGTCGCCTGCGCGGCGGCTTTGGCAA
CCATCACGACCATCGAGAACGACGGCCTGATCCAGCGAGCCCAACAGATC
GAACGGCTGATCACCGACCGGTTGTTGCGACTTCAGGACGCCGACGATCG
GATAGGTGACGTACGTGGCCGGGGTGCCATGATCGCCGTCGAATTGGTAA
AATCCGGCACGGCTGAGCCCGACCCCGAGCTGACCGAAAAAGTAGCCACC
GCAGCACACGCTACCGGCGTCATCATCTTGACGTGTGGCATGTTCGGCAA
CATCATCCGACTGCTGCCGCCTCTGACCATAAGCGACGAACTGTTGGCCG
AAGGCCTTGACATCCTAAGCCGGATCCTGGGTGACTTC
>C6
GTGACCAGCGTCGAGCAGAGCCGTCAGCTGGTCACTGAAATCCCCGGCCC
CGTGTCACTTGAACTAGCCAAACGCCTCAACGCGGCGGTGCCTCGTGGGG
TGGGAGTCACCCTGCCAGTGTTTGTAACGCGCGCCGCCGGCGGCGTTATC
GAGGACGTCGACGGGAACCGGCTTATCGACCTGGGTTCTGGAATCGCCGT
CACCACAATCGGCAACTCGTCGCCTCGCGTTGTGGACGCGGTGCGCGCCC
AGGTGGCCGACTTTACCCACACCTGTTTCATAATCACACCTTACGAGGAG
TACGTCGCCGTCACCGAGCAACTCAATCGAATTACCCCAGGATCCGGCGA
GAAACGCTCGGTGCTGTTCAATTCCGGCGCCGAGGCAGTGGAGAATTCTA
TCAAGGTCGCACGTTCGTACACCCGCAAGCCCGCAGTGGTCGCGTTCGAC
CACGCCTACCACGGTCGCACCAACCTGACAATGGCACTGACCGCCAAGTC
CATGCCGTACAAAAGCGGCTTTGGTCCTTTTGCGCCGGAGATCTACCGGG
CGCCGCTGTCCTACCCCTATCGGGACGGCCTGCTCAACAAAGACCTAGCC
ACCGACGGCAAGTTGGCCGGCGCACGGGCCATCAACGTCATTGAGAAGCA
GGTTGGCGCCGATGACCTGGCTGCCGTGATCATTGAGCCGATCCAGGGCG
AAGGCGGTTTCATCGTCCCGGCCGAAGGGTTTTTAGCTACTTTGCTGGAT
TGGTGCCGCAAGAACAACGTGATGTTCATCGCCGATGAGGTGCAAACGGG
GTTTGCGCGTACCGGCGCCATGTTCGCCTGCGAGCACGATGGAATCGTGC
CCGACCTGATCTGCACCGCCAAGGGCATCGCCGACGGATTGCCGCTGGCG
GCGGTAACCGGACGGGCTGAGATCATGAACGCCCCGCACGTCAGCGGCCT
CGGTGGCACTTTCGGCGGCAACCCGGTCGCCTGCGCGGCGGCTTTGGCAA
CCATCACGACCATCGAGAACGACGGCCTGATCCAGCGAGCCCAACAGATC
GAACGGCTGATCACCGACCGGTTGTTGCGACTTCAGGACGCCGACGATCG
GATAGGTGACGTACGTGGCCGGGGTGCCATGATCGCCGTCGAATTGGTAA
AATCCGGCACGGCTGAGCCCGACCCCGAGCTGACCGAAAAAGTAGCCACC
GCAGCACACGCTACCGGCGTCATCATCTTGACGTGTGGCATGTTCGGCAA
CATCATCCGACTGCTGCCGCCTCTGACCATAAGCGACGAACTGTTGGCCG
AAGGCCTTGACATCCTAAGCCGGATCCTGGGTGACTTC
>C1
VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
>C2
VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
>C3
VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
>C4
VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
>C5
VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF
>C6
VTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVI
EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEE
YVAVTEQLNRITPGSGEKRSVLFNSGAEAVENSIKVARSYTRKPAVVAFD
HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLNKDLA
TDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVPAEGFLATLLD
WCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQI
ERLITDRLLRLQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVAT
AAHATGVIILTCGMFGNIIRLLPPLTISDELLAEGLDILSRILGDF


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/2res/gabT/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1338 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789579
      Setting output file names to "/data/2res/gabT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 627713837
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0988674295
      Seed = 1477699470
      Swapseed = 1579789579
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2994.507978 -- -24.965149
         Chain 2 -- -2994.508150 -- -24.965149
         Chain 3 -- -2994.508150 -- -24.965149
         Chain 4 -- -2994.508150 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2994.508150 -- -24.965149
         Chain 2 -- -2994.508150 -- -24.965149
         Chain 3 -- -2994.507978 -- -24.965149
         Chain 4 -- -2994.508150 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2994.508] (-2994.508) (-2994.508) (-2994.508) * [-2994.508] (-2994.508) (-2994.508) (-2994.508) 
        500 -- [-1833.865] (-1877.080) (-1838.187) (-1860.618) * (-1841.821) (-1828.475) (-1857.588) [-1831.323] -- 0:00:00
       1000 -- [-1826.348] (-1832.779) (-1828.045) (-1833.042) * (-1831.581) (-1823.975) (-1830.627) [-1823.525] -- 0:00:00
       1500 -- (-1826.756) (-1832.130) (-1830.750) [-1827.613] * (-1827.013) (-1835.485) [-1828.591] (-1821.697) -- 0:00:00
       2000 -- (-1838.702) [-1829.235] (-1828.174) (-1823.163) * [-1825.761] (-1832.590) (-1828.507) (-1837.353) -- 0:00:00
       2500 -- [-1822.966] (-1826.501) (-1829.297) (-1833.620) * (-1832.182) (-1832.105) [-1823.646] (-1820.726) -- 0:00:00
       3000 -- (-1824.340) (-1832.463) (-1830.243) [-1827.221] * [-1827.972] (-1821.410) (-1824.887) (-1826.654) -- 0:00:00
       3500 -- (-1828.563) (-1826.619) (-1833.481) [-1823.848] * (-1826.368) (-1831.586) (-1826.199) [-1822.466] -- 0:00:00
       4000 -- (-1839.158) (-1825.833) [-1827.907] (-1822.384) * (-1834.342) (-1829.411) [-1825.733] (-1830.383) -- 0:00:00
       4500 -- (-1833.121) (-1832.059) (-1827.665) [-1824.773] * [-1826.369] (-1828.581) (-1832.299) (-1826.929) -- 0:00:00
       5000 -- (-1832.734) (-1836.118) (-1836.016) [-1827.399] * [-1827.796] (-1827.471) (-1827.787) (-1833.688) -- 0:00:00

      Average standard deviation of split frequencies: 0.091662

       5500 -- (-1827.051) (-1823.724) [-1824.048] (-1828.956) * (-1825.287) (-1827.172) [-1823.202] (-1830.883) -- 0:00:00
       6000 -- [-1826.329] (-1823.035) (-1836.280) (-1831.447) * (-1828.076) (-1826.467) [-1827.986] (-1826.529) -- 0:00:00
       6500 -- (-1823.742) [-1825.926] (-1825.573) (-1827.439) * [-1825.939] (-1827.205) (-1829.027) (-1830.237) -- 0:00:00
       7000 -- (-1832.813) (-1827.080) [-1824.065] (-1828.442) * [-1827.982] (-1829.489) (-1829.039) (-1822.727) -- 0:00:00
       7500 -- (-1827.236) (-1836.153) [-1830.972] (-1828.691) * [-1828.873] (-1826.236) (-1832.740) (-1830.935) -- 0:00:00
       8000 -- [-1831.265] (-1823.064) (-1824.076) (-1828.111) * [-1827.325] (-1826.950) (-1827.947) (-1829.651) -- 0:02:04
       8500 -- (-1826.556) [-1819.166] (-1830.752) (-1832.119) * (-1832.105) [-1827.814] (-1828.454) (-1827.925) -- 0:01:56
       9000 -- (-1834.240) (-1824.193) [-1827.043] (-1826.098) * (-1824.209) [-1826.241] (-1825.055) (-1829.303) -- 0:01:50
       9500 -- (-1831.651) (-1824.016) [-1831.763] (-1829.257) * [-1824.517] (-1831.667) (-1827.224) (-1828.083) -- 0:01:44
      10000 -- (-1833.830) (-1824.145) (-1829.841) [-1829.415] * (-1829.695) (-1825.622) (-1822.640) [-1824.683] -- 0:01:39

      Average standard deviation of split frequencies: 0.074327

      10500 -- (-1828.840) [-1824.183] (-1821.600) (-1828.637) * (-1828.144) (-1828.806) (-1834.938) [-1822.835] -- 0:01:34
      11000 -- [-1828.531] (-1820.911) (-1839.203) (-1825.830) * [-1830.718] (-1830.275) (-1821.903) (-1826.078) -- 0:01:29
      11500 -- (-1826.026) [-1820.016] (-1825.255) (-1829.156) * [-1831.137] (-1828.200) (-1831.294) (-1828.270) -- 0:01:25
      12000 -- [-1825.917] (-1820.019) (-1827.703) (-1827.225) * (-1829.025) [-1832.643] (-1830.940) (-1830.704) -- 0:01:22
      12500 -- (-1826.997) (-1816.947) [-1827.708] (-1823.764) * (-1829.190) (-1833.777) (-1829.391) [-1829.029] -- 0:01:19
      13000 -- [-1825.121] (-1816.875) (-1825.358) (-1831.394) * (-1827.186) (-1827.883) [-1827.932] (-1827.143) -- 0:01:15
      13500 -- (-1830.410) [-1818.091] (-1828.741) (-1828.550) * [-1826.200] (-1828.052) (-1829.897) (-1831.087) -- 0:01:13
      14000 -- (-1828.008) (-1819.715) [-1827.039] (-1824.482) * (-1823.483) [-1828.570] (-1825.267) (-1828.525) -- 0:01:10
      14500 -- (-1824.039) (-1818.188) (-1827.047) [-1822.996] * (-1822.485) (-1826.623) [-1824.425] (-1830.240) -- 0:01:07
      15000 -- (-1826.398) (-1818.274) (-1829.742) [-1817.214] * [-1830.317] (-1827.410) (-1826.437) (-1826.387) -- 0:01:05

      Average standard deviation of split frequencies: 0.067764

      15500 -- (-1829.283) (-1818.249) (-1826.146) [-1819.607] * (-1830.707) (-1839.931) (-1826.519) [-1824.824] -- 0:01:03
      16000 -- (-1830.300) (-1817.292) (-1824.560) [-1819.627] * (-1828.427) (-1829.131) [-1826.383] (-1829.489) -- 0:01:01
      16500 -- [-1831.423] (-1816.972) (-1832.848) (-1818.201) * (-1822.938) (-1827.266) [-1827.634] (-1827.283) -- 0:00:59
      17000 -- [-1839.390] (-1818.976) (-1830.799) (-1818.495) * (-1826.324) (-1831.880) (-1829.492) [-1823.188] -- 0:00:57
      17500 -- [-1823.239] (-1820.621) (-1829.909) (-1819.934) * [-1822.541] (-1822.854) (-1827.563) (-1828.085) -- 0:00:56
      18000 -- (-1832.440) [-1820.235] (-1831.688) (-1819.608) * (-1833.420) [-1830.277] (-1829.625) (-1825.842) -- 0:00:54
      18500 -- [-1826.652] (-1817.691) (-1825.421) (-1819.336) * (-1830.336) (-1822.287) (-1830.786) [-1825.317] -- 0:00:53
      19000 -- (-1829.208) (-1817.771) [-1829.420] (-1821.594) * [-1835.403] (-1828.156) (-1827.734) (-1823.111) -- 0:00:51
      19500 -- (-1824.699) (-1816.763) [-1827.523] (-1824.783) * (-1828.025) (-1827.083) (-1834.847) [-1819.439] -- 0:00:50
      20000 -- (-1823.498) (-1820.588) (-1830.244) [-1821.344] * [-1829.772] (-1834.177) (-1834.237) (-1818.750) -- 0:00:49

      Average standard deviation of split frequencies: 0.070964

      20500 -- (-1827.366) (-1818.023) [-1824.931] (-1826.420) * (-1827.008) (-1826.314) (-1826.666) [-1818.441] -- 0:00:47
      21000 -- (-1832.272) (-1818.413) [-1828.605] (-1822.520) * (-1830.673) (-1833.789) (-1827.625) [-1820.966] -- 0:00:46
      21500 -- (-1829.401) (-1818.293) [-1827.878] (-1819.498) * (-1826.178) (-1825.939) [-1827.652] (-1817.979) -- 0:00:45
      22000 -- [-1823.106] (-1816.976) (-1829.062) (-1819.162) * (-1824.801) [-1828.954] (-1834.052) (-1819.884) -- 0:01:28
      22500 -- [-1828.242] (-1817.506) (-1832.097) (-1818.369) * [-1827.545] (-1828.747) (-1837.267) (-1819.639) -- 0:01:26
      23000 -- (-1824.521) [-1817.471] (-1831.896) (-1819.087) * (-1830.497) (-1828.801) (-1833.122) [-1819.122] -- 0:01:24
      23500 -- (-1832.029) [-1818.183] (-1830.695) (-1819.181) * (-1829.363) (-1831.745) [-1819.579] (-1819.602) -- 0:01:23
      24000 -- [-1824.030] (-1819.514) (-1826.530) (-1818.597) * [-1824.073] (-1823.767) (-1826.605) (-1818.809) -- 0:01:21
      24500 -- (-1826.123) [-1820.224] (-1825.584) (-1818.836) * [-1824.865] (-1829.631) (-1830.754) (-1819.492) -- 0:01:19
      25000 -- (-1827.231) (-1818.919) [-1824.495] (-1821.933) * (-1826.396) [-1831.623] (-1826.337) (-1819.106) -- 0:01:18

      Average standard deviation of split frequencies: 0.052745

      25500 -- [-1827.504] (-1817.961) (-1827.071) (-1818.738) * [-1830.349] (-1822.052) (-1829.771) (-1818.644) -- 0:01:16
      26000 -- (-1824.269) [-1817.573] (-1825.191) (-1820.825) * (-1827.248) [-1826.006] (-1825.460) (-1821.178) -- 0:01:14
      26500 -- (-1826.451) (-1817.610) [-1827.169] (-1821.488) * (-1827.200) [-1820.283] (-1833.180) (-1824.422) -- 0:01:13
      27000 -- (-1829.222) (-1818.054) [-1834.342] (-1818.681) * [-1825.743] (-1832.273) (-1828.866) (-1821.001) -- 0:01:12
      27500 -- (-1825.788) (-1819.049) [-1830.129] (-1820.696) * [-1824.121] (-1830.151) (-1823.067) (-1820.327) -- 0:01:10
      28000 -- (-1823.280) [-1818.297] (-1826.251) (-1818.560) * (-1823.615) (-1823.638) (-1833.681) [-1818.270] -- 0:01:09
      28500 -- [-1821.327] (-1821.807) (-1824.214) (-1819.895) * (-1829.708) (-1828.086) [-1826.976] (-1817.473) -- 0:01:08
      29000 -- (-1831.236) (-1821.567) [-1823.158] (-1818.107) * (-1823.468) [-1824.653] (-1829.446) (-1817.440) -- 0:01:06
      29500 -- [-1821.788] (-1818.749) (-1822.203) (-1820.068) * [-1829.512] (-1824.267) (-1828.545) (-1816.552) -- 0:01:05
      30000 -- (-1829.427) (-1819.004) [-1823.659] (-1821.199) * (-1832.444) [-1821.963] (-1828.335) (-1816.610) -- 0:01:04

      Average standard deviation of split frequencies: 0.035868

      30500 -- (-1833.998) (-1817.747) (-1822.034) [-1816.648] * (-1831.021) [-1828.016] (-1841.726) (-1817.142) -- 0:01:03
      31000 -- [-1823.493] (-1820.972) (-1825.027) (-1819.276) * (-1838.634) (-1830.393) (-1829.453) [-1817.729] -- 0:01:02
      31500 -- (-1829.052) (-1819.808) (-1828.926) [-1820.339] * (-1828.420) [-1823.102] (-1827.351) (-1817.459) -- 0:01:01
      32000 -- (-1833.985) (-1822.269) [-1824.389] (-1817.117) * (-1831.681) [-1833.241] (-1832.249) (-1819.234) -- 0:01:00
      32500 -- [-1831.643] (-1820.174) (-1827.218) (-1817.474) * (-1834.210) [-1826.481] (-1823.740) (-1818.910) -- 0:00:59
      33000 -- (-1836.036) (-1820.802) (-1832.939) [-1817.398] * (-1831.765) (-1827.439) [-1828.303] (-1818.028) -- 0:00:58
      33500 -- (-1829.572) (-1819.896) [-1824.107] (-1821.870) * [-1826.624] (-1823.407) (-1829.975) (-1818.798) -- 0:00:57
      34000 -- (-1832.170) [-1819.464] (-1833.186) (-1818.874) * (-1828.252) [-1824.121] (-1831.516) (-1818.735) -- 0:00:56
      34500 -- [-1830.359] (-1818.526) (-1831.930) (-1819.115) * (-1831.673) (-1829.998) [-1824.738] (-1820.425) -- 0:00:55
      35000 -- (-1828.190) (-1818.448) [-1827.946] (-1819.081) * (-1827.213) (-1826.022) [-1829.068] (-1824.276) -- 0:00:55

      Average standard deviation of split frequencies: 0.034701

      35500 -- (-1825.814) [-1817.382] (-1828.749) (-1819.385) * (-1825.546) (-1825.791) [-1831.496] (-1822.754) -- 0:00:54
      36000 -- (-1826.789) [-1817.382] (-1844.379) (-1818.453) * (-1828.034) [-1828.102] (-1826.675) (-1822.972) -- 0:00:53
      36500 -- (-1832.930) [-1820.715] (-1820.272) (-1816.676) * (-1836.944) (-1823.343) [-1830.084] (-1821.779) -- 0:00:52
      37000 -- (-1832.059) [-1822.111] (-1818.832) (-1817.667) * (-1823.700) (-1829.171) [-1828.828] (-1822.206) -- 0:01:18
      37500 -- (-1827.526) (-1817.905) [-1823.872] (-1817.009) * [-1825.665] (-1831.239) (-1824.612) (-1819.643) -- 0:01:17
      38000 -- [-1827.564] (-1817.722) (-1821.606) (-1819.372) * (-1822.666) (-1827.409) (-1824.325) [-1821.321] -- 0:01:15
      38500 -- [-1826.402] (-1817.827) (-1821.251) (-1819.458) * [-1820.882] (-1834.421) (-1826.165) (-1819.320) -- 0:01:14
      39000 -- (-1827.420) (-1817.827) (-1819.149) [-1818.051] * (-1834.969) (-1828.121) (-1829.350) [-1817.904] -- 0:01:13
      39500 -- (-1823.060) (-1817.709) (-1818.803) [-1817.475] * (-1833.123) (-1824.447) [-1830.234] (-1820.002) -- 0:01:12
      40000 -- [-1823.654] (-1818.960) (-1817.543) (-1819.447) * (-1831.332) (-1822.059) [-1827.358] (-1818.174) -- 0:01:12

      Average standard deviation of split frequencies: 0.034776

      40500 -- (-1824.672) (-1818.601) [-1816.988] (-1826.856) * [-1830.035] (-1828.142) (-1832.741) (-1818.714) -- 0:01:11
      41000 -- (-1828.744) (-1819.707) (-1817.323) [-1819.965] * [-1826.756] (-1822.957) (-1820.597) (-1817.323) -- 0:01:10
      41500 -- (-1827.788) [-1818.337] (-1817.150) (-1821.823) * (-1828.237) (-1827.923) (-1820.185) [-1817.324] -- 0:01:09
      42000 -- [-1823.072] (-1819.657) (-1819.590) (-1822.938) * (-1823.713) (-1830.810) (-1817.752) [-1817.654] -- 0:01:08
      42500 -- (-1830.731) (-1820.050) (-1821.101) [-1821.078] * (-1829.079) (-1830.928) [-1820.186] (-1818.484) -- 0:01:07
      43000 -- (-1831.361) [-1819.106] (-1820.792) (-1816.951) * (-1827.960) [-1824.016] (-1819.711) (-1819.371) -- 0:01:06
      43500 -- (-1828.838) (-1819.198) (-1821.299) [-1816.875] * (-1830.373) [-1835.761] (-1817.750) (-1817.291) -- 0:01:05
      44000 -- (-1829.522) (-1820.159) (-1824.036) [-1816.905] * (-1829.977) [-1829.424] (-1823.265) (-1817.491) -- 0:01:05
      44500 -- (-1838.065) (-1820.568) (-1821.540) [-1816.538] * (-1823.660) [-1828.837] (-1821.964) (-1817.473) -- 0:01:04
      45000 -- [-1825.350] (-1823.915) (-1821.709) (-1816.431) * (-1833.475) (-1828.677) [-1821.005] (-1817.809) -- 0:01:03

      Average standard deviation of split frequencies: 0.034331

      45500 -- (-1826.683) [-1819.953] (-1823.105) (-1820.599) * (-1830.580) [-1828.678] (-1818.828) (-1817.837) -- 0:01:02
      46000 -- [-1827.894] (-1817.983) (-1821.577) (-1818.662) * [-1831.533] (-1829.747) (-1817.371) (-1817.936) -- 0:01:02
      46500 -- (-1823.082) [-1818.034] (-1820.125) (-1819.490) * [-1824.912] (-1831.785) (-1820.596) (-1818.135) -- 0:01:01
      47000 -- [-1824.447] (-1817.969) (-1823.283) (-1822.064) * [-1832.360] (-1829.292) (-1820.572) (-1818.654) -- 0:01:00
      47500 -- [-1830.777] (-1818.813) (-1823.716) (-1820.152) * [-1832.638] (-1835.773) (-1819.444) (-1816.850) -- 0:01:00
      48000 -- (-1827.846) (-1819.759) [-1820.155] (-1817.316) * [-1824.549] (-1828.732) (-1819.070) (-1818.519) -- 0:00:59
      48500 -- [-1828.954] (-1822.402) (-1819.980) (-1820.899) * (-1827.979) [-1828.967] (-1821.745) (-1817.913) -- 0:00:58
      49000 -- [-1824.188] (-1817.892) (-1818.980) (-1820.293) * [-1823.680] (-1823.307) (-1819.860) (-1816.844) -- 0:00:58
      49500 -- [-1827.608] (-1817.998) (-1816.856) (-1819.888) * (-1823.161) (-1832.149) [-1817.316] (-1817.200) -- 0:00:57
      50000 -- (-1829.478) [-1817.597] (-1817.035) (-1819.189) * (-1828.326) [-1827.128] (-1816.852) (-1819.104) -- 0:00:57

      Average standard deviation of split frequencies: 0.034768

      50500 -- (-1827.078) [-1817.649] (-1817.645) (-1819.148) * [-1822.607] (-1826.688) (-1817.344) (-1818.392) -- 0:00:56
      51000 -- (-1824.851) [-1819.449] (-1820.142) (-1819.306) * (-1832.719) [-1827.830] (-1817.794) (-1819.293) -- 0:00:55
      51500 -- (-1825.652) [-1819.758] (-1818.931) (-1820.852) * [-1828.250] (-1824.358) (-1818.314) (-1818.852) -- 0:01:13
      52000 -- (-1830.252) [-1819.763] (-1819.381) (-1820.049) * (-1831.228) (-1829.782) (-1817.487) [-1818.957] -- 0:01:12
      52500 -- (-1824.807) (-1820.132) [-1818.791] (-1822.251) * (-1831.258) [-1829.155] (-1816.996) (-1817.324) -- 0:01:12
      53000 -- (-1834.481) (-1819.732) [-1819.204] (-1822.711) * (-1827.512) (-1829.173) (-1817.335) [-1817.427] -- 0:01:11
      53500 -- [-1828.075] (-1819.405) (-1819.081) (-1822.516) * (-1826.106) (-1829.418) [-1817.221] (-1819.595) -- 0:01:10
      54000 -- (-1830.825) (-1822.201) (-1819.958) [-1819.659] * (-1827.490) [-1823.854] (-1817.677) (-1824.121) -- 0:01:10
      54500 -- (-1838.157) (-1817.719) (-1820.390) [-1819.103] * (-1829.621) [-1823.308] (-1818.081) (-1820.955) -- 0:01:09
      55000 -- (-1833.934) [-1817.855] (-1825.211) (-1818.032) * (-1827.639) (-1829.099) (-1818.996) [-1820.971] -- 0:01:08

      Average standard deviation of split frequencies: 0.032343

      55500 -- (-1826.089) (-1818.189) (-1819.669) [-1817.121] * [-1826.061] (-1836.102) (-1818.319) (-1820.086) -- 0:01:08
      56000 -- (-1826.828) [-1816.556] (-1823.052) (-1817.326) * (-1821.363) (-1827.261) (-1818.734) [-1819.577] -- 0:01:07
      56500 -- (-1832.815) [-1821.081] (-1819.165) (-1819.527) * [-1824.891] (-1828.889) (-1817.755) (-1819.503) -- 0:01:06
      57000 -- [-1825.927] (-1816.568) (-1819.451) (-1818.593) * (-1823.434) [-1825.796] (-1818.014) (-1820.541) -- 0:01:06
      57500 -- (-1826.241) (-1818.955) (-1820.252) [-1818.027] * [-1826.977] (-1830.366) (-1818.565) (-1820.708) -- 0:01:05
      58000 -- [-1824.079] (-1817.879) (-1819.173) (-1818.622) * (-1833.389) (-1826.804) [-1818.684] (-1820.199) -- 0:01:04
      58500 -- (-1837.005) (-1817.879) (-1817.924) [-1818.741] * (-1833.283) (-1822.438) [-1816.868] (-1817.169) -- 0:01:04
      59000 -- (-1823.161) [-1818.818] (-1818.326) (-1819.707) * (-1822.169) (-1824.484) (-1819.080) [-1817.118] -- 0:01:03
      59500 -- (-1826.077) (-1816.897) [-1823.679] (-1820.484) * (-1817.169) (-1825.540) (-1819.763) [-1817.351] -- 0:01:03
      60000 -- (-1830.228) (-1820.895) (-1822.620) [-1818.702] * [-1817.216] (-1830.699) (-1818.277) (-1820.326) -- 0:01:02

      Average standard deviation of split frequencies: 0.029787

      60500 -- (-1828.050) (-1818.893) [-1822.019] (-1819.747) * (-1817.666) (-1832.038) [-1819.016] (-1818.457) -- 0:01:02
      61000 -- (-1833.901) (-1818.309) [-1819.360] (-1819.080) * (-1820.181) [-1825.248] (-1818.681) (-1817.823) -- 0:01:01
      61500 -- (-1825.489) [-1818.073] (-1821.994) (-1821.445) * (-1818.081) [-1835.965] (-1818.270) (-1817.567) -- 0:01:01
      62000 -- (-1833.335) [-1817.141] (-1825.287) (-1820.107) * [-1820.099] (-1822.359) (-1819.437) (-1820.913) -- 0:01:00
      62500 -- (-1826.315) (-1818.724) (-1821.253) [-1819.307] * [-1824.980] (-1831.884) (-1817.464) (-1817.546) -- 0:01:00
      63000 -- (-1829.322) [-1816.957] (-1820.055) (-1819.416) * (-1817.549) (-1834.468) (-1819.353) [-1818.016] -- 0:00:59
      63500 -- (-1824.686) (-1821.853) (-1820.302) [-1818.335] * (-1817.256) (-1822.104) [-1817.346] (-1818.880) -- 0:00:58
      64000 -- (-1825.046) (-1819.032) (-1817.072) [-1820.266] * [-1816.385] (-1822.667) (-1820.761) (-1822.306) -- 0:00:58
      64500 -- (-1827.808) (-1820.543) [-1817.290] (-1818.796) * (-1819.013) [-1828.423] (-1821.357) (-1822.809) -- 0:00:58
      65000 -- (-1830.721) [-1817.360] (-1817.933) (-1817.967) * (-1818.478) (-1826.188) [-1818.484] (-1820.105) -- 0:00:57

      Average standard deviation of split frequencies: 0.032311

      65500 -- (-1823.102) (-1818.428) (-1817.496) [-1818.338] * [-1819.636] (-1837.628) (-1820.159) (-1820.952) -- 0:00:57
      66000 -- [-1829.851] (-1818.296) (-1817.657) (-1817.306) * (-1818.882) (-1825.277) (-1818.582) [-1817.452] -- 0:00:56
      66500 -- [-1826.453] (-1817.444) (-1817.661) (-1816.612) * (-1821.238) [-1828.477] (-1818.957) (-1818.688) -- 0:00:56
      67000 -- (-1835.593) [-1818.169] (-1817.710) (-1821.591) * (-1820.048) [-1830.111] (-1818.437) (-1818.213) -- 0:01:09
      67500 -- (-1827.315) (-1818.785) [-1818.875] (-1818.261) * (-1817.606) [-1823.929] (-1818.087) (-1817.309) -- 0:01:09
      68000 -- [-1830.917] (-1818.001) (-1819.597) (-1817.964) * (-1819.093) (-1832.037) (-1819.306) [-1816.914] -- 0:01:08
      68500 -- [-1831.039] (-1817.527) (-1818.516) (-1817.349) * (-1821.668) (-1835.593) [-1817.838] (-1819.659) -- 0:01:07
      69000 -- (-1826.414) [-1819.168] (-1818.346) (-1821.300) * (-1819.488) (-1826.894) (-1821.890) [-1820.549] -- 0:01:07
      69500 -- [-1828.173] (-1820.846) (-1817.512) (-1817.167) * (-1820.508) (-1825.569) (-1821.068) [-1818.407] -- 0:01:06
      70000 -- (-1830.510) (-1817.916) (-1817.399) [-1818.755] * [-1818.690] (-1833.213) (-1817.576) (-1820.185) -- 0:01:06

      Average standard deviation of split frequencies: 0.031501

      70500 -- (-1828.642) (-1818.643) [-1817.283] (-1818.636) * (-1817.308) [-1830.579] (-1819.617) (-1821.102) -- 0:01:05
      71000 -- (-1830.984) [-1819.079] (-1818.510) (-1819.449) * (-1819.094) (-1821.361) (-1819.584) [-1821.837] -- 0:01:05
      71500 -- (-1836.009) (-1817.375) [-1822.207] (-1820.158) * (-1820.101) [-1830.939] (-1820.109) (-1826.437) -- 0:01:04
      72000 -- (-1820.710) (-1818.683) (-1822.359) [-1818.396] * (-1820.162) [-1829.014] (-1819.271) (-1817.400) -- 0:01:04
      72500 -- [-1822.907] (-1816.983) (-1817.596) (-1817.122) * (-1819.722) (-1826.130) [-1819.125] (-1817.371) -- 0:01:03
      73000 -- (-1830.304) (-1817.369) (-1817.174) [-1819.879] * (-1819.375) [-1828.289] (-1817.488) (-1816.895) -- 0:01:03
      73500 -- (-1831.472) (-1818.955) [-1818.153] (-1818.200) * (-1819.374) [-1826.814] (-1818.231) (-1817.412) -- 0:01:03
      74000 -- (-1835.530) (-1819.376) (-1818.022) [-1819.745] * (-1818.807) (-1836.583) (-1818.231) [-1817.046] -- 0:01:02
      74500 -- (-1824.163) [-1817.804] (-1818.965) (-1818.857) * (-1816.543) (-1825.915) [-1820.235] (-1817.148) -- 0:01:02
      75000 -- [-1821.505] (-1817.580) (-1822.359) (-1817.449) * (-1816.543) [-1825.553] (-1819.391) (-1816.865) -- 0:01:01

      Average standard deviation of split frequencies: 0.033625

      75500 -- (-1824.848) [-1819.154] (-1819.450) (-1817.519) * (-1819.200) (-1821.839) [-1819.095] (-1818.615) -- 0:01:01
      76000 -- (-1824.852) [-1817.461] (-1816.869) (-1817.746) * (-1819.989) (-1826.753) (-1823.301) [-1819.077] -- 0:01:00
      76500 -- [-1826.713] (-1816.798) (-1817.844) (-1818.578) * (-1819.032) (-1827.031) (-1823.502) [-1816.873] -- 0:01:00
      77000 -- (-1833.005) (-1816.845) (-1821.552) [-1819.514] * (-1819.273) (-1834.285) [-1820.815] (-1817.463) -- 0:00:59
      77500 -- (-1838.445) (-1819.806) (-1820.427) [-1817.762] * (-1817.745) [-1827.730] (-1820.726) (-1818.810) -- 0:00:59
      78000 -- (-1846.230) (-1817.268) (-1820.615) [-1817.810] * [-1817.160] (-1828.360) (-1817.044) (-1816.941) -- 0:00:59
      78500 -- (-1822.346) (-1820.911) (-1821.729) [-1818.995] * [-1817.524] (-1824.148) (-1819.203) (-1818.412) -- 0:00:58
      79000 -- (-1818.537) (-1822.751) (-1824.366) [-1816.684] * (-1819.961) [-1820.151] (-1818.635) (-1818.947) -- 0:00:58
      79500 -- [-1819.589] (-1823.004) (-1825.114) (-1820.347) * [-1818.491] (-1833.644) (-1817.605) (-1817.479) -- 0:00:57
      80000 -- (-1818.319) (-1825.624) (-1817.887) [-1822.497] * [-1818.257] (-1829.162) (-1817.558) (-1817.237) -- 0:00:57

      Average standard deviation of split frequencies: 0.031492

      80500 -- (-1820.263) [-1817.834] (-1817.262) (-1826.784) * [-1820.087] (-1833.895) (-1827.603) (-1817.604) -- 0:00:57
      81000 -- (-1818.274) (-1818.390) [-1816.798] (-1823.109) * [-1820.555] (-1830.153) (-1818.162) (-1817.245) -- 0:00:56
      81500 -- (-1817.499) [-1818.108] (-1816.720) (-1822.063) * (-1816.530) (-1833.162) [-1817.724] (-1818.087) -- 0:00:56
      82000 -- (-1818.333) [-1820.457] (-1818.620) (-1817.810) * [-1816.431] (-1833.326) (-1819.953) (-1817.383) -- 0:00:55
      82500 -- (-1816.497) (-1823.599) [-1818.101] (-1817.453) * (-1816.550) [-1826.003] (-1820.640) (-1817.821) -- 0:00:55
      83000 -- (-1818.988) [-1827.116] (-1817.858) (-1820.549) * (-1817.321) [-1833.716] (-1820.275) (-1816.943) -- 0:01:06
      83500 -- [-1819.304] (-1819.036) (-1817.374) (-1819.838) * (-1817.789) (-1833.105) [-1819.452] (-1817.796) -- 0:01:05
      84000 -- (-1816.497) (-1817.434) [-1816.644] (-1817.216) * (-1820.062) [-1828.662] (-1820.876) (-1818.037) -- 0:01:05
      84500 -- [-1816.496] (-1817.256) (-1820.465) (-1816.824) * (-1822.705) [-1823.604] (-1818.709) (-1817.379) -- 0:01:05
      85000 -- [-1817.136] (-1817.654) (-1817.384) (-1820.004) * (-1818.289) (-1831.247) [-1818.647] (-1817.484) -- 0:01:04

      Average standard deviation of split frequencies: 0.029715

      85500 -- [-1817.293] (-1818.474) (-1817.391) (-1819.600) * (-1818.431) [-1830.188] (-1818.773) (-1818.858) -- 0:01:04
      86000 -- (-1818.843) (-1820.379) [-1816.893] (-1818.805) * [-1817.993] (-1832.136) (-1818.802) (-1823.044) -- 0:01:03
      86500 -- [-1819.457] (-1817.505) (-1816.992) (-1818.447) * [-1818.206] (-1833.882) (-1820.271) (-1817.640) -- 0:01:03
      87000 -- (-1818.107) [-1817.226] (-1818.413) (-1818.160) * [-1817.657] (-1831.749) (-1821.156) (-1818.581) -- 0:01:02
      87500 -- (-1816.743) (-1817.811) [-1821.041] (-1821.515) * (-1817.665) [-1823.966] (-1820.506) (-1819.051) -- 0:01:02
      88000 -- (-1817.383) (-1818.149) [-1819.965] (-1822.625) * (-1818.779) (-1825.400) (-1820.130) [-1819.062] -- 0:01:02
      88500 -- (-1817.369) (-1820.180) [-1816.860] (-1820.118) * [-1818.063] (-1834.581) (-1820.198) (-1818.531) -- 0:01:01
      89000 -- (-1817.751) (-1819.237) [-1818.810] (-1820.723) * [-1817.888] (-1845.609) (-1817.385) (-1817.799) -- 0:01:01
      89500 -- (-1818.091) (-1820.868) (-1816.283) [-1821.833] * (-1818.177) (-1825.872) [-1817.618] (-1820.441) -- 0:01:01
      90000 -- (-1818.386) [-1820.577] (-1816.504) (-1820.649) * [-1819.954] (-1818.105) (-1816.871) (-1818.253) -- 0:01:00

      Average standard deviation of split frequencies: 0.029463

      90500 -- [-1817.071] (-1816.569) (-1817.149) (-1817.974) * (-1817.181) (-1820.025) [-1817.737] (-1818.253) -- 0:01:00
      91000 -- [-1818.588] (-1817.299) (-1816.919) (-1819.090) * [-1816.870] (-1821.477) (-1820.006) (-1820.792) -- 0:00:59
      91500 -- [-1817.259] (-1818.132) (-1816.939) (-1817.516) * (-1817.855) [-1822.425] (-1817.036) (-1818.311) -- 0:00:59
      92000 -- (-1817.154) (-1818.313) (-1817.216) [-1819.086] * [-1818.818] (-1821.880) (-1818.875) (-1818.371) -- 0:00:59
      92500 -- (-1817.061) [-1822.195] (-1820.185) (-1819.073) * (-1818.332) (-1821.117) (-1817.487) [-1816.820] -- 0:00:58
      93000 -- [-1816.885] (-1820.979) (-1820.289) (-1819.426) * [-1818.856] (-1818.188) (-1817.369) (-1817.566) -- 0:00:58
      93500 -- (-1817.457) (-1819.163) (-1821.147) [-1818.834] * (-1817.561) (-1817.664) [-1819.334] (-1817.558) -- 0:00:58
      94000 -- (-1817.493) (-1818.867) (-1819.401) [-1820.236] * [-1819.375] (-1817.895) (-1819.551) (-1816.501) -- 0:00:57
      94500 -- (-1817.253) (-1818.387) (-1819.156) [-1818.131] * (-1818.039) [-1821.688] (-1817.283) (-1816.597) -- 0:00:57
      95000 -- [-1817.242] (-1817.655) (-1821.642) (-1818.091) * (-1818.581) [-1820.132] (-1817.206) (-1818.723) -- 0:00:57

      Average standard deviation of split frequencies: 0.025780

      95500 -- (-1819.181) (-1816.989) (-1823.368) [-1819.143] * (-1819.622) (-1821.505) (-1817.112) [-1818.041] -- 0:00:56
      96000 -- (-1824.964) (-1816.637) [-1821.351] (-1821.585) * (-1818.372) (-1823.482) [-1816.897] (-1819.372) -- 0:00:56
      96500 -- [-1817.286] (-1816.857) (-1819.879) (-1819.715) * (-1818.237) (-1821.870) [-1818.399] (-1820.248) -- 0:00:56
      97000 -- (-1817.246) (-1816.987) [-1819.078] (-1820.007) * [-1818.277] (-1821.626) (-1816.942) (-1821.443) -- 0:00:55
      97500 -- (-1820.070) (-1819.301) (-1819.630) [-1819.875] * [-1818.318] (-1820.298) (-1816.674) (-1816.556) -- 0:00:55
      98000 -- (-1816.716) (-1818.989) (-1818.845) [-1818.156] * (-1822.239) (-1823.323) (-1819.112) [-1818.450] -- 0:00:55
      98500 -- (-1816.716) (-1817.491) (-1819.523) [-1818.242] * (-1818.529) (-1823.760) [-1820.350] (-1820.000) -- 0:01:04
      99000 -- (-1816.972) (-1817.789) [-1819.385] (-1820.434) * [-1818.420] (-1819.303) (-1817.376) (-1816.520) -- 0:01:03
      99500 -- (-1816.866) (-1818.566) (-1822.272) [-1817.848] * (-1820.016) [-1821.135] (-1819.978) (-1818.923) -- 0:01:03
      100000 -- (-1817.098) (-1816.688) (-1819.747) [-1817.197] * [-1823.534] (-1823.188) (-1819.917) (-1818.256) -- 0:01:02

      Average standard deviation of split frequencies: 0.024117

      100500 -- [-1817.591] (-1818.074) (-1818.177) (-1821.810) * (-1821.375) (-1820.326) [-1818.446] (-1819.509) -- 0:01:02
      101000 -- [-1817.368] (-1818.298) (-1818.393) (-1818.978) * (-1821.136) (-1818.995) [-1816.926] (-1819.286) -- 0:01:02
      101500 -- (-1816.879) (-1818.600) [-1818.806] (-1818.590) * (-1820.754) (-1821.317) [-1816.873] (-1817.719) -- 0:01:01
      102000 -- (-1816.940) [-1820.864] (-1818.468) (-1818.239) * (-1820.640) (-1821.051) [-1816.994] (-1818.021) -- 0:01:01
      102500 -- (-1816.704) (-1819.266) (-1819.881) [-1818.635] * (-1819.857) [-1818.545] (-1816.983) (-1819.018) -- 0:01:01
      103000 -- (-1816.565) (-1820.375) (-1820.908) [-1818.618] * (-1819.970) (-1819.800) (-1818.445) [-1818.312] -- 0:01:00
      103500 -- [-1817.272] (-1822.267) (-1823.120) (-1817.969) * (-1820.481) (-1819.317) [-1820.865] (-1816.979) -- 0:01:00
      104000 -- (-1817.995) (-1818.248) (-1817.528) [-1818.606] * [-1822.141] (-1817.821) (-1825.185) (-1816.708) -- 0:01:00
      104500 -- (-1818.361) (-1817.656) [-1817.237] (-1817.684) * (-1820.530) (-1818.709) (-1821.848) [-1816.667] -- 0:00:59
      105000 -- (-1816.861) (-1819.551) (-1818.907) [-1820.651] * (-1820.711) [-1819.517] (-1822.051) (-1820.160) -- 0:00:59

      Average standard deviation of split frequencies: 0.020457

      105500 -- (-1817.149) (-1819.005) [-1820.191] (-1819.913) * (-1817.085) (-1819.747) [-1818.056] (-1821.213) -- 0:00:59
      106000 -- (-1819.588) (-1822.275) [-1821.042] (-1819.118) * (-1823.281) (-1821.091) [-1817.336] (-1823.794) -- 0:00:59
      106500 -- (-1820.315) (-1818.813) (-1820.045) [-1818.678] * (-1818.558) (-1820.088) [-1817.541] (-1818.892) -- 0:00:58
      107000 -- (-1818.899) (-1818.171) [-1819.930] (-1818.895) * (-1817.993) [-1818.230] (-1817.519) (-1821.163) -- 0:00:58
      107500 -- [-1816.628] (-1817.879) (-1822.667) (-1818.613) * (-1817.467) [-1820.024] (-1818.071) (-1818.312) -- 0:00:58
      108000 -- (-1817.920) (-1817.347) [-1818.916] (-1820.220) * (-1822.815) [-1819.420] (-1820.663) (-1818.346) -- 0:00:57
      108500 -- (-1816.506) (-1817.135) (-1819.782) [-1818.160] * (-1821.737) (-1818.337) (-1817.522) [-1818.569] -- 0:00:57
      109000 -- (-1817.584) (-1819.068) [-1820.662] (-1817.136) * [-1816.926] (-1820.397) (-1818.405) (-1819.741) -- 0:00:57
      109500 -- (-1820.242) (-1818.729) [-1817.254] (-1817.136) * (-1817.184) (-1821.723) [-1818.318] (-1820.043) -- 0:00:56
      110000 -- [-1816.465] (-1823.426) (-1817.225) (-1817.138) * (-1817.365) [-1821.892] (-1817.842) (-1819.354) -- 0:00:56

      Average standard deviation of split frequencies: 0.019169

      110500 -- (-1818.151) (-1819.202) [-1816.548] (-1817.133) * [-1818.679] (-1820.509) (-1819.390) (-1822.133) -- 0:00:56
      111000 -- (-1817.205) (-1820.946) [-1816.882] (-1821.251) * [-1819.802] (-1820.355) (-1823.391) (-1823.126) -- 0:00:56
      111500 -- (-1818.946) (-1818.418) [-1817.261] (-1819.194) * (-1817.804) (-1820.782) (-1821.517) [-1819.987] -- 0:00:55
      112000 -- (-1818.203) (-1817.610) [-1817.253] (-1820.052) * (-1818.011) [-1818.840] (-1819.238) (-1819.923) -- 0:00:55
      112500 -- (-1817.582) (-1818.356) (-1820.548) [-1817.447] * (-1817.536) [-1820.036] (-1817.508) (-1820.101) -- 0:00:55
      113000 -- (-1818.039) [-1817.310] (-1818.383) (-1818.923) * (-1817.576) (-1820.797) (-1817.509) [-1817.943] -- 0:00:54
      113500 -- (-1818.268) (-1816.929) (-1817.865) [-1822.758] * (-1818.216) (-1818.122) [-1818.116] (-1818.316) -- 0:00:54
      114000 -- (-1818.489) (-1823.225) [-1818.221] (-1824.943) * (-1818.949) [-1820.529] (-1820.605) (-1817.611) -- 0:01:02
      114500 -- (-1819.986) (-1823.024) [-1816.670] (-1817.667) * (-1818.926) [-1819.213] (-1818.168) (-1818.020) -- 0:01:01
      115000 -- (-1820.954) [-1819.443] (-1816.609) (-1819.774) * [-1818.291] (-1820.130) (-1817.611) (-1817.894) -- 0:01:01

      Average standard deviation of split frequencies: 0.022351

      115500 -- (-1817.678) (-1818.465) [-1816.848] (-1818.991) * (-1818.624) (-1818.678) (-1821.685) [-1819.050] -- 0:01:01
      116000 -- (-1820.808) (-1818.454) (-1816.886) [-1819.176] * (-1821.134) (-1818.683) (-1820.534) [-1817.898] -- 0:01:00
      116500 -- (-1819.799) (-1818.649) [-1818.083] (-1819.666) * [-1818.836] (-1820.062) (-1818.099) (-1820.378) -- 0:01:00
      117000 -- (-1818.652) [-1817.619] (-1819.518) (-1822.300) * (-1817.273) (-1820.094) (-1817.638) [-1818.817] -- 0:01:00
      117500 -- (-1826.405) [-1817.618] (-1818.714) (-1823.768) * (-1817.760) (-1819.151) (-1818.609) [-1820.344] -- 0:01:00
      118000 -- (-1824.368) [-1820.193] (-1817.831) (-1822.064) * (-1818.541) (-1819.151) (-1821.748) [-1820.411] -- 0:00:59
      118500 -- (-1825.555) (-1818.478) [-1817.595] (-1821.797) * (-1819.889) (-1818.008) (-1820.869) [-1817.376] -- 0:00:59
      119000 -- (-1823.871) [-1816.322] (-1816.535) (-1819.915) * (-1819.133) (-1820.103) (-1819.305) [-1817.323] -- 0:00:59
      119500 -- (-1817.177) (-1816.395) [-1816.516] (-1821.773) * [-1816.787] (-1818.238) (-1819.454) (-1818.722) -- 0:00:58
      120000 -- (-1819.131) (-1818.065) (-1817.574) [-1818.145] * [-1816.793] (-1818.362) (-1817.068) (-1818.923) -- 0:00:58

      Average standard deviation of split frequencies: 0.023440

      120500 -- (-1819.159) (-1820.931) (-1818.607) [-1817.401] * (-1818.857) (-1817.067) [-1817.116] (-1817.624) -- 0:00:58
      121000 -- (-1821.352) [-1819.393] (-1820.245) (-1818.508) * (-1818.374) (-1821.523) [-1818.709] (-1817.973) -- 0:00:58
      121500 -- (-1820.640) (-1817.461) [-1817.186] (-1819.429) * (-1818.193) (-1819.409) (-1818.163) [-1816.613] -- 0:00:57
      122000 -- (-1820.078) (-1817.674) [-1820.102] (-1816.490) * (-1817.641) (-1818.075) [-1818.152] (-1817.104) -- 0:00:57
      122500 -- (-1818.514) (-1816.545) (-1818.069) [-1816.979] * (-1818.299) (-1818.113) [-1817.080] (-1818.136) -- 0:00:57
      123000 -- [-1817.085] (-1817.348) (-1818.011) (-1822.793) * (-1818.297) [-1817.426] (-1818.117) (-1818.136) -- 0:00:57
      123500 -- (-1818.034) (-1817.636) [-1818.572] (-1819.314) * (-1819.699) [-1820.008] (-1817.964) (-1817.629) -- 0:00:56
      124000 -- (-1817.743) [-1818.526] (-1818.414) (-1821.320) * (-1817.058) (-1818.108) (-1823.468) [-1817.977] -- 0:00:56
      124500 -- (-1817.500) (-1817.928) [-1816.995] (-1821.535) * (-1817.610) (-1817.543) (-1824.219) [-1817.891] -- 0:00:56
      125000 -- (-1817.542) [-1817.624] (-1817.081) (-1822.064) * [-1821.002] (-1818.727) (-1821.309) (-1818.343) -- 0:00:56

      Average standard deviation of split frequencies: 0.022448

      125500 -- (-1818.808) (-1816.864) [-1816.692] (-1819.563) * (-1820.810) [-1819.537] (-1818.328) (-1817.772) -- 0:00:55
      126000 -- (-1818.815) [-1816.631] (-1817.957) (-1819.419) * [-1820.161] (-1819.888) (-1818.912) (-1817.459) -- 0:00:55
      126500 -- [-1817.509] (-1820.010) (-1817.368) (-1820.629) * (-1819.647) (-1818.714) (-1817.495) [-1816.832] -- 0:00:55
      127000 -- (-1817.210) (-1825.038) [-1817.687] (-1819.049) * [-1820.251] (-1818.704) (-1817.370) (-1816.906) -- 0:00:54
      127500 -- (-1817.237) [-1820.325] (-1818.058) (-1818.764) * (-1821.710) [-1821.026] (-1818.004) (-1819.544) -- 0:00:54
      128000 -- (-1818.959) [-1821.169] (-1818.444) (-1818.932) * [-1818.902] (-1819.660) (-1818.728) (-1819.071) -- 0:00:54
      128500 -- (-1822.254) [-1819.029] (-1818.431) (-1818.607) * (-1820.876) [-1818.459] (-1817.965) (-1817.998) -- 0:00:54
      129000 -- (-1824.810) (-1817.388) [-1824.515] (-1820.408) * [-1819.106] (-1820.034) (-1816.673) (-1817.061) -- 0:00:54
      129500 -- [-1816.803] (-1816.638) (-1818.148) (-1820.240) * (-1819.172) (-1819.822) (-1818.908) [-1817.928] -- 0:01:00
      130000 -- (-1817.108) [-1816.702] (-1819.283) (-1820.191) * [-1818.920] (-1818.847) (-1817.204) (-1818.759) -- 0:01:00

      Average standard deviation of split frequencies: 0.025634

      130500 -- [-1817.151] (-1817.203) (-1818.855) (-1819.250) * (-1820.999) (-1821.087) [-1817.336] (-1817.231) -- 0:00:59
      131000 -- (-1816.925) (-1824.642) [-1818.690] (-1816.619) * (-1819.562) (-1819.447) [-1818.058] (-1816.903) -- 0:00:59
      131500 -- (-1818.091) (-1817.146) (-1818.465) [-1816.987] * (-1818.955) (-1818.966) (-1820.004) [-1817.112] -- 0:00:59
      132000 -- (-1817.932) (-1817.281) [-1819.162] (-1816.391) * [-1819.212] (-1820.703) (-1819.949) (-1817.784) -- 0:00:59
      132500 -- (-1818.999) [-1817.373] (-1817.562) (-1818.554) * (-1818.936) [-1818.456] (-1819.505) (-1818.315) -- 0:00:58
      133000 -- (-1819.550) (-1817.689) (-1817.563) [-1816.337] * (-1818.861) [-1818.402] (-1816.985) (-1819.964) -- 0:00:58
      133500 -- (-1820.296) (-1817.447) (-1818.587) [-1816.467] * (-1818.935) (-1823.187) [-1818.704] (-1819.467) -- 0:00:58
      134000 -- (-1819.693) (-1817.957) (-1820.530) [-1816.466] * (-1818.044) [-1820.616] (-1819.142) (-1819.029) -- 0:00:58
      134500 -- [-1819.147] (-1818.019) (-1824.274) (-1816.214) * [-1818.482] (-1823.375) (-1818.508) (-1819.023) -- 0:00:57
      135000 -- (-1819.145) [-1817.987] (-1822.809) (-1817.404) * (-1817.696) [-1823.790] (-1819.946) (-1819.076) -- 0:00:57

      Average standard deviation of split frequencies: 0.022357

      135500 -- (-1818.900) (-1818.405) [-1819.257] (-1819.812) * (-1818.465) [-1819.662] (-1820.399) (-1820.915) -- 0:00:57
      136000 -- (-1818.950) (-1818.112) [-1818.045] (-1818.594) * [-1817.840] (-1822.745) (-1819.779) (-1819.112) -- 0:00:57
      136500 -- (-1820.267) [-1816.925] (-1818.108) (-1817.097) * (-1817.823) (-1821.324) (-1820.213) [-1818.503] -- 0:00:56
      137000 -- (-1819.391) (-1818.210) [-1819.672] (-1817.418) * (-1817.369) (-1820.809) (-1817.409) [-1820.392] -- 0:00:56
      137500 -- (-1817.971) [-1817.292] (-1817.308) (-1818.786) * (-1817.126) [-1818.260] (-1817.313) (-1819.330) -- 0:00:56
      138000 -- (-1818.839) (-1817.452) [-1818.387] (-1817.094) * (-1817.790) [-1818.597] (-1819.283) (-1819.294) -- 0:00:56
      138500 -- [-1819.566] (-1818.630) (-1817.493) (-1817.105) * [-1819.452] (-1818.300) (-1819.882) (-1819.339) -- 0:00:55
      139000 -- (-1819.232) [-1819.789] (-1818.226) (-1817.155) * (-1819.270) [-1817.981] (-1819.211) (-1819.389) -- 0:00:55
      139500 -- (-1819.545) (-1817.347) (-1820.068) [-1817.584] * (-1818.882) (-1820.132) (-1819.274) [-1819.612] -- 0:00:55
      140000 -- [-1817.851] (-1819.780) (-1819.115) (-1818.504) * (-1817.883) (-1818.157) [-1819.482] (-1816.638) -- 0:00:55

      Average standard deviation of split frequencies: 0.021280

      140500 -- (-1819.197) [-1817.901] (-1818.507) (-1822.433) * (-1816.954) [-1821.360] (-1817.394) (-1818.468) -- 0:00:55
      141000 -- (-1817.772) (-1820.659) [-1818.318] (-1821.919) * (-1819.441) (-1818.035) [-1817.272] (-1817.901) -- 0:00:54
      141500 -- (-1817.993) (-1819.054) (-1819.058) [-1819.009] * (-1819.477) (-1818.298) (-1817.201) [-1820.751] -- 0:00:54
      142000 -- (-1817.593) (-1819.867) (-1817.900) [-1818.699] * (-1819.672) (-1816.527) [-1817.411] (-1818.994) -- 0:00:54
      142500 -- (-1817.688) (-1820.139) [-1819.285] (-1818.735) * (-1820.620) [-1817.186] (-1820.270) (-1821.569) -- 0:00:54
      143000 -- (-1818.265) [-1821.519] (-1819.453) (-1818.953) * (-1822.533) (-1817.225) (-1824.360) [-1820.156] -- 0:00:53
      143500 -- (-1816.811) [-1817.557] (-1819.429) (-1819.664) * [-1820.984] (-1817.060) (-1820.073) (-1818.451) -- 0:00:53
      144000 -- (-1818.439) (-1818.931) [-1820.927] (-1820.199) * (-1820.554) (-1817.794) [-1819.405] (-1817.068) -- 0:00:53
      144500 -- (-1822.549) (-1819.908) [-1820.210] (-1819.253) * (-1823.451) [-1817.566] (-1819.182) (-1819.307) -- 0:00:53
      145000 -- (-1822.900) (-1821.361) (-1824.156) [-1819.503] * (-1822.333) (-1818.072) (-1824.188) [-1818.368] -- 0:00:53

      Average standard deviation of split frequencies: 0.018297

      145500 -- (-1820.092) (-1821.870) [-1821.167] (-1822.270) * (-1820.853) (-1822.946) (-1819.024) [-1820.922] -- 0:00:58
      146000 -- (-1820.513) (-1820.028) (-1818.572) [-1818.656] * [-1819.528] (-1818.901) (-1818.865) (-1818.592) -- 0:00:58
      146500 -- (-1819.918) (-1819.947) (-1817.355) [-1822.351] * (-1819.471) (-1818.308) [-1821.262] (-1817.024) -- 0:00:58
      147000 -- (-1818.530) (-1820.097) [-1818.982] (-1819.224) * (-1824.055) (-1821.672) (-1819.801) [-1817.020] -- 0:00:58
      147500 -- [-1817.311] (-1819.424) (-1821.793) (-1818.535) * (-1820.531) (-1824.209) [-1819.144] (-1817.966) -- 0:00:57
      148000 -- (-1817.863) (-1819.410) [-1818.503] (-1818.344) * (-1816.737) (-1823.168) [-1818.227] (-1818.123) -- 0:00:57
      148500 -- (-1817.993) (-1827.631) [-1818.802] (-1818.399) * [-1817.263] (-1818.062) (-1818.018) (-1818.173) -- 0:00:57
      149000 -- (-1817.519) [-1826.782] (-1822.587) (-1817.590) * [-1816.998] (-1819.306) (-1818.653) (-1817.769) -- 0:00:57
      149500 -- (-1817.517) (-1822.160) (-1819.656) [-1817.803] * (-1817.291) (-1819.797) [-1817.970] (-1818.871) -- 0:00:56
      150000 -- [-1817.240] (-1821.471) (-1818.627) (-1818.588) * [-1822.083] (-1819.089) (-1817.970) (-1820.245) -- 0:00:56

      Average standard deviation of split frequencies: 0.016687

      150500 -- (-1816.726) (-1819.804) [-1820.987] (-1817.601) * (-1820.846) [-1816.938] (-1818.594) (-1817.251) -- 0:00:56
      151000 -- [-1819.761] (-1818.044) (-1821.102) (-1817.587) * (-1819.773) (-1820.051) (-1816.894) [-1817.802] -- 0:00:56
      151500 -- [-1819.111] (-1817.714) (-1820.953) (-1817.100) * [-1819.159] (-1819.500) (-1816.894) (-1817.222) -- 0:00:56
      152000 -- [-1819.698] (-1818.280) (-1816.744) (-1819.561) * [-1823.021] (-1818.701) (-1816.904) (-1820.473) -- 0:00:55
      152500 -- [-1817.265] (-1817.214) (-1819.190) (-1818.633) * (-1819.866) [-1817.364] (-1816.810) (-1820.886) -- 0:00:55
      153000 -- [-1817.265] (-1816.633) (-1822.607) (-1816.682) * (-1820.666) (-1817.334) (-1816.598) [-1820.340] -- 0:00:55
      153500 -- (-1817.031) [-1816.580] (-1820.732) (-1817.011) * (-1820.418) (-1817.675) [-1816.637] (-1819.356) -- 0:00:55
      154000 -- (-1819.838) [-1817.060] (-1819.860) (-1817.703) * (-1818.789) (-1817.706) [-1817.943] (-1820.249) -- 0:00:54
      154500 -- (-1822.532) (-1820.593) (-1819.295) [-1817.054] * [-1817.631] (-1817.985) (-1816.552) (-1818.531) -- 0:00:54
      155000 -- [-1823.166] (-1817.713) (-1818.654) (-1820.381) * (-1818.767) [-1818.220] (-1816.377) (-1819.654) -- 0:00:54

      Average standard deviation of split frequencies: 0.017375

      155500 -- (-1825.242) (-1817.677) [-1817.715] (-1823.044) * [-1820.344] (-1817.804) (-1816.471) (-1818.377) -- 0:00:54
      156000 -- (-1821.909) (-1817.318) [-1816.611] (-1818.936) * [-1817.702] (-1819.361) (-1818.854) (-1817.779) -- 0:00:54
      156500 -- (-1820.222) (-1817.386) [-1818.180] (-1819.991) * [-1818.162] (-1819.197) (-1819.757) (-1821.179) -- 0:00:53
      157000 -- (-1817.365) [-1817.590] (-1818.413) (-1819.606) * (-1817.816) [-1820.487] (-1819.707) (-1821.620) -- 0:00:53
      157500 -- (-1817.278) (-1820.279) (-1818.978) [-1822.768] * (-1817.094) (-1817.852) [-1819.240] (-1818.295) -- 0:00:53
      158000 -- [-1817.047] (-1817.606) (-1818.125) (-1821.794) * (-1816.636) [-1820.716] (-1823.947) (-1821.967) -- 0:00:53
      158500 -- (-1818.417) (-1817.856) [-1819.933] (-1816.405) * (-1816.708) (-1821.249) [-1818.202] (-1818.105) -- 0:00:53
      159000 -- (-1818.927) [-1819.559] (-1823.192) (-1822.713) * (-1816.791) [-1819.214] (-1818.784) (-1819.368) -- 0:00:52
      159500 -- [-1818.630] (-1820.704) (-1821.779) (-1820.562) * (-1819.395) [-1819.551] (-1817.578) (-1817.118) -- 0:00:52
      160000 -- [-1821.239] (-1817.650) (-1820.532) (-1820.688) * (-1817.984) (-1820.410) (-1822.655) [-1816.405] -- 0:00:52

      Average standard deviation of split frequencies: 0.014817

      160500 -- (-1819.047) [-1818.777] (-1818.781) (-1821.787) * (-1818.740) (-1820.560) (-1818.285) [-1816.910] -- 0:00:52
      161000 -- (-1821.372) [-1819.010] (-1817.672) (-1818.834) * (-1823.059) (-1819.598) [-1818.496] (-1816.689) -- 0:00:57
      161500 -- [-1817.950] (-1817.778) (-1819.300) (-1818.161) * (-1822.540) (-1818.440) (-1819.233) [-1817.131] -- 0:00:57
      162000 -- (-1818.139) (-1818.428) (-1820.331) [-1819.264] * [-1820.254] (-1818.458) (-1818.955) (-1817.736) -- 0:00:56
      162500 -- (-1817.531) [-1817.889] (-1818.049) (-1826.290) * (-1820.001) [-1819.716] (-1822.057) (-1819.490) -- 0:00:56
      163000 -- (-1817.443) [-1818.459] (-1818.517) (-1824.350) * (-1824.520) (-1817.966) [-1820.873] (-1818.691) -- 0:00:56
      163500 -- (-1818.029) [-1817.741] (-1818.659) (-1823.557) * (-1822.781) [-1819.699] (-1821.522) (-1817.138) -- 0:00:56
      164000 -- [-1817.998] (-1817.151) (-1817.720) (-1822.760) * (-1818.994) [-1819.434] (-1820.153) (-1817.279) -- 0:00:56
      164500 -- (-1820.954) (-1817.160) (-1817.819) [-1823.040] * (-1817.747) [-1821.005] (-1821.006) (-1816.526) -- 0:00:55
      165000 -- [-1819.434] (-1817.483) (-1822.781) (-1818.759) * [-1819.369] (-1819.086) (-1819.788) (-1817.492) -- 0:00:55

      Average standard deviation of split frequencies: 0.015193

      165500 -- (-1821.387) [-1817.060] (-1821.607) (-1819.068) * (-1823.202) [-1818.849] (-1820.911) (-1817.099) -- 0:00:55
      166000 -- (-1820.224) (-1817.485) (-1818.832) [-1818.786] * (-1824.814) (-1819.601) (-1822.588) [-1817.371] -- 0:00:55
      166500 -- (-1819.841) (-1817.717) (-1819.332) [-1818.589] * (-1817.788) (-1826.653) (-1818.585) [-1816.686] -- 0:00:55
      167000 -- (-1819.135) (-1818.018) [-1820.221] (-1818.632) * (-1820.275) [-1821.894] (-1817.795) (-1816.834) -- 0:00:54
      167500 -- [-1817.963] (-1820.015) (-1819.914) (-1820.642) * (-1821.847) [-1816.759] (-1819.835) (-1818.731) -- 0:00:54
      168000 -- (-1817.338) (-1819.200) [-1817.086] (-1818.971) * (-1820.656) [-1818.189] (-1819.810) (-1817.898) -- 0:00:54
      168500 -- [-1816.761] (-1820.334) (-1817.846) (-1817.846) * (-1823.380) [-1818.575] (-1819.405) (-1817.861) -- 0:00:54
      169000 -- [-1817.433] (-1817.750) (-1821.858) (-1816.809) * (-1820.603) (-1817.832) (-1821.286) [-1819.029] -- 0:00:54
      169500 -- (-1817.204) [-1817.773] (-1819.349) (-1819.437) * [-1817.813] (-1820.370) (-1822.630) (-1820.508) -- 0:00:53
      170000 -- [-1817.827] (-1819.447) (-1817.643) (-1818.790) * (-1819.888) [-1816.562] (-1821.795) (-1820.423) -- 0:00:53

      Average standard deviation of split frequencies: 0.015744

      170500 -- (-1819.372) (-1819.286) (-1819.183) [-1818.710] * [-1818.629] (-1816.593) (-1817.914) (-1819.670) -- 0:00:53
      171000 -- [-1817.052] (-1819.067) (-1817.415) (-1821.010) * (-1819.578) [-1819.339] (-1817.910) (-1817.968) -- 0:00:53
      171500 -- (-1817.174) [-1817.749] (-1818.247) (-1820.641) * (-1818.365) (-1822.435) (-1823.981) [-1818.342] -- 0:00:53
      172000 -- (-1817.498) (-1817.273) (-1820.247) [-1826.591] * [-1817.849] (-1821.367) (-1823.992) (-1817.927) -- 0:00:52
      172500 -- (-1816.918) (-1818.009) (-1820.473) [-1821.661] * (-1816.706) (-1818.134) (-1819.738) [-1817.950] -- 0:00:52
      173000 -- (-1817.847) [-1816.833] (-1819.394) (-1820.335) * (-1818.309) [-1817.354] (-1817.423) (-1821.785) -- 0:00:52
      173500 -- (-1820.644) (-1818.254) [-1819.046] (-1821.742) * (-1818.315) (-1819.643) (-1817.534) [-1816.568] -- 0:00:52
      174000 -- [-1819.905] (-1817.882) (-1818.741) (-1820.847) * [-1817.474] (-1817.458) (-1817.440) (-1818.600) -- 0:00:52
      174500 -- (-1817.147) [-1818.165] (-1819.496) (-1822.866) * [-1817.654] (-1820.592) (-1818.776) (-1817.518) -- 0:00:52
      175000 -- (-1822.209) (-1818.431) [-1822.447] (-1821.483) * (-1817.110) [-1817.221] (-1818.359) (-1817.304) -- 0:00:51

      Average standard deviation of split frequencies: 0.014999

      175500 -- (-1821.528) [-1817.925] (-1822.251) (-1819.487) * (-1818.566) (-1817.202) [-1816.810] (-1817.923) -- 0:00:51
      176000 -- [-1817.888] (-1817.668) (-1819.662) (-1822.955) * [-1817.754] (-1817.202) (-1816.786) (-1818.842) -- 0:00:56
      176500 -- (-1817.769) (-1818.286) (-1818.719) [-1818.419] * [-1817.784] (-1819.171) (-1816.707) (-1817.908) -- 0:00:55
      177000 -- [-1816.596] (-1818.953) (-1818.266) (-1823.377) * (-1817.008) [-1818.996] (-1818.340) (-1820.194) -- 0:00:55
      177500 -- (-1816.442) [-1819.982] (-1820.553) (-1821.196) * (-1819.595) (-1821.413) (-1817.201) [-1818.643] -- 0:00:55
      178000 -- [-1816.464] (-1818.854) (-1818.487) (-1820.957) * (-1817.193) (-1820.850) (-1818.511) [-1819.157] -- 0:00:55
      178500 -- (-1816.464) (-1821.698) (-1817.881) [-1818.804] * (-1820.337) (-1824.395) [-1817.335] (-1818.539) -- 0:00:55
      179000 -- [-1819.613] (-1818.723) (-1817.681) (-1817.223) * (-1818.871) (-1817.648) [-1819.232] (-1820.145) -- 0:00:55
      179500 -- (-1817.366) (-1817.050) [-1817.296] (-1819.608) * (-1818.293) (-1816.916) (-1820.016) [-1821.104] -- 0:00:54
      180000 -- (-1818.125) (-1817.048) [-1817.286] (-1822.371) * [-1818.709] (-1818.633) (-1822.537) (-1820.285) -- 0:00:54

      Average standard deviation of split frequencies: 0.013733

      180500 -- (-1821.761) [-1817.205] (-1819.202) (-1819.651) * [-1820.585] (-1818.244) (-1816.651) (-1820.359) -- 0:00:54
      181000 -- (-1821.900) (-1820.499) [-1818.168] (-1817.784) * (-1817.998) (-1816.640) (-1817.203) [-1817.676] -- 0:00:54
      181500 -- (-1820.603) (-1816.804) [-1819.858] (-1820.391) * (-1823.241) (-1816.640) [-1817.198] (-1819.298) -- 0:00:54
      182000 -- (-1822.937) [-1817.371] (-1817.749) (-1816.670) * (-1820.473) (-1816.571) (-1819.394) [-1818.828] -- 0:00:53
      182500 -- (-1823.190) (-1817.459) (-1818.351) [-1817.698] * (-1816.901) (-1816.916) [-1817.634] (-1817.642) -- 0:00:53
      183000 -- [-1821.422] (-1821.578) (-1818.248) (-1817.461) * (-1817.469) (-1820.858) (-1817.017) [-1818.031] -- 0:00:53
      183500 -- (-1820.450) [-1817.056] (-1817.887) (-1819.894) * (-1818.050) (-1820.251) (-1817.557) [-1817.175] -- 0:00:53
      184000 -- (-1818.329) (-1816.947) [-1817.522] (-1820.590) * [-1819.271] (-1819.005) (-1818.923) (-1818.144) -- 0:00:53
      184500 -- (-1817.906) [-1820.896] (-1820.391) (-1820.175) * (-1824.382) [-1818.514] (-1818.878) (-1818.023) -- 0:00:53
      185000 -- (-1817.589) (-1820.424) [-1817.228] (-1817.367) * (-1822.962) (-1818.633) [-1818.863] (-1819.278) -- 0:00:52

      Average standard deviation of split frequencies: 0.013339

      185500 -- [-1818.244] (-1820.681) (-1816.724) (-1818.966) * (-1821.128) (-1819.738) (-1816.506) [-1818.531] -- 0:00:52
      186000 -- (-1817.746) (-1817.625) [-1816.605] (-1817.625) * (-1819.637) (-1821.585) [-1816.975] (-1823.157) -- 0:00:52
      186500 -- (-1819.534) (-1817.488) (-1817.475) [-1819.469] * (-1819.124) [-1816.937] (-1816.523) (-1816.883) -- 0:00:52
      187000 -- (-1818.328) (-1817.671) (-1818.292) [-1818.002] * (-1822.514) (-1817.337) [-1816.977] (-1818.464) -- 0:00:52
      187500 -- (-1818.929) [-1817.950] (-1818.359) (-1818.502) * [-1820.599] (-1817.643) (-1818.451) (-1819.159) -- 0:00:52
      188000 -- (-1818.201) [-1818.744] (-1818.975) (-1817.703) * (-1819.068) [-1818.996] (-1823.961) (-1816.554) -- 0:00:51
      188500 -- (-1820.772) [-1816.862] (-1817.933) (-1819.378) * (-1817.321) (-1819.561) (-1818.540) [-1818.009] -- 0:00:51
      189000 -- [-1822.335] (-1817.905) (-1820.388) (-1818.094) * [-1818.697] (-1822.110) (-1817.181) (-1821.717) -- 0:00:51
      189500 -- (-1820.412) (-1817.557) (-1819.773) [-1818.215] * [-1821.789] (-1820.351) (-1817.040) (-1818.615) -- 0:00:51
      190000 -- (-1820.128) (-1819.628) (-1819.825) [-1817.755] * (-1820.373) (-1819.710) (-1817.237) [-1818.614] -- 0:00:51

      Average standard deviation of split frequencies: 0.014054

      190500 -- (-1818.398) (-1818.116) (-1823.395) [-1816.967] * (-1819.455) [-1817.292] (-1817.955) (-1819.644) -- 0:00:50
      191000 -- (-1819.005) (-1818.342) (-1821.882) [-1817.583] * (-1820.796) [-1817.054] (-1821.083) (-1821.797) -- 0:00:50
      191500 -- (-1818.768) [-1818.078] (-1816.633) (-1818.536) * [-1820.154] (-1817.607) (-1820.275) (-1818.114) -- 0:00:50
      192000 -- (-1818.023) [-1818.132] (-1820.303) (-1820.311) * (-1819.842) (-1816.981) [-1819.101] (-1817.438) -- 0:00:54
      192500 -- (-1817.999) [-1820.624] (-1820.025) (-1819.225) * [-1818.529] (-1820.419) (-1819.067) (-1817.378) -- 0:00:54
      193000 -- (-1820.820) [-1817.745] (-1818.233) (-1818.640) * (-1818.862) [-1817.165] (-1819.260) (-1817.568) -- 0:00:54
      193500 -- (-1821.542) (-1817.750) [-1818.494] (-1819.940) * (-1819.313) (-1818.294) [-1819.964] (-1819.255) -- 0:00:54
      194000 -- (-1818.735) [-1818.661] (-1818.629) (-1818.119) * (-1817.615) (-1817.995) [-1821.224] (-1820.175) -- 0:00:54
      194500 -- (-1820.608) [-1819.010] (-1818.161) (-1818.629) * (-1823.367) (-1818.616) (-1818.029) [-1818.478] -- 0:00:53
      195000 -- (-1822.066) (-1816.882) [-1819.560] (-1818.134) * (-1821.108) (-1821.364) (-1819.736) [-1820.512] -- 0:00:53

      Average standard deviation of split frequencies: 0.014051

      195500 -- (-1821.232) [-1816.742] (-1821.464) (-1817.346) * (-1820.179) (-1818.440) [-1819.832] (-1818.282) -- 0:00:53
      196000 -- (-1819.373) [-1817.838] (-1823.420) (-1817.383) * (-1817.712) (-1821.298) (-1819.104) [-1818.057] -- 0:00:53
      196500 -- [-1817.945] (-1819.429) (-1820.550) (-1816.894) * (-1822.459) [-1821.355] (-1819.594) (-1817.860) -- 0:00:53
      197000 -- [-1816.884] (-1817.814) (-1820.051) (-1819.255) * (-1820.197) (-1820.027) [-1819.063] (-1820.252) -- 0:00:52
      197500 -- (-1817.167) [-1818.072] (-1817.163) (-1818.407) * [-1817.894] (-1820.301) (-1819.203) (-1816.271) -- 0:00:52
      198000 -- (-1817.692) (-1818.994) [-1817.912] (-1819.152) * [-1818.539] (-1819.159) (-1818.404) (-1817.578) -- 0:00:52
      198500 -- [-1820.178] (-1818.470) (-1817.430) (-1817.402) * (-1818.646) [-1818.506] (-1818.436) (-1817.132) -- 0:00:52
      199000 -- (-1817.763) (-1817.491) (-1817.664) [-1817.250] * [-1818.758] (-1823.480) (-1818.369) (-1817.669) -- 0:00:52
      199500 -- [-1819.283] (-1818.594) (-1821.659) (-1819.553) * (-1816.866) [-1818.844] (-1819.698) (-1817.904) -- 0:00:52
      200000 -- (-1817.052) [-1817.375] (-1820.529) (-1818.307) * [-1817.204] (-1818.107) (-1820.394) (-1817.070) -- 0:00:51

      Average standard deviation of split frequencies: 0.013965

      200500 -- (-1818.146) [-1817.188] (-1820.809) (-1818.932) * (-1817.476) (-1818.586) (-1821.138) [-1817.031] -- 0:00:51
      201000 -- (-1820.473) (-1816.898) [-1819.615] (-1818.475) * (-1817.427) (-1817.393) (-1821.983) [-1817.007] -- 0:00:51
      201500 -- [-1819.521] (-1816.463) (-1818.866) (-1819.182) * [-1817.847] (-1817.491) (-1820.670) (-1816.862) -- 0:00:51
      202000 -- (-1819.796) (-1816.890) (-1818.241) [-1818.923] * (-1819.208) (-1818.684) [-1820.348] (-1818.613) -- 0:00:51
      202500 -- (-1817.351) (-1826.126) [-1818.201] (-1819.657) * (-1820.694) (-1818.475) [-1825.076] (-1817.390) -- 0:00:51
      203000 -- [-1817.900] (-1823.937) (-1818.482) (-1817.129) * [-1817.786] (-1817.572) (-1823.818) (-1822.526) -- 0:00:51
      203500 -- (-1817.034) [-1821.538] (-1817.846) (-1817.382) * (-1818.001) (-1817.258) (-1819.039) [-1821.061] -- 0:00:50
      204000 -- (-1819.862) (-1819.767) [-1817.898] (-1816.902) * (-1818.676) (-1817.798) (-1818.654) [-1817.897] -- 0:00:50
      204500 -- (-1817.330) [-1818.752] (-1818.906) (-1816.842) * (-1819.442) [-1817.307] (-1819.696) (-1818.050) -- 0:00:50
      205000 -- [-1817.841] (-1817.997) (-1821.527) (-1817.424) * (-1819.451) [-1817.636] (-1820.785) (-1817.478) -- 0:00:50

      Average standard deviation of split frequencies: 0.015296

      205500 -- (-1816.958) (-1819.894) (-1822.850) [-1821.012] * (-1819.235) (-1817.954) (-1819.806) [-1817.401] -- 0:00:50
      206000 -- (-1816.661) (-1819.856) (-1820.878) [-1820.105] * (-1818.020) (-1818.816) (-1818.373) [-1821.142] -- 0:00:50
      206500 -- [-1816.503] (-1821.706) (-1820.181) (-1821.419) * (-1819.181) [-1817.846] (-1822.168) (-1818.925) -- 0:00:49
      207000 -- [-1818.442] (-1819.781) (-1821.302) (-1819.556) * (-1817.403) [-1818.929] (-1820.939) (-1818.606) -- 0:00:49
      207500 -- (-1818.104) (-1820.583) [-1820.173] (-1819.253) * (-1817.054) [-1819.712] (-1819.002) (-1821.680) -- 0:00:53
      208000 -- (-1819.933) (-1819.277) (-1822.102) [-1819.372] * [-1817.441] (-1819.377) (-1818.114) (-1818.608) -- 0:00:53
      208500 -- (-1816.526) (-1818.113) (-1821.928) [-1822.580] * [-1816.901] (-1819.392) (-1818.223) (-1819.003) -- 0:00:53
      209000 -- (-1820.100) (-1817.506) [-1820.982] (-1825.161) * [-1817.152] (-1818.049) (-1817.238) (-1820.154) -- 0:00:52
      209500 -- (-1820.031) (-1817.442) [-1819.838] (-1821.861) * (-1818.476) (-1817.814) (-1817.128) [-1822.657] -- 0:00:52
      210000 -- (-1818.796) (-1817.565) [-1822.569] (-1816.616) * (-1818.829) (-1821.544) [-1817.356] (-1817.348) -- 0:00:52

      Average standard deviation of split frequencies: 0.017280

      210500 -- (-1818.167) (-1818.752) [-1818.207] (-1818.517) * [-1818.346] (-1820.764) (-1817.684) (-1819.243) -- 0:00:52
      211000 -- [-1817.970] (-1817.649) (-1817.911) (-1817.471) * (-1819.652) [-1818.148] (-1821.866) (-1819.338) -- 0:00:52
      211500 -- (-1823.691) (-1818.329) [-1818.097] (-1817.781) * [-1819.384] (-1817.366) (-1818.699) (-1820.763) -- 0:00:52
      212000 -- (-1826.138) (-1823.544) (-1826.899) [-1816.544] * (-1822.038) (-1817.169) (-1818.613) [-1818.784] -- 0:00:52
      212500 -- (-1821.857) [-1819.996] (-1823.923) (-1817.057) * (-1821.649) (-1816.425) [-1819.754] (-1818.480) -- 0:00:51
      213000 -- (-1819.947) (-1820.699) [-1821.692] (-1818.704) * (-1825.542) [-1820.796] (-1821.192) (-1826.232) -- 0:00:51
      213500 -- [-1822.390] (-1821.263) (-1827.480) (-1819.635) * (-1824.280) (-1819.687) [-1820.370] (-1819.517) -- 0:00:51
      214000 -- (-1821.828) (-1821.783) (-1823.644) [-1816.865] * (-1823.631) (-1820.200) [-1817.001] (-1820.439) -- 0:00:51
      214500 -- (-1820.821) (-1820.155) (-1822.363) [-1818.387] * (-1821.393) (-1820.738) [-1819.191] (-1818.930) -- 0:00:51
      215000 -- (-1824.934) (-1820.081) [-1818.560] (-1817.623) * (-1822.517) (-1821.389) [-1818.189] (-1819.486) -- 0:00:51

      Average standard deviation of split frequencies: 0.018005

      215500 -- (-1818.835) [-1818.395] (-1819.299) (-1817.349) * (-1817.452) (-1817.811) (-1818.223) [-1818.564] -- 0:00:50
      216000 -- (-1819.143) [-1821.080] (-1817.810) (-1817.440) * (-1819.911) (-1819.035) (-1818.224) [-1817.950] -- 0:00:50
      216500 -- (-1817.587) (-1817.432) (-1817.609) [-1817.161] * (-1821.755) (-1819.977) (-1817.259) [-1817.871] -- 0:00:50
      217000 -- (-1817.744) (-1818.511) [-1818.639] (-1817.957) * [-1818.892] (-1821.039) (-1818.017) (-1819.025) -- 0:00:50
      217500 -- (-1817.147) (-1822.127) (-1818.171) [-1817.433] * (-1819.894) (-1820.794) [-1817.456] (-1818.342) -- 0:00:50
      218000 -- [-1817.573] (-1819.342) (-1818.636) (-1817.410) * (-1820.979) (-1820.163) (-1819.492) [-1818.662] -- 0:00:50
      218500 -- (-1817.572) [-1818.999] (-1819.533) (-1818.557) * (-1818.667) (-1819.814) [-1819.597] (-1817.003) -- 0:00:50
      219000 -- (-1818.793) [-1818.185] (-1819.168) (-1817.419) * (-1819.654) (-1819.934) [-1817.828] (-1818.598) -- 0:00:49
      219500 -- (-1818.155) (-1826.067) [-1820.816] (-1816.899) * (-1819.494) [-1819.716] (-1818.993) (-1825.151) -- 0:00:49
      220000 -- (-1817.031) [-1823.081] (-1818.051) (-1816.899) * (-1818.036) [-1819.045] (-1818.843) (-1821.784) -- 0:00:49

      Average standard deviation of split frequencies: 0.018692

      220500 -- [-1819.035] (-1817.951) (-1823.952) (-1816.899) * [-1820.233] (-1820.345) (-1817.455) (-1820.079) -- 0:00:49
      221000 -- (-1819.875) [-1819.587] (-1822.435) (-1816.574) * (-1819.074) (-1818.775) [-1818.179] (-1818.284) -- 0:00:49
      221500 -- (-1817.521) (-1821.003) (-1819.472) [-1819.065] * (-1818.850) (-1816.940) (-1818.243) [-1820.008] -- 0:00:49
      222000 -- [-1819.359] (-1818.192) (-1817.963) (-1819.431) * (-1821.918) (-1817.698) [-1818.007] (-1816.745) -- 0:00:49
      222500 -- (-1820.592) (-1817.427) [-1818.343] (-1818.621) * [-1823.227] (-1817.542) (-1818.023) (-1817.154) -- 0:00:48
      223000 -- (-1823.458) [-1817.221] (-1819.360) (-1819.667) * (-1826.318) [-1818.055] (-1820.861) (-1818.694) -- 0:00:52
      223500 -- (-1819.346) [-1817.737] (-1820.214) (-1822.219) * (-1827.742) (-1819.200) (-1820.371) [-1817.764] -- 0:00:52
      224000 -- (-1817.265) (-1817.160) (-1819.915) [-1820.429] * (-1822.663) (-1821.231) [-1820.046] (-1818.200) -- 0:00:51
      224500 -- [-1817.150] (-1817.825) (-1818.793) (-1818.684) * (-1820.954) (-1821.083) (-1819.231) [-1817.825] -- 0:00:51
      225000 -- [-1817.699] (-1820.461) (-1817.191) (-1817.788) * (-1819.156) (-1819.780) (-1818.454) [-1817.181] -- 0:00:51

      Average standard deviation of split frequencies: 0.018460

      225500 -- [-1816.775] (-1824.468) (-1818.618) (-1820.852) * (-1817.805) (-1818.560) (-1818.643) [-1818.178] -- 0:00:51
      226000 -- [-1817.204] (-1817.884) (-1820.529) (-1820.241) * (-1821.172) (-1818.947) (-1818.195) [-1816.887] -- 0:00:51
      226500 -- [-1819.881] (-1818.562) (-1818.836) (-1822.672) * (-1818.271) (-1817.755) (-1818.697) [-1817.596] -- 0:00:51
      227000 -- (-1822.597) (-1818.888) [-1817.830] (-1823.110) * (-1819.420) (-1816.717) (-1817.481) [-1817.696] -- 0:00:51
      227500 -- (-1819.117) (-1820.244) [-1818.977] (-1828.729) * (-1821.005) [-1816.820] (-1817.328) (-1819.782) -- 0:00:50
      228000 -- (-1817.847) (-1821.612) [-1823.105] (-1825.693) * (-1818.489) (-1816.839) [-1817.189] (-1817.194) -- 0:00:50
      228500 -- [-1818.614] (-1818.973) (-1819.045) (-1816.856) * [-1817.426] (-1821.092) (-1818.559) (-1817.220) -- 0:00:50
      229000 -- (-1821.932) (-1820.786) (-1821.938) [-1821.533] * (-1817.133) [-1819.510] (-1818.514) (-1818.452) -- 0:00:50
      229500 -- (-1819.100) [-1819.680] (-1822.103) (-1818.617) * (-1817.475) (-1818.175) (-1817.453) [-1818.158] -- 0:00:50
      230000 -- (-1819.916) [-1820.910] (-1820.104) (-1821.201) * (-1817.528) [-1817.284] (-1817.614) (-1824.959) -- 0:00:50

      Average standard deviation of split frequencies: 0.017210

      230500 -- (-1817.903) [-1818.011] (-1817.966) (-1824.580) * (-1817.470) [-1817.182] (-1817.134) (-1816.673) -- 0:00:50
      231000 -- (-1817.022) (-1817.935) [-1816.394] (-1822.725) * (-1817.848) (-1816.806) (-1818.180) [-1817.193] -- 0:00:49
      231500 -- (-1823.428) (-1818.678) [-1818.045] (-1821.633) * (-1820.758) (-1818.756) (-1818.076) [-1820.444] -- 0:00:49
      232000 -- (-1822.794) (-1817.832) [-1818.947] (-1818.999) * (-1818.787) [-1823.362] (-1818.116) (-1817.118) -- 0:00:49
      232500 -- (-1822.940) (-1816.791) [-1817.610] (-1819.845) * (-1819.544) (-1821.495) [-1817.910] (-1819.267) -- 0:00:49
      233000 -- (-1820.642) [-1817.761] (-1818.978) (-1820.309) * (-1820.205) (-1821.475) (-1818.954) [-1818.623] -- 0:00:49
      233500 -- (-1823.475) (-1817.785) (-1819.701) [-1821.043] * (-1817.679) (-1818.818) (-1818.234) [-1817.284] -- 0:00:49
      234000 -- (-1825.319) [-1817.814] (-1819.915) (-1818.349) * [-1817.662] (-1820.539) (-1819.512) (-1817.846) -- 0:00:49
      234500 -- (-1819.491) (-1818.056) [-1819.407] (-1819.981) * (-1817.916) (-1818.804) [-1818.274] (-1817.689) -- 0:00:48
      235000 -- [-1819.487] (-1817.186) (-1819.333) (-1821.033) * (-1819.560) (-1820.356) [-1820.682] (-1816.972) -- 0:00:48

      Average standard deviation of split frequencies: 0.016926

      235500 -- [-1818.749] (-1816.606) (-1819.456) (-1818.287) * (-1817.682) (-1819.264) [-1818.605] (-1816.785) -- 0:00:48
      236000 -- (-1819.505) (-1816.567) (-1819.107) [-1816.747] * [-1817.961] (-1821.301) (-1818.605) (-1824.549) -- 0:00:48
      236500 -- (-1817.831) (-1817.293) (-1817.812) [-1817.848] * (-1817.861) [-1822.743] (-1818.480) (-1822.478) -- 0:00:48
      237000 -- (-1821.468) (-1816.825) (-1819.699) [-1819.039] * (-1818.266) (-1818.667) [-1818.096] (-1822.367) -- 0:00:48
      237500 -- (-1820.825) [-1816.548] (-1819.983) (-1819.612) * (-1817.848) (-1817.918) [-1817.611] (-1827.444) -- 0:00:48
      238000 -- (-1817.517) (-1817.801) [-1816.852] (-1817.636) * (-1823.865) (-1818.636) (-1816.637) [-1817.266] -- 0:00:48
      238500 -- (-1819.968) (-1817.358) (-1817.262) [-1821.458] * (-1823.961) (-1817.489) (-1816.890) [-1817.232] -- 0:00:47
      239000 -- (-1818.100) (-1817.007) [-1818.495] (-1821.197) * [-1820.708] (-1817.378) (-1817.140) (-1822.623) -- 0:00:50
      239500 -- (-1817.233) (-1817.004) (-1817.024) [-1818.789] * (-1820.894) (-1819.500) [-1818.499] (-1816.942) -- 0:00:50
      240000 -- (-1817.395) [-1818.129] (-1817.932) (-1822.472) * (-1818.209) (-1817.690) (-1818.810) [-1819.957] -- 0:00:50

      Average standard deviation of split frequencies: 0.016649

      240500 -- (-1817.726) (-1816.417) (-1817.176) [-1822.774] * (-1817.919) [-1817.064] (-1816.750) (-1820.713) -- 0:00:50
      241000 -- [-1817.680] (-1816.432) (-1819.754) (-1822.167) * (-1824.126) (-1818.873) [-1818.514] (-1818.713) -- 0:00:50
      241500 -- (-1819.616) [-1816.918] (-1823.319) (-1821.561) * (-1818.650) (-1819.425) [-1819.772] (-1817.677) -- 0:00:50
      242000 -- (-1818.960) [-1816.836] (-1819.525) (-1823.203) * [-1818.673] (-1820.876) (-1817.770) (-1818.429) -- 0:00:50
      242500 -- (-1819.987) (-1822.549) [-1816.762] (-1817.879) * (-1818.998) (-1818.968) (-1819.434) [-1819.465] -- 0:00:49
      243000 -- [-1817.453] (-1820.536) (-1816.349) (-1821.210) * [-1816.558] (-1819.839) (-1816.867) (-1818.833) -- 0:00:49
      243500 -- [-1817.607] (-1821.342) (-1816.778) (-1821.338) * [-1816.426] (-1820.629) (-1823.276) (-1817.725) -- 0:00:49
      244000 -- (-1818.460) (-1821.000) [-1817.204] (-1817.436) * (-1816.426) [-1818.192] (-1819.608) (-1816.450) -- 0:00:49
      244500 -- (-1817.389) [-1821.226] (-1816.632) (-1820.668) * (-1822.384) (-1817.166) [-1819.448] (-1817.773) -- 0:00:49
      245000 -- (-1817.530) (-1818.568) [-1818.131] (-1820.982) * (-1823.029) (-1817.712) [-1818.587] (-1819.657) -- 0:00:49

      Average standard deviation of split frequencies: 0.015835

      245500 -- [-1817.943] (-1819.343) (-1817.958) (-1818.304) * (-1821.984) [-1819.523] (-1820.113) (-1817.105) -- 0:00:49
      246000 -- (-1819.496) [-1818.156] (-1818.614) (-1820.207) * (-1820.832) (-1820.944) (-1819.974) [-1817.704] -- 0:00:49
      246500 -- [-1820.936] (-1819.010) (-1821.857) (-1824.651) * (-1819.829) [-1820.177] (-1821.508) (-1820.440) -- 0:00:48
      247000 -- (-1818.682) [-1820.080] (-1817.071) (-1819.887) * (-1823.634) (-1820.902) (-1822.954) [-1818.550] -- 0:00:48
      247500 -- (-1818.585) [-1818.299] (-1817.090) (-1820.600) * [-1819.764] (-1820.352) (-1818.278) (-1823.055) -- 0:00:48
      248000 -- (-1818.154) (-1817.894) [-1818.145] (-1820.423) * (-1821.157) [-1817.066] (-1817.955) (-1816.797) -- 0:00:48
      248500 -- [-1818.683] (-1819.032) (-1817.227) (-1820.491) * (-1822.452) (-1818.101) (-1818.405) [-1819.318] -- 0:00:48
      249000 -- (-1816.887) (-1821.837) (-1818.488) [-1817.943] * (-1822.012) (-1816.607) (-1818.160) [-1816.958] -- 0:00:48
      249500 -- (-1816.714) (-1818.058) (-1819.468) [-1818.624] * (-1819.444) [-1817.102] (-1818.234) (-1818.590) -- 0:00:48
      250000 -- [-1817.130] (-1817.365) (-1818.025) (-1818.003) * (-1820.147) (-1819.701) (-1819.850) [-1816.844] -- 0:00:48

      Average standard deviation of split frequencies: 0.016549

      250500 -- (-1818.787) (-1817.365) (-1817.455) [-1820.327] * (-1818.501) (-1818.839) [-1819.340] (-1816.464) -- 0:00:47
      251000 -- (-1817.886) [-1818.506] (-1816.594) (-1817.610) * (-1818.221) (-1818.574) [-1817.723] (-1817.152) -- 0:00:47
      251500 -- (-1817.886) [-1816.694] (-1817.162) (-1817.611) * (-1818.965) [-1816.964] (-1818.242) (-1817.131) -- 0:00:47
      252000 -- (-1818.874) [-1816.363] (-1817.227) (-1820.775) * (-1817.632) (-1821.519) [-1821.101] (-1817.114) -- 0:00:47
      252500 -- [-1819.101] (-1817.172) (-1816.932) (-1822.019) * (-1819.120) (-1821.519) (-1821.101) [-1817.064] -- 0:00:47
      253000 -- [-1817.808] (-1819.070) (-1816.267) (-1818.714) * (-1819.962) (-1824.703) (-1818.487) [-1817.019] -- 0:00:47
      253500 -- (-1821.339) (-1821.116) [-1816.595] (-1818.754) * (-1819.305) (-1825.813) (-1816.944) [-1817.364] -- 0:00:47
      254000 -- [-1820.575] (-1818.355) (-1818.871) (-1818.196) * (-1823.160) [-1821.534] (-1816.818) (-1818.881) -- 0:00:46
      254500 -- (-1820.063) [-1819.256] (-1818.733) (-1820.096) * (-1822.572) (-1819.883) [-1817.388] (-1821.409) -- 0:00:49
      255000 -- (-1821.452) (-1819.242) [-1817.390] (-1817.729) * (-1824.544) [-1820.873] (-1816.957) (-1817.868) -- 0:00:49

      Average standard deviation of split frequencies: 0.015754

      255500 -- [-1819.473] (-1817.670) (-1818.353) (-1819.870) * [-1820.916] (-1820.129) (-1816.898) (-1818.119) -- 0:00:49
      256000 -- [-1818.430] (-1820.009) (-1816.760) (-1817.939) * (-1820.950) (-1819.884) (-1817.609) [-1818.181] -- 0:00:49
      256500 -- (-1818.930) [-1817.427] (-1818.530) (-1817.432) * (-1819.967) (-1818.948) (-1818.836) [-1818.370] -- 0:00:49
      257000 -- (-1819.120) [-1817.709] (-1818.530) (-1819.595) * (-1820.150) [-1819.042] (-1821.355) (-1818.983) -- 0:00:49
      257500 -- [-1817.615] (-1818.028) (-1821.127) (-1817.725) * (-1816.683) (-1823.335) (-1817.626) [-1823.589] -- 0:00:49
      258000 -- [-1817.875] (-1818.668) (-1824.660) (-1820.823) * (-1816.479) (-1822.018) [-1817.279] (-1820.210) -- 0:00:48
      258500 -- (-1817.075) (-1819.669) [-1822.630] (-1820.140) * [-1816.481] (-1820.105) (-1821.762) (-1817.583) -- 0:00:48
      259000 -- (-1822.915) (-1820.966) (-1822.584) [-1819.627] * (-1816.796) (-1818.987) (-1818.544) [-1818.037] -- 0:00:48
      259500 -- (-1818.064) (-1819.943) [-1821.087] (-1820.478) * [-1816.762] (-1817.259) (-1817.994) (-1818.347) -- 0:00:48
      260000 -- [-1817.941] (-1821.471) (-1817.000) (-1816.772) * (-1817.468) (-1817.173) (-1817.325) [-1819.156] -- 0:00:48

      Average standard deviation of split frequencies: 0.017683

      260500 -- [-1816.498] (-1817.923) (-1818.146) (-1818.822) * [-1816.972] (-1818.591) (-1818.241) (-1817.158) -- 0:00:48
      261000 -- (-1819.527) [-1820.290] (-1817.285) (-1819.428) * (-1818.005) [-1818.448] (-1818.416) (-1816.929) -- 0:00:48
      261500 -- [-1817.460] (-1821.788) (-1817.516) (-1819.163) * (-1816.804) (-1817.439) (-1820.920) [-1817.094] -- 0:00:48
      262000 -- (-1820.152) [-1821.778] (-1819.683) (-1820.818) * (-1816.821) [-1817.584] (-1819.686) (-1818.559) -- 0:00:47
      262500 -- [-1817.975] (-1817.790) (-1818.917) (-1820.641) * [-1816.486] (-1816.995) (-1819.139) (-1818.287) -- 0:00:47
      263000 -- (-1816.656) [-1817.327] (-1817.878) (-1820.556) * (-1817.904) (-1818.242) [-1817.154] (-1819.863) -- 0:00:47
      263500 -- (-1824.133) (-1817.359) (-1818.750) [-1817.049] * (-1817.877) (-1817.586) (-1818.756) [-1819.204] -- 0:00:47
      264000 -- [-1819.665] (-1818.013) (-1819.816) (-1817.131) * (-1817.873) (-1821.733) (-1818.031) [-1819.560] -- 0:00:47
      264500 -- (-1819.764) (-1819.536) (-1819.709) [-1817.118] * [-1824.116] (-1821.043) (-1819.812) (-1820.833) -- 0:00:47
      265000 -- (-1821.393) [-1818.702] (-1821.712) (-1817.087) * (-1818.881) [-1817.332] (-1819.840) (-1821.024) -- 0:00:47

      Average standard deviation of split frequencies: 0.017820

      265500 -- (-1819.444) (-1817.549) (-1822.145) [-1817.131] * [-1819.624] (-1817.400) (-1817.754) (-1817.576) -- 0:00:47
      266000 -- (-1818.029) (-1817.842) [-1820.231] (-1817.163) * (-1819.969) [-1817.876] (-1817.615) (-1817.270) -- 0:00:46
      266500 -- (-1817.806) (-1818.616) [-1818.840] (-1820.040) * (-1820.909) (-1819.525) (-1816.840) [-1817.365] -- 0:00:46
      267000 -- (-1817.210) [-1818.206] (-1817.381) (-1817.589) * (-1818.138) [-1819.394] (-1817.950) (-1817.404) -- 0:00:46
      267500 -- (-1818.883) [-1819.561] (-1817.838) (-1817.740) * (-1819.558) [-1820.294] (-1816.498) (-1818.564) -- 0:00:46
      268000 -- [-1820.028] (-1818.976) (-1818.107) (-1816.996) * [-1822.042] (-1825.186) (-1817.436) (-1818.151) -- 0:00:46
      268500 -- (-1820.628) (-1819.553) [-1818.447] (-1818.180) * (-1821.144) (-1817.807) [-1816.686] (-1818.111) -- 0:00:46
      269000 -- (-1820.245) (-1823.154) (-1818.426) [-1819.600] * (-1818.819) (-1818.134) [-1817.331] (-1818.597) -- 0:00:46
      269500 -- (-1819.914) (-1817.774) [-1818.580] (-1817.632) * (-1818.365) [-1818.070] (-1817.324) (-1818.705) -- 0:00:46
      270000 -- [-1817.965] (-1818.436) (-1817.259) (-1820.027) * (-1816.353) (-1816.553) [-1817.670] (-1817.809) -- 0:00:48

      Average standard deviation of split frequencies: 0.019255

      270500 -- (-1817.514) (-1818.325) [-1817.749] (-1819.539) * (-1819.062) [-1819.183] (-1819.295) (-1823.359) -- 0:00:48
      271000 -- (-1820.417) (-1817.425) (-1817.715) [-1822.144] * [-1822.245] (-1819.183) (-1819.692) (-1822.921) -- 0:00:48
      271500 -- (-1818.601) (-1817.204) [-1817.424] (-1819.127) * (-1816.980) (-1817.262) [-1816.811] (-1820.592) -- 0:00:48
      272000 -- (-1818.600) (-1820.308) (-1817.567) [-1818.842] * (-1816.648) (-1822.562) [-1816.428] (-1817.770) -- 0:00:48
      272500 -- (-1820.750) [-1818.645] (-1817.561) (-1817.028) * (-1817.896) (-1818.206) (-1817.660) [-1816.668] -- 0:00:48
      273000 -- (-1820.776) (-1820.149) [-1818.632] (-1817.373) * (-1818.570) (-1819.460) (-1817.660) [-1816.798] -- 0:00:47
      273500 -- (-1818.556) (-1817.471) (-1818.188) [-1817.252] * (-1820.471) (-1818.933) (-1822.655) [-1817.493] -- 0:00:47
      274000 -- [-1817.793] (-1820.505) (-1817.168) (-1817.834) * (-1819.525) (-1819.003) (-1818.255) [-1817.755] -- 0:00:47
      274500 -- (-1817.193) [-1817.600] (-1817.873) (-1819.536) * [-1818.427] (-1817.811) (-1817.421) (-1818.911) -- 0:00:47
      275000 -- [-1817.348] (-1818.544) (-1817.158) (-1817.248) * (-1820.106) [-1817.880] (-1816.683) (-1818.714) -- 0:00:47

      Average standard deviation of split frequencies: 0.018788

      275500 -- (-1817.269) (-1817.339) [-1817.059] (-1820.353) * (-1820.088) (-1818.159) (-1816.683) [-1820.733] -- 0:00:47
      276000 -- (-1817.142) (-1817.463) (-1819.934) [-1819.389] * [-1819.344] (-1817.376) (-1816.921) (-1819.463) -- 0:00:47
      276500 -- [-1819.401] (-1817.356) (-1820.030) (-1818.162) * [-1818.958] (-1824.596) (-1817.178) (-1820.217) -- 0:00:47
      277000 -- [-1816.869] (-1817.312) (-1817.933) (-1821.106) * (-1819.920) (-1826.823) [-1819.763] (-1818.008) -- 0:00:46
      277500 -- (-1817.037) (-1820.499) (-1817.334) [-1820.314] * (-1819.448) (-1820.931) [-1821.439] (-1818.186) -- 0:00:46
      278000 -- (-1818.394) [-1818.269] (-1818.532) (-1819.289) * (-1816.704) (-1820.317) [-1816.919] (-1818.918) -- 0:00:46
      278500 -- (-1819.010) (-1823.088) (-1818.533) [-1819.001] * (-1816.949) (-1819.046) [-1819.943] (-1819.211) -- 0:00:46
      279000 -- [-1817.677] (-1817.243) (-1817.493) (-1817.240) * (-1818.952) (-1824.889) [-1819.913] (-1820.035) -- 0:00:46
      279500 -- (-1817.992) [-1817.401] (-1819.390) (-1819.633) * (-1819.464) [-1818.839] (-1820.585) (-1821.464) -- 0:00:46
      280000 -- (-1819.207) (-1817.563) (-1817.041) [-1818.068] * (-1819.981) [-1818.165] (-1820.618) (-1816.965) -- 0:00:46

      Average standard deviation of split frequencies: 0.019502

      280500 -- [-1820.148] (-1817.491) (-1818.565) (-1818.693) * (-1817.964) (-1819.379) (-1826.317) [-1816.558] -- 0:00:46
      281000 -- (-1817.057) (-1819.856) (-1820.887) [-1823.434] * (-1819.954) [-1818.556] (-1822.649) (-1818.781) -- 0:00:46
      281500 -- (-1820.725) (-1822.651) [-1819.766] (-1823.431) * [-1820.034] (-1820.596) (-1821.133) (-1818.484) -- 0:00:45
      282000 -- [-1818.043] (-1819.252) (-1821.094) (-1825.333) * (-1818.079) (-1823.494) (-1823.326) [-1817.520] -- 0:00:45
      282500 -- (-1818.562) (-1818.022) (-1818.094) [-1817.209] * [-1817.536] (-1816.337) (-1819.579) (-1818.578) -- 0:00:45
      283000 -- [-1819.727] (-1817.657) (-1822.564) (-1817.865) * (-1819.707) [-1816.251] (-1819.141) (-1817.473) -- 0:00:45
      283500 -- (-1821.458) (-1819.388) (-1822.804) [-1821.309] * (-1821.103) [-1816.356] (-1818.139) (-1817.088) -- 0:00:45
      284000 -- (-1820.192) [-1817.259] (-1819.742) (-1819.684) * (-1820.830) (-1817.790) (-1818.479) [-1817.425] -- 0:00:45
      284500 -- (-1818.670) (-1817.372) [-1819.563] (-1819.680) * [-1818.235] (-1817.789) (-1824.027) (-1817.286) -- 0:00:45
      285000 -- (-1820.191) (-1817.148) (-1817.917) [-1819.306] * (-1818.642) [-1818.698] (-1822.888) (-1817.128) -- 0:00:47

      Average standard deviation of split frequencies: 0.019047

      285500 -- (-1819.771) [-1817.179] (-1817.435) (-1822.928) * (-1818.609) (-1819.316) (-1820.036) [-1818.707] -- 0:00:47
      286000 -- (-1818.972) [-1817.788] (-1818.768) (-1821.603) * (-1818.520) [-1816.835] (-1819.544) (-1820.759) -- 0:00:47
      286500 -- (-1821.934) [-1818.768] (-1817.109) (-1821.243) * [-1817.675] (-1816.716) (-1818.769) (-1820.928) -- 0:00:47
      287000 -- [-1819.497] (-1818.160) (-1818.274) (-1817.033) * (-1817.308) (-1817.307) (-1822.119) [-1818.348] -- 0:00:47
      287500 -- (-1818.554) (-1818.160) [-1817.139] (-1816.599) * (-1817.534) (-1817.094) (-1818.646) [-1817.356] -- 0:00:47
      288000 -- (-1818.456) [-1817.336] (-1819.060) (-1817.140) * (-1817.942) [-1819.878] (-1819.581) (-1818.200) -- 0:00:46
      288500 -- [-1819.266] (-1817.324) (-1817.240) (-1817.698) * (-1817.421) (-1818.857) [-1819.768] (-1818.510) -- 0:00:46
      289000 -- (-1818.256) (-1821.791) (-1817.780) [-1816.816] * (-1817.689) (-1822.779) (-1821.222) [-1819.099] -- 0:00:46
      289500 -- (-1817.914) (-1817.271) [-1817.755] (-1817.113) * (-1817.985) [-1818.971] (-1820.146) (-1818.449) -- 0:00:46
      290000 -- [-1819.149] (-1820.268) (-1821.954) (-1817.113) * (-1820.059) [-1819.020] (-1820.180) (-1817.977) -- 0:00:46

      Average standard deviation of split frequencies: 0.019462

      290500 -- (-1819.998) [-1820.294] (-1818.584) (-1819.243) * (-1817.825) [-1819.031] (-1818.453) (-1817.179) -- 0:00:46
      291000 -- (-1817.485) [-1819.121] (-1819.183) (-1818.975) * [-1817.540] (-1818.492) (-1821.797) (-1819.704) -- 0:00:46
      291500 -- (-1819.041) (-1820.194) [-1817.710] (-1818.926) * (-1818.052) [-1816.985] (-1820.082) (-1820.165) -- 0:00:46
      292000 -- (-1818.851) (-1819.338) [-1817.835] (-1819.670) * [-1816.813] (-1817.295) (-1818.249) (-1817.056) -- 0:00:46
      292500 -- (-1817.609) [-1821.057] (-1819.000) (-1817.369) * (-1816.941) (-1816.660) [-1817.804] (-1818.397) -- 0:00:45
      293000 -- (-1818.583) (-1821.334) (-1818.410) [-1818.264] * (-1820.834) [-1819.705] (-1824.010) (-1817.785) -- 0:00:45
      293500 -- [-1817.990] (-1822.138) (-1823.170) (-1819.069) * (-1818.615) [-1819.204] (-1821.367) (-1819.732) -- 0:00:45
      294000 -- (-1817.684) (-1817.090) (-1821.478) [-1817.674] * (-1820.810) [-1819.046] (-1821.401) (-1819.747) -- 0:00:45
      294500 -- (-1817.433) [-1817.447] (-1819.885) (-1818.047) * (-1820.802) (-1819.283) (-1817.113) [-1820.617] -- 0:00:45
      295000 -- (-1818.180) (-1817.297) [-1821.147] (-1818.680) * (-1817.698) (-1817.950) [-1816.705] (-1818.915) -- 0:00:45

      Average standard deviation of split frequencies: 0.018692

      295500 -- (-1822.077) [-1817.645] (-1820.763) (-1817.216) * (-1817.262) (-1819.262) [-1816.640] (-1818.373) -- 0:00:45
      296000 -- (-1819.232) (-1817.654) (-1817.316) [-1818.039] * (-1818.443) (-1819.805) [-1817.441] (-1822.932) -- 0:00:45
      296500 -- [-1817.265] (-1819.124) (-1818.331) (-1817.631) * [-1819.115] (-1820.970) (-1818.191) (-1818.853) -- 0:00:45
      297000 -- [-1817.673] (-1820.574) (-1819.107) (-1818.923) * (-1819.073) (-1819.548) (-1817.289) [-1816.982] -- 0:00:44
      297500 -- [-1817.839] (-1823.274) (-1817.642) (-1817.325) * (-1819.788) (-1819.217) [-1816.999] (-1819.200) -- 0:00:44
      298000 -- (-1817.938) (-1818.977) (-1817.962) [-1818.356] * [-1819.694] (-1820.240) (-1816.591) (-1818.839) -- 0:00:44
      298500 -- (-1819.825) [-1818.450] (-1819.347) (-1817.423) * (-1819.511) (-1817.235) [-1816.489] (-1817.623) -- 0:00:44
      299000 -- (-1820.740) [-1819.742] (-1820.587) (-1817.386) * (-1817.865) (-1818.588) (-1817.576) [-1819.358] -- 0:00:44
      299500 -- (-1819.582) (-1818.720) (-1820.084) [-1818.150] * (-1817.280) (-1817.640) (-1824.190) [-1819.682] -- 0:00:46
      300000 -- (-1818.688) (-1818.684) [-1819.160] (-1818.569) * [-1818.868] (-1817.947) (-1817.608) (-1819.239) -- 0:00:46

      Average standard deviation of split frequencies: 0.018732

      300500 -- (-1821.318) [-1818.733] (-1816.553) (-1817.077) * (-1821.343) [-1820.130] (-1817.854) (-1819.291) -- 0:00:46
      301000 -- (-1817.468) (-1817.365) (-1821.674) [-1817.077] * (-1820.105) (-1820.600) (-1817.335) [-1818.421] -- 0:00:46
      301500 -- [-1817.479] (-1817.366) (-1818.179) (-1820.254) * (-1820.096) (-1818.452) (-1822.621) [-1817.945] -- 0:00:46
      302000 -- [-1817.498] (-1817.677) (-1818.036) (-1820.723) * (-1820.701) [-1817.322] (-1822.075) (-1817.790) -- 0:00:46
      302500 -- (-1818.949) (-1821.956) [-1818.114] (-1818.937) * (-1819.568) [-1819.137] (-1817.850) (-1818.245) -- 0:00:46
      303000 -- [-1818.297] (-1817.775) (-1817.376) (-1819.297) * (-1817.535) [-1820.291] (-1817.497) (-1818.155) -- 0:00:46
      303500 -- (-1817.715) (-1819.121) [-1817.733] (-1821.126) * (-1819.223) (-1822.492) (-1817.587) [-1819.388] -- 0:00:45
      304000 -- (-1817.316) [-1817.395] (-1821.428) (-1817.713) * (-1818.197) [-1818.127] (-1817.235) (-1819.068) -- 0:00:45
      304500 -- [-1818.935] (-1817.715) (-1818.083) (-1821.285) * (-1819.189) [-1818.298] (-1819.301) (-1817.646) -- 0:00:45
      305000 -- (-1818.476) (-1817.377) (-1816.461) [-1820.696] * (-1818.648) [-1822.169] (-1819.876) (-1817.334) -- 0:00:45

      Average standard deviation of split frequencies: 0.018405

      305500 -- [-1817.950] (-1818.515) (-1819.259) (-1819.174) * (-1818.041) (-1816.960) [-1819.156] (-1818.117) -- 0:00:45
      306000 -- [-1817.259] (-1820.059) (-1820.436) (-1820.642) * (-1819.096) (-1817.043) (-1818.698) [-1817.738] -- 0:00:45
      306500 -- [-1819.493] (-1820.833) (-1819.895) (-1820.946) * (-1826.585) [-1817.327] (-1818.815) (-1819.496) -- 0:00:45
      307000 -- (-1817.946) [-1821.703] (-1817.391) (-1820.244) * (-1822.715) (-1817.701) [-1818.906] (-1819.789) -- 0:00:45
      307500 -- (-1822.268) (-1823.775) [-1816.809] (-1817.422) * (-1822.800) (-1818.419) (-1819.720) [-1817.690] -- 0:00:45
      308000 -- (-1820.509) (-1823.258) [-1817.074] (-1818.496) * (-1822.387) [-1819.771] (-1818.012) (-1817.514) -- 0:00:44
      308500 -- (-1820.624) (-1823.591) (-1817.428) [-1818.144] * (-1820.410) (-1818.108) (-1818.267) [-1817.115] -- 0:00:44
      309000 -- [-1817.303] (-1820.524) (-1818.982) (-1817.475) * [-1819.103] (-1818.346) (-1817.793) (-1817.793) -- 0:00:44
      309500 -- [-1817.126] (-1819.559) (-1818.384) (-1821.808) * (-1818.172) (-1818.180) [-1818.714] (-1816.974) -- 0:00:44
      310000 -- [-1816.971] (-1816.675) (-1817.916) (-1818.926) * (-1818.153) (-1818.072) [-1818.629] (-1821.234) -- 0:00:44

      Average standard deviation of split frequencies: 0.017330

      310500 -- (-1817.529) (-1816.765) [-1818.514] (-1818.514) * (-1817.653) (-1817.864) (-1819.069) [-1820.348] -- 0:00:44
      311000 -- (-1816.874) [-1816.459] (-1819.437) (-1819.080) * [-1816.628] (-1819.726) (-1820.393) (-1819.468) -- 0:00:44
      311500 -- (-1816.851) [-1818.551] (-1819.046) (-1819.830) * (-1818.387) (-1828.068) [-1818.172] (-1819.046) -- 0:00:44
      312000 -- [-1819.277] (-1820.457) (-1826.681) (-1818.905) * (-1822.011) (-1825.268) (-1816.520) [-1817.876] -- 0:00:44
      312500 -- (-1818.654) (-1823.297) [-1826.167] (-1818.455) * (-1817.874) (-1821.120) (-1818.387) [-1821.789] -- 0:00:44
      313000 -- (-1816.359) [-1819.033] (-1822.227) (-1820.029) * (-1818.304) [-1818.852] (-1823.289) (-1817.733) -- 0:00:43
      313500 -- (-1820.700) [-1816.693] (-1823.192) (-1819.019) * [-1817.927] (-1819.336) (-1818.110) (-1822.611) -- 0:00:45
      314000 -- [-1817.202] (-1820.382) (-1817.854) (-1818.802) * (-1820.561) [-1817.830] (-1819.161) (-1819.706) -- 0:00:45
      314500 -- (-1819.687) [-1820.874] (-1818.858) (-1817.824) * (-1817.419) [-1817.352] (-1817.499) (-1818.042) -- 0:00:45
      315000 -- (-1819.146) (-1820.745) (-1820.893) [-1818.636] * [-1817.112] (-1816.504) (-1817.402) (-1820.348) -- 0:00:45

      Average standard deviation of split frequencies: 0.016959

      315500 -- (-1818.871) (-1817.747) (-1818.127) [-1817.391] * [-1817.029] (-1816.572) (-1816.597) (-1820.210) -- 0:00:45
      316000 -- [-1817.943] (-1820.981) (-1821.288) (-1818.209) * [-1816.366] (-1817.771) (-1818.080) (-1819.301) -- 0:00:45
      316500 -- (-1823.336) (-1818.799) [-1819.277] (-1820.568) * [-1820.436] (-1823.134) (-1817.249) (-1819.094) -- 0:00:45
      317000 -- (-1821.760) (-1819.289) [-1817.562] (-1822.063) * (-1820.490) (-1820.752) [-1819.818] (-1821.577) -- 0:00:45
      317500 -- (-1818.770) [-1819.970] (-1820.457) (-1817.962) * (-1822.825) (-1816.896) (-1818.023) [-1819.965] -- 0:00:45
      318000 -- (-1820.297) (-1819.280) (-1819.004) [-1817.754] * [-1821.227] (-1817.065) (-1819.528) (-1821.196) -- 0:00:45
      318500 -- (-1816.255) (-1822.411) (-1816.836) [-1817.987] * (-1821.975) (-1820.277) [-1817.481] (-1818.907) -- 0:00:44
      319000 -- (-1818.305) (-1821.798) [-1817.536] (-1822.601) * (-1820.199) (-1817.570) [-1818.777] (-1818.661) -- 0:00:44
      319500 -- [-1816.497] (-1819.176) (-1817.669) (-1821.110) * (-1819.091) [-1817.245] (-1817.222) (-1819.282) -- 0:00:44
      320000 -- [-1817.153] (-1818.235) (-1822.536) (-1817.110) * [-1818.811] (-1819.957) (-1817.478) (-1820.200) -- 0:00:44

      Average standard deviation of split frequencies: 0.016480

      320500 -- [-1816.914] (-1817.593) (-1818.890) (-1823.600) * (-1820.872) (-1819.892) (-1817.925) [-1820.684] -- 0:00:44
      321000 -- (-1816.499) [-1818.358] (-1819.234) (-1820.232) * (-1819.791) (-1817.514) (-1817.448) [-1818.940] -- 0:00:44
      321500 -- [-1816.453] (-1821.415) (-1817.097) (-1819.779) * [-1819.277] (-1817.235) (-1818.154) (-1817.383) -- 0:00:44
      322000 -- (-1819.590) [-1818.620] (-1816.632) (-1820.602) * (-1818.706) (-1818.649) [-1818.152] (-1818.920) -- 0:00:44
      322500 -- [-1820.812] (-1818.362) (-1816.415) (-1818.827) * (-1819.042) [-1817.077] (-1818.204) (-1818.552) -- 0:00:44
      323000 -- [-1818.616] (-1818.621) (-1817.795) (-1817.644) * [-1822.058] (-1817.244) (-1819.786) (-1817.810) -- 0:00:44
      323500 -- (-1824.180) [-1818.438] (-1817.627) (-1817.446) * (-1816.595) (-1818.780) [-1819.185] (-1819.927) -- 0:00:43
      324000 -- (-1817.818) (-1820.955) [-1816.903] (-1817.827) * (-1816.595) [-1818.749] (-1821.037) (-1819.957) -- 0:00:43
      324500 -- [-1817.197] (-1818.913) (-1818.294) (-1818.478) * [-1816.584] (-1816.614) (-1818.226) (-1818.720) -- 0:00:43
      325000 -- (-1817.797) [-1818.254] (-1817.868) (-1820.969) * (-1816.903) [-1817.957] (-1820.543) (-1817.430) -- 0:00:43

      Average standard deviation of split frequencies: 0.017428

      325500 -- (-1821.803) [-1817.757] (-1819.672) (-1817.231) * (-1820.722) (-1820.213) (-1818.085) [-1821.328] -- 0:00:43
      326000 -- (-1820.769) (-1820.009) (-1817.063) [-1817.593] * (-1817.863) (-1817.351) (-1819.451) [-1819.716] -- 0:00:43
      326500 -- (-1818.684) (-1818.750) (-1817.600) [-1817.722] * (-1816.773) [-1819.859] (-1817.736) (-1822.740) -- 0:00:43
      327000 -- (-1817.119) [-1818.671] (-1817.478) (-1821.454) * (-1816.717) (-1821.648) [-1818.317] (-1821.832) -- 0:00:43
      327500 -- (-1817.411) (-1818.622) (-1818.112) [-1819.520] * (-1816.742) (-1819.405) [-1819.375] (-1820.247) -- 0:00:43
      328000 -- [-1816.964] (-1819.945) (-1818.328) (-1819.159) * (-1817.471) [-1817.577] (-1818.862) (-1822.134) -- 0:00:45
      328500 -- (-1825.158) (-1817.859) [-1818.356] (-1818.433) * (-1818.136) (-1817.720) [-1819.854] (-1829.617) -- 0:00:44
      329000 -- (-1817.578) [-1817.035] (-1819.612) (-1819.451) * (-1817.986) [-1819.499] (-1820.963) (-1820.500) -- 0:00:44
      329500 -- (-1817.185) (-1817.035) (-1817.298) [-1821.324] * (-1819.553) (-1820.071) [-1819.053] (-1818.673) -- 0:00:44
      330000 -- (-1817.697) (-1818.526) [-1818.559] (-1818.990) * (-1818.950) (-1817.893) [-1816.964] (-1817.276) -- 0:00:44

      Average standard deviation of split frequencies: 0.019087

      330500 -- [-1816.833] (-1818.446) (-1816.627) (-1818.943) * [-1817.792] (-1820.131) (-1819.543) (-1817.211) -- 0:00:44
      331000 -- [-1818.246] (-1820.260) (-1817.054) (-1817.722) * (-1817.777) [-1818.582] (-1817.179) (-1821.049) -- 0:00:44
      331500 -- (-1819.094) [-1818.270] (-1819.672) (-1820.659) * (-1817.201) (-1818.291) (-1818.056) [-1820.266] -- 0:00:44
      332000 -- [-1820.350] (-1819.037) (-1816.974) (-1818.913) * (-1818.527) [-1817.939] (-1816.714) (-1819.074) -- 0:00:44
      332500 -- [-1816.896] (-1817.892) (-1817.565) (-1817.514) * (-1819.806) (-1817.516) [-1816.972] (-1818.924) -- 0:00:44
      333000 -- (-1822.120) (-1817.771) [-1816.962] (-1816.815) * [-1818.617] (-1816.483) (-1817.509) (-1820.754) -- 0:00:44
      333500 -- [-1820.211] (-1819.076) (-1820.102) (-1819.256) * (-1824.268) (-1819.173) [-1820.336] (-1820.829) -- 0:00:43
      334000 -- [-1819.837] (-1817.471) (-1817.928) (-1819.398) * (-1819.726) (-1818.291) (-1820.056) [-1820.672] -- 0:00:43
      334500 -- (-1817.556) (-1820.216) [-1817.918] (-1820.906) * [-1817.527] (-1817.018) (-1819.067) (-1818.515) -- 0:00:43
      335000 -- [-1819.139] (-1818.905) (-1818.557) (-1821.114) * [-1817.557] (-1816.948) (-1817.197) (-1823.371) -- 0:00:43

      Average standard deviation of split frequencies: 0.018161

      335500 -- (-1817.441) [-1818.108] (-1822.644) (-1821.226) * [-1819.840] (-1819.111) (-1817.324) (-1819.810) -- 0:00:43
      336000 -- (-1820.896) (-1818.256) [-1819.609] (-1817.785) * (-1818.861) [-1817.487] (-1816.951) (-1820.305) -- 0:00:43
      336500 -- (-1819.079) (-1818.359) (-1817.919) [-1817.592] * (-1819.720) [-1817.714] (-1817.202) (-1821.406) -- 0:00:43
      337000 -- (-1820.574) (-1822.604) [-1818.158] (-1817.613) * (-1818.157) (-1819.660) [-1818.831] (-1817.455) -- 0:00:43
      337500 -- (-1820.223) (-1821.636) [-1818.285] (-1818.275) * (-1819.262) (-1819.660) (-1818.736) [-1818.614] -- 0:00:43
      338000 -- [-1820.975] (-1819.519) (-1819.883) (-1819.166) * (-1818.820) (-1818.935) [-1817.945] (-1816.712) -- 0:00:43
      338500 -- [-1818.139] (-1819.889) (-1820.848) (-1820.595) * [-1822.942] (-1818.272) (-1818.517) (-1818.683) -- 0:00:42
      339000 -- [-1819.576] (-1818.562) (-1819.580) (-1819.291) * (-1823.108) (-1821.501) [-1818.304] (-1817.487) -- 0:00:42
      339500 -- (-1817.742) (-1817.823) (-1818.844) [-1818.864] * (-1818.831) [-1818.778] (-1817.220) (-1823.032) -- 0:00:42
      340000 -- (-1818.610) [-1820.433] (-1818.814) (-1819.615) * (-1822.288) [-1819.789] (-1817.218) (-1823.208) -- 0:00:42

      Average standard deviation of split frequencies: 0.018527

      340500 -- (-1819.517) (-1822.987) [-1818.113] (-1818.434) * (-1818.086) (-1817.097) (-1820.986) [-1821.747] -- 0:00:42
      341000 -- [-1819.914] (-1820.725) (-1819.912) (-1817.372) * (-1817.118) (-1817.092) (-1818.382) [-1819.670] -- 0:00:42
      341500 -- (-1818.803) (-1819.734) [-1817.866] (-1816.571) * (-1817.241) (-1819.556) [-1819.886] (-1818.778) -- 0:00:42
      342000 -- (-1816.877) (-1820.659) (-1817.025) [-1816.973] * (-1818.525) [-1821.300] (-1818.576) (-1818.556) -- 0:00:42
      342500 -- (-1817.264) (-1820.461) (-1821.090) [-1816.988] * [-1816.786] (-1818.939) (-1817.433) (-1819.110) -- 0:00:44
      343000 -- (-1817.159) (-1823.469) [-1817.743] (-1816.988) * (-1817.747) (-1817.136) [-1818.077] (-1819.149) -- 0:00:44
      343500 -- [-1817.159] (-1817.573) (-1818.077) (-1817.996) * (-1823.037) (-1817.206) (-1818.135) [-1820.964] -- 0:00:43
      344000 -- (-1817.360) (-1817.960) (-1817.049) [-1819.317] * (-1822.695) (-1817.330) (-1820.538) [-1817.622] -- 0:00:43
      344500 -- [-1817.466] (-1817.706) (-1819.721) (-1818.482) * (-1820.933) (-1817.397) [-1820.500] (-1817.713) -- 0:00:43
      345000 -- (-1818.667) (-1818.086) (-1817.567) [-1818.187] * [-1817.736] (-1819.689) (-1819.147) (-1816.751) -- 0:00:43

      Average standard deviation of split frequencies: 0.018242

      345500 -- (-1818.929) (-1818.542) [-1819.021] (-1817.667) * (-1818.137) (-1819.690) [-1818.577] (-1817.740) -- 0:00:43
      346000 -- (-1821.034) (-1817.588) [-1818.052] (-1819.920) * [-1817.712] (-1817.419) (-1823.780) (-1818.388) -- 0:00:43
      346500 -- [-1818.246] (-1821.757) (-1816.469) (-1819.006) * (-1822.133) (-1820.248) (-1822.417) [-1819.246] -- 0:00:43
      347000 -- (-1820.493) [-1819.909] (-1818.125) (-1818.846) * (-1816.617) (-1821.519) (-1823.299) [-1817.769] -- 0:00:43
      347500 -- (-1818.592) (-1819.631) [-1819.713] (-1818.875) * [-1816.503] (-1819.399) (-1819.741) (-1817.693) -- 0:00:43
      348000 -- [-1818.832] (-1817.357) (-1819.001) (-1819.836) * [-1816.694] (-1817.366) (-1817.329) (-1819.449) -- 0:00:43
      348500 -- (-1820.217) (-1817.110) (-1819.955) [-1818.904] * (-1818.250) [-1817.350] (-1817.672) (-1824.105) -- 0:00:42
      349000 -- [-1817.645] (-1817.337) (-1817.275) (-1819.596) * (-1820.654) [-1817.252] (-1822.352) (-1820.224) -- 0:00:42
      349500 -- (-1818.928) (-1818.485) (-1818.345) [-1818.334] * (-1820.527) (-1818.595) (-1819.294) [-1818.303] -- 0:00:42
      350000 -- (-1819.438) (-1818.717) (-1820.539) [-1818.883] * (-1821.884) (-1817.436) (-1818.113) [-1818.517] -- 0:00:42

      Average standard deviation of split frequencies: 0.017924

      350500 -- (-1816.651) [-1817.373] (-1819.906) (-1819.449) * (-1821.383) [-1819.872] (-1818.114) (-1819.728) -- 0:00:42
      351000 -- (-1816.528) (-1817.301) (-1820.173) [-1817.276] * (-1818.047) [-1818.926] (-1818.942) (-1821.144) -- 0:00:42
      351500 -- (-1816.962) [-1816.912] (-1819.280) (-1818.032) * [-1818.071] (-1818.669) (-1817.203) (-1818.496) -- 0:00:42
      352000 -- [-1816.962] (-1817.772) (-1819.516) (-1819.365) * [-1818.550] (-1817.610) (-1816.506) (-1817.018) -- 0:00:42
      352500 -- (-1818.877) (-1819.474) (-1817.150) [-1818.021] * [-1818.603] (-1819.808) (-1817.780) (-1817.977) -- 0:00:42
      353000 -- (-1818.072) [-1817.678] (-1819.549) (-1817.044) * (-1819.677) (-1821.680) [-1820.903] (-1817.688) -- 0:00:42
      353500 -- (-1817.638) (-1819.641) (-1818.515) [-1817.209] * (-1818.353) (-1818.789) (-1819.007) [-1818.433] -- 0:00:42
      354000 -- (-1817.845) (-1819.732) (-1819.214) [-1817.244] * (-1817.607) (-1821.136) (-1820.200) [-1822.821] -- 0:00:41
      354500 -- [-1818.420] (-1817.902) (-1819.564) (-1817.380) * (-1818.055) (-1821.996) (-1818.637) [-1819.343] -- 0:00:41
      355000 -- (-1817.267) [-1818.968] (-1819.398) (-1817.285) * [-1818.004] (-1823.503) (-1819.764) (-1818.588) -- 0:00:41

      Average standard deviation of split frequencies: 0.016726

      355500 -- [-1819.229] (-1817.743) (-1820.211) (-1817.596) * (-1819.427) (-1818.399) [-1820.061] (-1817.932) -- 0:00:41
      356000 -- (-1819.337) (-1817.941) [-1820.230] (-1819.411) * (-1818.222) (-1817.659) [-1820.457] (-1817.994) -- 0:00:41
      356500 -- [-1817.267] (-1818.390) (-1821.367) (-1818.497) * (-1820.361) [-1817.949] (-1820.359) (-1819.731) -- 0:00:41
      357000 -- (-1817.229) (-1818.040) (-1818.154) [-1816.578] * [-1820.972] (-1817.640) (-1817.979) (-1822.284) -- 0:00:43
      357500 -- [-1819.024] (-1817.871) (-1819.428) (-1821.141) * [-1821.261] (-1816.434) (-1817.965) (-1820.013) -- 0:00:43
      358000 -- (-1817.821) [-1818.505] (-1818.912) (-1818.490) * (-1818.502) (-1817.509) [-1817.493] (-1821.607) -- 0:00:43
      358500 -- (-1818.111) (-1819.722) (-1818.497) [-1819.406] * (-1816.911) (-1818.903) [-1817.085] (-1817.156) -- 0:00:42
      359000 -- [-1817.614] (-1818.459) (-1818.600) (-1820.223) * (-1817.672) [-1818.495] (-1817.369) (-1822.389) -- 0:00:42
      359500 -- (-1817.182) (-1816.601) [-1817.076] (-1819.665) * (-1818.555) (-1823.171) (-1817.051) [-1824.011] -- 0:00:42
      360000 -- (-1819.202) (-1819.712) [-1816.761] (-1818.576) * (-1818.545) (-1817.294) (-1818.096) [-1823.427] -- 0:00:42

      Average standard deviation of split frequencies: 0.017209

      360500 -- (-1818.557) (-1817.885) [-1816.754] (-1817.116) * [-1820.297] (-1816.812) (-1822.556) (-1818.053) -- 0:00:42
      361000 -- (-1816.681) (-1822.342) [-1819.625] (-1817.070) * (-1819.193) [-1819.410] (-1818.882) (-1817.717) -- 0:00:42
      361500 -- (-1819.983) [-1820.778] (-1816.768) (-1816.956) * [-1819.394] (-1817.341) (-1817.644) (-1817.872) -- 0:00:42
      362000 -- (-1819.422) (-1821.999) (-1817.660) [-1818.130] * (-1819.914) (-1817.745) [-1816.997] (-1817.787) -- 0:00:42
      362500 -- [-1823.064] (-1820.542) (-1818.411) (-1820.505) * [-1820.411] (-1818.851) (-1816.709) (-1818.863) -- 0:00:42
      363000 -- (-1823.112) (-1820.921) [-1817.624] (-1819.607) * (-1818.827) (-1820.621) (-1817.760) [-1820.556] -- 0:00:42
      363500 -- (-1825.490) (-1821.199) (-1817.617) [-1818.523] * (-1818.511) [-1818.638] (-1817.988) (-1819.214) -- 0:00:42
      364000 -- (-1819.935) (-1816.732) [-1817.831] (-1821.025) * (-1818.572) (-1818.050) [-1817.969] (-1821.767) -- 0:00:41
      364500 -- (-1818.827) [-1821.867] (-1819.542) (-1819.983) * (-1817.368) (-1820.667) [-1817.345] (-1818.930) -- 0:00:41
      365000 -- (-1821.468) [-1818.014] (-1820.038) (-1818.338) * (-1822.159) (-1820.754) [-1817.679] (-1816.553) -- 0:00:41

      Average standard deviation of split frequencies: 0.016066

      365500 -- (-1820.111) (-1819.089) [-1820.026] (-1819.323) * (-1822.146) (-1820.332) [-1821.943] (-1816.958) -- 0:00:41
      366000 -- (-1821.726) (-1820.274) [-1818.333] (-1818.631) * (-1817.643) (-1823.622) [-1817.695] (-1816.454) -- 0:00:41
      366500 -- (-1818.387) (-1818.704) [-1816.845] (-1821.067) * (-1819.181) (-1818.251) [-1818.177] (-1817.406) -- 0:00:41
      367000 -- (-1819.715) (-1818.593) [-1820.561] (-1818.739) * (-1818.521) [-1817.447] (-1822.584) (-1817.597) -- 0:00:41
      367500 -- (-1819.407) (-1819.957) (-1821.108) [-1816.961] * (-1817.982) [-1817.157] (-1821.096) (-1819.879) -- 0:00:41
      368000 -- (-1821.193) (-1818.868) (-1817.310) [-1817.831] * [-1818.287] (-1817.331) (-1817.600) (-1819.735) -- 0:00:41
      368500 -- (-1822.066) [-1818.191] (-1817.760) (-1817.633) * (-1817.804) [-1817.336] (-1817.939) (-1820.149) -- 0:00:41
      369000 -- (-1817.034) (-1820.648) [-1818.014] (-1818.894) * (-1818.486) [-1824.631] (-1817.592) (-1820.419) -- 0:00:41
      369500 -- (-1819.828) (-1820.303) [-1824.293] (-1818.769) * (-1818.131) [-1819.512] (-1818.453) (-1817.796) -- 0:00:40
      370000 -- (-1818.178) (-1816.935) (-1818.719) [-1818.266] * (-1818.252) (-1822.638) (-1817.661) [-1818.684] -- 0:00:40

      Average standard deviation of split frequencies: 0.016109

      370500 -- [-1816.880] (-1817.614) (-1818.052) (-1819.648) * [-1816.974] (-1816.995) (-1817.748) (-1819.756) -- 0:00:40
      371000 -- (-1816.575) (-1817.036) [-1817.193] (-1819.055) * (-1818.337) (-1817.112) (-1817.877) [-1819.677] -- 0:00:40
      371500 -- (-1816.892) (-1816.926) (-1818.722) [-1818.347] * (-1818.386) [-1821.103] (-1818.975) (-1819.325) -- 0:00:40
      372000 -- [-1818.484] (-1820.997) (-1817.866) (-1821.407) * (-1817.411) [-1819.222] (-1817.903) (-1819.299) -- 0:00:42
      372500 -- (-1820.664) (-1821.585) [-1816.513] (-1818.732) * (-1821.887) [-1818.377] (-1820.015) (-1819.299) -- 0:00:42
      373000 -- (-1821.507) (-1821.965) (-1816.844) [-1818.019] * (-1820.551) (-1818.993) (-1821.353) [-1818.068] -- 0:00:42
      373500 -- (-1817.154) [-1817.839] (-1817.053) (-1819.521) * (-1820.153) [-1817.981] (-1817.908) (-1818.101) -- 0:00:41
      374000 -- (-1820.480) (-1817.398) [-1818.329] (-1819.445) * (-1817.287) (-1820.163) [-1817.936] (-1817.952) -- 0:00:41
      374500 -- (-1827.654) (-1820.156) (-1817.618) [-1819.863] * (-1819.400) (-1818.229) (-1818.221) [-1817.576] -- 0:00:41
      375000 -- (-1820.309) (-1817.796) (-1818.226) [-1817.442] * (-1824.455) (-1817.411) (-1825.135) [-1817.408] -- 0:00:41

      Average standard deviation of split frequencies: 0.014836

      375500 -- (-1820.583) [-1818.023] (-1816.395) (-1822.313) * (-1818.307) (-1816.978) (-1820.615) [-1817.021] -- 0:00:41
      376000 -- (-1819.802) (-1819.791) (-1817.644) [-1822.341] * (-1818.546) (-1817.124) (-1818.164) [-1817.457] -- 0:00:41
      376500 -- (-1818.067) (-1820.092) [-1817.960] (-1821.393) * (-1818.374) (-1816.892) [-1819.440] (-1818.390) -- 0:00:41
      377000 -- (-1818.890) (-1820.580) (-1820.832) [-1819.090] * [-1819.270] (-1823.205) (-1817.009) (-1819.749) -- 0:00:41
      377500 -- (-1818.863) (-1817.691) [-1817.518] (-1822.369) * (-1819.522) (-1820.289) [-1817.282] (-1820.902) -- 0:00:41
      378000 -- (-1818.202) (-1817.353) [-1821.795] (-1825.324) * [-1817.712] (-1819.869) (-1818.584) (-1822.017) -- 0:00:41
      378500 -- (-1819.583) [-1817.326] (-1821.698) (-1817.570) * (-1817.001) (-1818.967) (-1817.669) [-1820.851] -- 0:00:41
      379000 -- [-1817.100] (-1820.085) (-1819.964) (-1818.500) * [-1817.285] (-1820.645) (-1819.079) (-1824.069) -- 0:00:40
      379500 -- [-1817.027] (-1817.924) (-1818.189) (-1818.746) * (-1818.858) (-1822.627) (-1818.415) [-1820.774] -- 0:00:40
      380000 -- (-1821.751) [-1820.046] (-1816.428) (-1822.553) * [-1817.565] (-1820.945) (-1817.496) (-1819.554) -- 0:00:40

      Average standard deviation of split frequencies: 0.014933

      380500 -- (-1818.876) (-1820.201) (-1820.600) [-1818.798] * (-1819.863) [-1819.206] (-1819.280) (-1823.318) -- 0:00:40
      381000 -- (-1816.299) (-1817.910) (-1817.963) [-1821.927] * (-1821.425) (-1817.924) (-1820.051) [-1819.035] -- 0:00:40
      381500 -- (-1816.332) (-1821.014) (-1817.807) [-1821.629] * (-1817.327) [-1817.669] (-1818.453) (-1820.327) -- 0:00:40
      382000 -- (-1817.521) [-1821.925] (-1820.717) (-1816.370) * (-1818.451) (-1818.713) [-1818.272] (-1820.948) -- 0:00:40
      382500 -- (-1817.528) [-1818.210] (-1822.114) (-1820.429) * (-1819.121) [-1822.497] (-1817.928) (-1820.179) -- 0:00:40
      383000 -- (-1817.420) (-1819.103) [-1818.005] (-1818.685) * (-1819.092) (-1817.159) (-1818.567) [-1819.099] -- 0:00:40
      383500 -- (-1819.502) [-1817.398] (-1818.937) (-1817.495) * (-1819.825) (-1816.805) (-1818.497) [-1820.137] -- 0:00:40
      384000 -- (-1816.580) (-1817.878) (-1818.862) [-1822.388] * (-1817.239) (-1816.886) (-1818.823) [-1818.887] -- 0:00:40
      384500 -- (-1817.600) (-1816.598) [-1825.643] (-1818.015) * (-1819.139) (-1817.106) (-1820.742) [-1818.222] -- 0:00:40
      385000 -- (-1817.416) [-1818.655] (-1825.070) (-1818.878) * (-1822.901) [-1817.506] (-1821.135) (-1817.362) -- 0:00:39

      Average standard deviation of split frequencies: 0.015373

      385500 -- (-1816.378) (-1823.458) (-1818.328) [-1818.848] * [-1820.762] (-1818.230) (-1818.733) (-1818.145) -- 0:00:39
      386000 -- (-1816.889) (-1819.579) [-1818.673] (-1821.275) * (-1820.758) [-1818.721] (-1820.164) (-1817.973) -- 0:00:41
      386500 -- (-1816.889) (-1819.881) (-1819.957) [-1821.701] * (-1820.311) [-1821.376] (-1817.067) (-1823.224) -- 0:00:41
      387000 -- (-1817.998) (-1823.919) [-1817.099] (-1820.018) * (-1820.434) (-1817.567) [-1817.589] (-1821.592) -- 0:00:41
      387500 -- (-1817.317) (-1819.155) [-1817.030] (-1820.511) * [-1819.239] (-1818.618) (-1818.306) (-1822.545) -- 0:00:41
      388000 -- (-1817.664) [-1819.333] (-1818.001) (-1821.691) * [-1819.329] (-1819.138) (-1818.987) (-1818.283) -- 0:00:41
      388500 -- [-1819.233] (-1817.648) (-1818.803) (-1821.694) * (-1819.011) [-1819.533] (-1817.327) (-1821.670) -- 0:00:40
      389000 -- [-1819.551] (-1818.263) (-1817.978) (-1820.954) * [-1818.364] (-1820.756) (-1817.510) (-1818.722) -- 0:00:40
      389500 -- (-1818.369) (-1816.784) (-1817.266) [-1818.373] * [-1818.565] (-1817.349) (-1817.559) (-1817.604) -- 0:00:40
      390000 -- [-1816.955] (-1818.054) (-1818.103) (-1818.651) * (-1817.525) (-1817.667) [-1819.219] (-1818.517) -- 0:00:40

      Average standard deviation of split frequencies: 0.015616

      390500 -- (-1816.366) [-1823.313] (-1819.168) (-1819.164) * (-1824.169) (-1819.752) (-1818.246) [-1820.864] -- 0:00:40
      391000 -- (-1818.047) [-1817.806] (-1821.915) (-1817.924) * (-1821.764) [-1819.789] (-1818.113) (-1817.011) -- 0:00:40
      391500 -- (-1817.924) (-1818.603) (-1818.074) [-1820.121] * (-1825.163) [-1818.639] (-1817.817) (-1817.115) -- 0:00:40
      392000 -- (-1818.620) (-1818.546) (-1820.486) [-1818.149] * [-1822.401] (-1817.521) (-1818.014) (-1817.811) -- 0:00:40
      392500 -- (-1817.774) (-1818.434) [-1821.106] (-1819.692) * (-1822.107) [-1819.605] (-1820.867) (-1817.139) -- 0:00:40
      393000 -- [-1819.515] (-1821.116) (-1819.180) (-1818.636) * (-1820.027) [-1818.376] (-1820.258) (-1817.208) -- 0:00:40
      393500 -- [-1819.320] (-1818.186) (-1818.278) (-1819.496) * [-1819.188] (-1817.334) (-1817.526) (-1819.844) -- 0:00:40
      394000 -- (-1818.561) [-1819.439] (-1817.834) (-1820.233) * (-1817.139) (-1818.155) (-1817.733) [-1821.437] -- 0:00:39
      394500 -- (-1817.388) (-1820.780) (-1817.756) [-1820.142] * (-1816.783) (-1818.902) [-1817.853] (-1820.456) -- 0:00:39
      395000 -- [-1817.505] (-1819.719) (-1817.134) (-1819.146) * (-1818.481) [-1817.259] (-1819.930) (-1820.762) -- 0:00:39

      Average standard deviation of split frequencies: 0.015475

      395500 -- [-1817.570] (-1817.286) (-1821.189) (-1818.832) * (-1819.613) (-1817.390) (-1820.272) [-1819.182] -- 0:00:39
      396000 -- (-1818.648) (-1817.146) (-1822.173) [-1821.182] * (-1817.979) (-1817.594) (-1824.945) [-1818.401] -- 0:00:39
      396500 -- (-1822.094) (-1820.055) (-1817.682) [-1824.305] * (-1819.887) (-1821.455) [-1821.587] (-1818.570) -- 0:00:39
      397000 -- [-1822.555] (-1818.569) (-1816.888) (-1818.479) * (-1819.921) [-1817.925] (-1820.774) (-1819.325) -- 0:00:39
      397500 -- (-1819.066) (-1818.044) (-1816.615) [-1817.402] * [-1826.428] (-1818.757) (-1822.898) (-1820.748) -- 0:00:39
      398000 -- (-1819.218) (-1817.427) [-1817.568] (-1818.187) * (-1822.318) (-1817.763) (-1819.720) [-1817.573] -- 0:00:39
      398500 -- [-1818.231] (-1817.579) (-1820.234) (-1817.170) * (-1820.419) (-1820.450) [-1820.044] (-1821.619) -- 0:00:39
      399000 -- (-1817.611) [-1816.716] (-1816.884) (-1821.812) * (-1819.413) (-1819.060) [-1816.940] (-1822.091) -- 0:00:39
      399500 -- (-1818.148) (-1818.021) [-1819.169] (-1817.170) * [-1820.153] (-1821.236) (-1817.423) (-1818.701) -- 0:00:39
      400000 -- (-1819.241) [-1818.214] (-1821.068) (-1817.377) * (-1817.862) (-1819.155) (-1817.421) [-1819.394] -- 0:00:40

      Average standard deviation of split frequencies: 0.015710

      400500 -- (-1816.800) [-1818.120] (-1821.847) (-1818.987) * (-1817.517) (-1817.718) [-1817.421] (-1819.789) -- 0:00:40
      401000 -- (-1818.800) (-1817.176) [-1817.846] (-1817.986) * (-1821.444) [-1817.716] (-1817.761) (-1820.756) -- 0:00:40
      401500 -- (-1817.366) (-1821.034) [-1817.286] (-1821.241) * (-1821.872) [-1817.746] (-1819.967) (-1817.250) -- 0:00:40
      402000 -- (-1820.003) [-1819.024] (-1817.724) (-1820.042) * (-1819.420) [-1817.994] (-1818.078) (-1817.531) -- 0:00:40
      402500 -- [-1819.505] (-1818.294) (-1819.021) (-1818.741) * (-1818.256) (-1818.059) (-1818.678) [-1817.346] -- 0:00:40
      403000 -- (-1820.217) (-1818.278) [-1817.485] (-1818.465) * [-1817.515] (-1817.354) (-1816.768) (-1817.306) -- 0:00:39
      403500 -- (-1818.629) (-1817.412) (-1819.101) [-1818.041] * (-1822.668) (-1818.599) (-1819.349) [-1817.368] -- 0:00:39
      404000 -- (-1818.678) [-1819.637] (-1819.593) (-1818.017) * [-1819.811] (-1820.502) (-1820.173) (-1821.201) -- 0:00:39
      404500 -- (-1817.312) (-1817.501) [-1817.966] (-1818.902) * [-1820.452] (-1820.500) (-1820.140) (-1821.201) -- 0:00:39
      405000 -- (-1817.402) (-1819.615) [-1820.116] (-1818.222) * [-1818.191] (-1817.453) (-1822.253) (-1817.194) -- 0:00:39

      Average standard deviation of split frequencies: 0.015216

      405500 -- (-1818.529) [-1821.917] (-1817.716) (-1819.666) * (-1818.651) [-1818.652] (-1819.688) (-1820.442) -- 0:00:39
      406000 -- (-1818.345) (-1823.399) [-1819.335] (-1819.852) * (-1817.525) (-1822.280) [-1818.124] (-1821.997) -- 0:00:39
      406500 -- (-1824.690) [-1819.340] (-1817.710) (-1819.221) * (-1820.231) (-1818.291) (-1819.707) [-1817.760] -- 0:00:39
      407000 -- (-1822.076) (-1818.397) [-1816.815] (-1818.399) * (-1818.717) (-1817.633) (-1827.019) [-1820.388] -- 0:00:39
      407500 -- (-1818.638) (-1819.161) (-1817.024) [-1818.729] * (-1817.903) (-1817.760) [-1818.821] (-1818.135) -- 0:00:39
      408000 -- [-1817.634] (-182