--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 10:12:48 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/cspB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -550.79 -553.92
2 -550.79 -554.38
--------------------------------------
TOTAL -550.79 -554.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900510 0.091042 0.383513 1.503505 0.866592 1297.47 1399.23 1.000
r(A<->C){all} 0.162318 0.019763 0.000420 0.450981 0.124596 162.60 181.94 1.000
r(A<->G){all} 0.166558 0.019812 0.000007 0.449714 0.129190 226.88 256.50 1.000
r(A<->T){all} 0.162782 0.019771 0.000062 0.453373 0.124088 199.40 233.57 1.011
r(C<->G){all} 0.175740 0.021727 0.000059 0.463401 0.141105 178.72 197.63 1.000
r(C<->T){all} 0.162734 0.018953 0.000237 0.442528 0.126766 248.27 248.41 1.002
r(G<->T){all} 0.169867 0.021818 0.000049 0.467964 0.126619 217.21 256.46 1.000
pi(A){all} 0.191926 0.000406 0.153950 0.231017 0.190793 1307.85 1385.91 1.000
pi(C){all} 0.264076 0.000458 0.220846 0.304657 0.263788 1386.21 1424.19 1.000
pi(G){all} 0.361691 0.000572 0.316234 0.408662 0.361790 875.56 1151.56 1.001
pi(T){all} 0.182307 0.000353 0.148210 0.221505 0.181706 1317.30 1386.28 1.002
alpha{1,2} 0.413444 0.244141 0.000188 1.393553 0.240819 1253.77 1272.56 1.000
alpha{3} 0.464488 0.263879 0.000175 1.486292 0.290096 1137.01 1231.08 1.000
pinvar{all} 0.996044 0.000023 0.986885 0.999998 0.997589 1180.27 1336.97 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -530.168395
Model 2: PositiveSelection -530.168539
Model 0: one-ratio -530.168395
Model 7: beta -530.168395
Model 8: beta&w>1 -530.168395
Model 0 vs 1 0.0
Model 2 vs 1 2.879999999549909E-4
Model 8 vs 7 0.0
>C1
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C2
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C3
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C4
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C5
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C6
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=136
C1 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C2 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C3 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C4 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C5 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C6 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
**************************************************
C1 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C2 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C3 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C4 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C5 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C6 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
**************************************************
C1 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C2 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C3 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C4 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C5 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C6 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4080]--->[4080]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.463 Mb, Max= 30.667 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C2 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C3 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C4 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C5 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C6 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
**************************************************
C1 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C2 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C3 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C4 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C5 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C6 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
**************************************************
C1 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C2 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C3 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C4 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C5 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C6 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
C2 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
C3 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
C4 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
C5 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
C6 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
**************************************************
C1 CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
C2 CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
C3 CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
C4 CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
C5 CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
C6 CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
**************************************************
C1 CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
C2 CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
C3 CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
C4 CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
C5 CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
C6 CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
**************************************************
C1 GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
C2 GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
C3 GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
C4 GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
C5 GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
C6 GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
**************************************************
C1 GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
C2 GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
C3 GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
C4 GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
C5 GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
C6 GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
**************************************************
C1 GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
C2 GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
C3 GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
C4 GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
C5 GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
C6 GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
**************************************************
C1 CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
C2 CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
C3 CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
C4 CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
C5 CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
C6 CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
**************************************************
C1 CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
C2 CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
C3 CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
C4 CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
C5 CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
C6 CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
**************************************************
C1 TCGACGCG
C2 TCGACGCG
C3 TCGACGCG
C4 TCGACGCG
C5 TCGACGCG
C6 TCGACGCG
********
>C1
GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
TCGACGCG
>C2
GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
TCGACGCG
>C3
GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
TCGACGCG
>C4
GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
TCGACGCG
>C5
GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
TCGACGCG
>C6
GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
TCGACGCG
>C1
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C2
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C3
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C4
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C5
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C6
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 408 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579774290
Setting output file names to "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1822642686
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8835211020
Seed = 1022277194
Swapseed = 1579774290
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -913.123558 -- -24.965149
Chain 2 -- -913.123558 -- -24.965149
Chain 3 -- -913.123558 -- -24.965149
Chain 4 -- -913.123558 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -913.123419 -- -24.965149
Chain 2 -- -913.123558 -- -24.965149
Chain 3 -- -913.123558 -- -24.965149
Chain 4 -- -913.123505 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-913.124] (-913.124) (-913.124) (-913.124) * [-913.123] (-913.124) (-913.124) (-913.124)
500 -- [-562.296] (-568.775) (-563.418) (-568.599) * [-566.774] (-572.115) (-565.221) (-574.889) -- 0:00:00
1000 -- (-562.257) (-569.709) (-554.271) [-552.615] * (-558.314) (-564.265) [-558.595] (-566.742) -- 0:00:00
1500 -- (-568.262) [-563.759] (-563.035) (-561.109) * (-563.812) (-558.808) [-559.231] (-564.270) -- 0:00:00
2000 -- [-557.237] (-561.422) (-563.326) (-567.111) * (-564.122) (-557.968) [-555.551] (-562.581) -- 0:00:00
2500 -- [-554.828] (-553.604) (-571.216) (-562.784) * (-569.485) (-566.136) (-560.692) [-556.788] -- 0:00:00
3000 -- (-560.111) [-556.414] (-562.477) (-567.825) * (-560.634) [-560.661] (-555.743) (-561.396) -- 0:05:32
3500 -- (-563.836) (-566.120) [-557.503] (-563.061) * (-559.569) (-562.700) [-556.729] (-555.934) -- 0:04:44
4000 -- [-555.982] (-566.728) (-571.509) (-560.964) * (-568.674) (-559.791) [-554.355] (-555.351) -- 0:04:09
4500 -- (-559.214) (-564.602) [-557.526] (-563.631) * [-558.455] (-567.307) (-565.392) (-561.640) -- 0:03:41
5000 -- (-558.316) (-565.429) (-553.963) [-562.516] * [-563.568] (-558.644) (-563.971) (-571.179) -- 0:03:19
Average standard deviation of split frequencies: 0.099995
5500 -- [-560.527] (-561.226) (-559.048) (-564.010) * (-564.593) [-562.207] (-564.193) (-564.394) -- 0:03:00
6000 -- (-559.697) (-556.333) (-559.670) [-559.914] * (-560.833) (-559.687) (-563.836) [-558.936] -- 0:02:45
6500 -- (-563.643) (-560.493) [-561.589] (-560.853) * (-555.869) (-563.605) (-559.550) [-564.117] -- 0:02:32
7000 -- [-555.790] (-556.571) (-562.140) (-563.537) * (-567.514) (-561.542) (-558.828) [-555.223] -- 0:02:21
7500 -- [-558.569] (-559.948) (-561.437) (-565.826) * (-565.132) (-561.330) (-557.142) [-564.974] -- 0:02:12
8000 -- [-563.506] (-559.989) (-565.978) (-564.651) * [-555.382] (-566.175) (-557.870) (-568.598) -- 0:02:04
8500 -- (-554.255) (-572.120) (-568.333) [-561.704] * [-559.219] (-554.989) (-563.790) (-552.060) -- 0:01:56
9000 -- (-565.739) (-561.629) (-562.969) [-550.023] * (-568.648) (-557.085) [-553.460] (-549.870) -- 0:01:50
9500 -- (-557.903) (-570.642) [-561.403] (-552.367) * (-560.393) (-562.537) (-563.690) [-550.157] -- 0:01:44
10000 -- (-559.641) (-556.284) (-575.090) [-550.318] * (-555.410) [-552.837] (-564.213) (-551.728) -- 0:01:39
Average standard deviation of split frequencies: 0.061030
10500 -- (-559.526) [-570.416] (-560.156) (-552.990) * [-557.724] (-566.205) (-562.939) (-551.563) -- 0:01:34
11000 -- (-562.106) [-555.386] (-561.063) (-552.303) * [-560.860] (-559.930) (-565.169) (-550.520) -- 0:01:29
11500 -- (-559.956) [-561.162] (-560.932) (-549.818) * (-555.984) [-557.578] (-568.295) (-550.778) -- 0:01:25
12000 -- (-559.956) (-562.406) (-560.774) [-552.355] * (-566.496) [-555.919] (-572.586) (-550.227) -- 0:01:22
12500 -- [-557.167] (-560.380) (-563.715) (-550.750) * [-562.750] (-564.274) (-568.500) (-552.529) -- 0:01:19
13000 -- (-556.319) (-561.088) (-561.146) [-553.351] * [-561.784] (-569.136) (-564.134) (-552.856) -- 0:01:15
13500 -- (-561.473) (-566.962) (-563.687) [-551.395] * [-556.049] (-559.532) (-550.697) (-550.606) -- 0:01:13
14000 -- (-557.732) (-558.793) [-562.183] (-552.364) * [-562.747] (-568.344) (-552.447) (-553.473) -- 0:01:10
14500 -- (-559.682) (-558.107) (-563.027) [-550.010] * [-561.622] (-556.098) (-550.248) (-551.838) -- 0:01:07
15000 -- (-561.923) (-561.546) [-558.022] (-549.914) * (-563.493) (-556.717) [-550.210] (-551.129) -- 0:01:05
Average standard deviation of split frequencies: 0.067591
15500 -- [-561.209] (-563.627) (-558.904) (-553.509) * [-561.360] (-559.017) (-551.768) (-550.385) -- 0:01:03
16000 -- (-562.454) (-558.368) (-559.544) [-549.919] * (-563.617) [-557.752] (-550.851) (-552.287) -- 0:01:01
16500 -- (-560.896) [-558.518] (-559.284) (-553.164) * [-561.329] (-564.594) (-550.029) (-556.864) -- 0:00:59
17000 -- (-560.874) (-560.544) (-560.586) [-553.174] * (-560.615) [-560.135] (-551.627) (-554.059) -- 0:00:57
17500 -- (-562.659) (-559.775) (-561.673) [-551.359] * (-559.655) [-558.038] (-554.011) (-550.553) -- 0:00:56
18000 -- [-555.835] (-562.963) (-558.261) (-552.343) * (-562.655) (-563.963) (-551.125) [-551.858] -- 0:00:54
18500 -- [-560.800] (-561.620) (-558.249) (-555.223) * (-559.230) (-557.728) (-550.940) [-551.796] -- 0:01:46
19000 -- (-559.907) (-562.391) (-560.300) [-550.008] * (-557.354) (-560.874) [-549.986] (-551.673) -- 0:01:43
19500 -- [-559.019] (-566.109) (-567.460) (-552.206) * (-566.581) (-559.118) [-550.473] (-551.849) -- 0:01:40
20000 -- (-555.294) [-562.007] (-561.797) (-554.276) * (-562.190) (-566.986) [-551.179] (-552.214) -- 0:01:38
Average standard deviation of split frequencies: 0.041343
20500 -- (-560.363) [-566.170] (-564.376) (-553.891) * (-559.663) (-564.083) [-550.984] (-552.117) -- 0:01:35
21000 -- (-558.084) (-569.598) [-556.048] (-550.880) * (-567.042) (-556.110) [-551.684] (-554.903) -- 0:01:33
21500 -- (-570.482) (-560.491) [-556.208] (-552.869) * (-564.500) [-559.059] (-551.503) (-551.272) -- 0:01:31
22000 -- [-557.098] (-566.835) (-558.348) (-551.587) * [-558.392] (-555.180) (-557.851) (-550.186) -- 0:01:28
22500 -- (-567.286) (-558.148) [-560.053] (-552.596) * (-562.598) [-553.428] (-550.087) (-549.500) -- 0:01:26
23000 -- (-552.822) (-557.663) (-552.569) [-554.441] * [-558.849] (-560.930) (-553.117) (-550.243) -- 0:01:24
23500 -- (-557.622) (-561.302) [-550.712] (-554.868) * (-557.734) [-558.068] (-549.579) (-550.613) -- 0:01:23
24000 -- [-551.609] (-562.962) (-549.982) (-551.981) * (-559.453) (-562.481) [-551.644] (-550.168) -- 0:01:21
24500 -- (-553.203) (-564.123) [-553.596] (-551.348) * [-556.938] (-556.781) (-552.064) (-556.303) -- 0:01:19
25000 -- (-550.477) [-565.126] (-552.619) (-551.562) * (-559.748) (-567.418) [-550.988] (-552.368) -- 0:01:18
Average standard deviation of split frequencies: 0.033897
25500 -- [-551.949] (-561.427) (-552.297) (-551.817) * [-562.598] (-568.406) (-550.193) (-553.522) -- 0:01:16
26000 -- (-549.602) [-564.520] (-549.991) (-551.912) * (-555.706) (-560.808) [-551.612] (-553.173) -- 0:01:14
26500 -- (-550.183) [-555.542] (-550.699) (-549.805) * (-559.253) (-562.430) (-549.979) [-551.010] -- 0:01:13
27000 -- (-552.249) [-563.066] (-553.815) (-549.640) * (-571.009) [-557.560] (-549.846) (-551.269) -- 0:01:12
27500 -- (-552.680) (-558.355) (-552.967) [-549.435] * (-558.063) (-557.803) (-553.097) [-550.633] -- 0:01:10
28000 -- (-551.512) [-556.572] (-551.598) (-552.698) * (-558.868) [-563.066] (-551.463) (-555.328) -- 0:01:09
28500 -- (-551.487) (-559.657) [-551.944] (-555.555) * (-566.753) (-556.889) (-552.223) [-551.758] -- 0:01:08
29000 -- (-552.073) [-567.652] (-552.072) (-550.424) * (-560.688) [-555.759] (-551.416) (-551.861) -- 0:01:06
29500 -- [-550.123] (-561.987) (-549.662) (-550.166) * (-560.697) [-565.875] (-551.686) (-551.857) -- 0:01:05
30000 -- (-552.722) (-560.375) (-550.978) [-549.956] * (-555.471) (-565.674) (-550.969) [-553.467] -- 0:01:04
Average standard deviation of split frequencies: 0.039528
30500 -- [-550.169] (-557.651) (-551.434) (-553.944) * (-556.573) [-557.571] (-550.079) (-550.158) -- 0:01:03
31000 -- [-550.907] (-572.859) (-550.588) (-550.999) * (-563.051) [-564.781] (-551.068) (-550.902) -- 0:01:02
31500 -- [-551.201] (-550.290) (-549.989) (-550.993) * [-558.066] (-568.727) (-549.580) (-562.099) -- 0:01:01
32000 -- (-550.985) [-550.202] (-550.607) (-550.572) * [-558.445] (-571.170) (-554.820) (-551.929) -- 0:01:00
32500 -- (-549.624) [-553.253] (-551.131) (-551.347) * (-558.058) (-551.481) (-553.953) [-550.070] -- 0:00:59
33000 -- (-550.484) (-552.822) (-549.821) [-551.248] * (-564.066) (-552.608) (-555.159) [-551.869] -- 0:00:58
33500 -- (-552.279) (-550.597) (-550.683) [-549.301] * [-557.716] (-550.653) (-550.984) (-550.736) -- 0:00:57
34000 -- (-554.388) [-551.518] (-552.775) (-549.597) * [-560.877] (-554.843) (-552.139) (-551.285) -- 0:00:56
34500 -- (-553.815) (-552.760) (-551.513) [-553.213] * (-560.520) (-553.913) (-550.758) [-551.023] -- 0:00:55
35000 -- [-550.246] (-553.878) (-552.781) (-551.446) * (-554.854) [-552.733] (-554.231) (-553.186) -- 0:01:22
Average standard deviation of split frequencies: 0.035868
35500 -- [-550.544] (-552.444) (-554.234) (-551.839) * [-558.545] (-550.966) (-556.585) (-553.298) -- 0:01:21
36000 -- (-552.230) (-551.247) [-550.967] (-550.006) * (-573.820) (-550.874) [-551.028] (-550.345) -- 0:01:20
36500 -- (-551.486) (-551.584) [-551.772] (-552.862) * (-565.139) (-554.636) (-550.699) [-551.059] -- 0:01:19
37000 -- (-550.086) (-551.733) (-550.481) [-550.769] * (-573.223) [-551.410] (-550.193) (-550.594) -- 0:01:18
37500 -- (-550.272) [-552.896] (-552.530) (-550.037) * [-564.019] (-552.472) (-551.321) (-550.135) -- 0:01:17
38000 -- (-550.761) (-554.079) [-550.785] (-550.767) * (-567.530) (-550.448) (-553.923) [-549.891] -- 0:01:15
38500 -- (-552.090) [-552.837] (-549.468) (-555.458) * (-556.056) (-551.580) (-557.451) [-555.600] -- 0:01:14
39000 -- (-551.473) [-552.593] (-549.365) (-552.091) * (-558.247) [-550.064] (-554.120) (-555.478) -- 0:01:13
39500 -- [-551.863] (-550.516) (-555.548) (-550.823) * [-557.971] (-550.105) (-551.382) (-553.222) -- 0:01:12
40000 -- [-549.247] (-550.800) (-554.857) (-559.520) * (-587.233) (-550.286) (-550.821) [-552.651] -- 0:01:12
Average standard deviation of split frequencies: 0.039046
40500 -- [-553.296] (-552.317) (-551.313) (-550.143) * (-574.956) [-552.791] (-550.683) (-550.535) -- 0:01:11
41000 -- [-551.781] (-554.365) (-549.511) (-551.066) * (-557.340) [-553.513] (-553.191) (-551.971) -- 0:01:10
41500 -- (-549.444) (-550.967) (-550.129) [-551.793] * [-550.356] (-553.006) (-551.861) (-550.603) -- 0:01:09
42000 -- [-549.609] (-549.729) (-552.135) (-549.879) * [-550.461] (-554.908) (-554.336) (-554.861) -- 0:01:08
42500 -- (-553.142) (-549.824) [-553.335] (-551.398) * (-550.626) (-552.905) (-555.765) [-552.655] -- 0:01:07
43000 -- (-552.699) [-550.149] (-554.647) (-554.039) * [-551.080] (-550.386) (-550.600) (-553.133) -- 0:01:06
43500 -- (-553.483) (-552.620) [-551.069] (-551.062) * (-550.203) (-551.496) [-551.475] (-554.288) -- 0:01:05
44000 -- [-553.091] (-553.750) (-552.785) (-550.272) * (-552.274) [-551.259] (-552.321) (-551.317) -- 0:01:05
44500 -- (-552.130) (-554.842) [-555.324] (-549.907) * (-550.386) [-550.900] (-553.362) (-550.335) -- 0:01:04
45000 -- [-550.263] (-552.308) (-552.752) (-550.617) * (-550.451) (-551.986) (-550.314) [-550.232] -- 0:01:03
Average standard deviation of split frequencies: 0.033539
45500 -- (-550.740) (-553.952) (-551.106) [-551.566] * (-549.898) (-551.021) (-557.505) [-550.672] -- 0:01:02
46000 -- (-552.003) (-551.267) (-550.012) [-551.289] * (-551.571) [-551.516] (-554.412) (-554.309) -- 0:01:02
46500 -- (-552.322) [-552.228] (-552.465) (-551.225) * (-551.403) [-550.750] (-550.626) (-549.370) -- 0:01:01
47000 -- (-551.132) [-550.795] (-554.302) (-552.743) * (-551.680) (-551.087) [-550.406] (-551.243) -- 0:01:00
47500 -- (-553.075) (-557.271) (-551.458) [-551.154] * [-550.067] (-550.058) (-554.512) (-555.360) -- 0:01:00
48000 -- (-550.008) [-553.118] (-549.885) (-557.601) * (-551.723) [-550.978] (-551.371) (-552.037) -- 0:00:59
48500 -- (-551.779) [-551.676] (-550.549) (-553.895) * [-552.445] (-553.055) (-549.594) (-550.425) -- 0:00:58
49000 -- (-552.538) (-554.739) [-550.123] (-550.563) * (-558.658) [-550.175] (-551.277) (-550.191) -- 0:00:58
49500 -- (-550.737) (-549.534) [-550.794] (-551.044) * (-550.677) (-551.190) (-554.903) [-552.930] -- 0:00:57
50000 -- (-550.143) [-550.095] (-549.660) (-553.136) * (-550.107) (-550.105) [-551.815] (-556.303) -- 0:00:57
Average standard deviation of split frequencies: 0.036773
50500 -- (-551.265) [-555.345] (-551.610) (-552.613) * [-549.830] (-550.930) (-557.279) (-554.404) -- 0:00:56
51000 -- (-549.477) (-554.007) (-553.710) [-552.679] * (-553.409) [-549.892] (-557.383) (-550.880) -- 0:00:55
51500 -- (-551.147) (-552.666) [-553.470] (-552.068) * [-551.472] (-550.352) (-555.920) (-553.007) -- 0:00:55
52000 -- (-552.705) (-550.188) [-551.597] (-553.781) * (-551.745) (-550.243) [-554.509] (-551.116) -- 0:00:54
52500 -- [-553.258] (-550.579) (-551.398) (-555.181) * (-551.884) [-550.030] (-553.889) (-550.234) -- 0:01:12
53000 -- (-553.736) (-552.455) [-549.849] (-555.348) * (-550.320) (-550.276) (-551.633) [-549.830] -- 0:01:11
53500 -- (-553.376) (-553.278) (-549.143) [-551.402] * [-554.748] (-553.326) (-554.077) (-553.780) -- 0:01:10
54000 -- (-555.021) (-550.299) (-551.073) [-549.943] * (-554.756) (-553.971) [-549.505] (-553.297) -- 0:01:10
54500 -- [-549.517] (-549.218) (-549.873) (-550.626) * (-551.910) (-552.342) [-551.550] (-550.062) -- 0:01:09
55000 -- (-553.626) (-552.995) [-551.367] (-550.618) * (-551.008) [-550.025] (-549.779) (-549.969) -- 0:01:08
Average standard deviation of split frequencies: 0.033306
55500 -- (-551.672) [-551.996] (-552.577) (-549.799) * (-551.188) (-550.281) [-550.820] (-553.378) -- 0:01:08
56000 -- (-551.740) (-550.835) [-550.212] (-552.267) * (-550.251) (-552.162) (-551.165) [-550.083] -- 0:01:07
56500 -- (-552.817) (-551.375) [-549.598] (-552.253) * (-550.260) (-552.759) (-550.518) [-552.669] -- 0:01:06
57000 -- (-550.445) (-551.321) [-554.675] (-551.062) * [-549.852] (-553.314) (-550.123) (-550.917) -- 0:01:06
57500 -- (-550.082) (-549.847) (-555.745) [-550.907] * [-549.866] (-552.538) (-549.804) (-552.564) -- 0:01:05
58000 -- (-552.966) (-553.965) (-550.348) [-550.641] * (-550.937) (-549.954) [-549.630] (-551.978) -- 0:01:04
58500 -- (-550.851) (-551.627) (-553.439) [-550.138] * (-551.050) (-551.579) [-549.663] (-553.630) -- 0:01:04
59000 -- (-552.018) [-551.640] (-550.831) (-552.513) * [-552.481] (-551.998) (-554.606) (-552.177) -- 0:01:03
59500 -- [-551.669] (-549.661) (-551.413) (-554.015) * (-553.353) [-550.465] (-551.288) (-555.994) -- 0:01:03
60000 -- [-551.920] (-549.903) (-551.400) (-549.959) * (-550.714) [-549.998] (-552.196) (-553.566) -- 0:01:02
Average standard deviation of split frequencies: 0.038075
60500 -- (-551.326) (-552.060) [-551.519] (-552.776) * (-550.986) [-552.357] (-552.717) (-549.573) -- 0:01:02
61000 -- (-553.294) (-551.616) [-555.816] (-552.130) * (-551.463) (-551.628) (-558.168) [-550.653] -- 0:01:01
61500 -- (-552.068) (-551.993) (-559.536) [-550.361] * (-553.212) [-551.177] (-552.829) (-550.259) -- 0:01:01
62000 -- [-557.796] (-550.245) (-550.590) (-550.121) * (-549.250) (-552.504) [-553.486] (-549.823) -- 0:01:00
62500 -- (-549.799) (-552.453) [-550.616] (-553.571) * (-550.555) (-552.319) [-551.669] (-551.330) -- 0:01:00
63000 -- [-549.448] (-554.641) (-549.695) (-554.803) * (-549.999) (-551.409) [-554.578] (-552.285) -- 0:00:59
63500 -- (-551.091) (-553.741) (-551.090) [-555.787] * [-551.493] (-556.493) (-551.938) (-550.636) -- 0:00:58
64000 -- [-549.989] (-554.179) (-551.087) (-552.752) * (-551.440) (-550.815) (-553.666) [-550.720] -- 0:00:58
64500 -- (-551.133) [-553.002] (-551.432) (-552.379) * (-552.449) (-558.175) (-552.746) [-552.201] -- 0:00:58
65000 -- [-549.472] (-553.188) (-552.583) (-551.767) * (-553.545) [-558.293] (-552.279) (-552.440) -- 0:00:57
Average standard deviation of split frequencies: 0.031986
65500 -- (-552.542) [-552.081] (-550.620) (-552.540) * (-556.063) (-554.939) [-550.673] (-551.967) -- 0:00:57
66000 -- [-555.133] (-552.612) (-550.759) (-553.154) * (-553.758) (-550.389) (-554.538) [-552.406] -- 0:00:56
66500 -- (-553.546) (-550.738) (-550.080) [-551.048] * (-550.148) (-553.158) (-551.853) [-551.013] -- 0:00:56
67000 -- (-550.280) [-550.723] (-552.291) (-553.271) * (-550.154) (-552.251) (-550.848) [-550.711] -- 0:00:55
67500 -- [-549.744] (-552.100) (-554.807) (-550.644) * [-551.592] (-552.310) (-552.030) (-551.479) -- 0:00:55
68000 -- [-550.043] (-551.668) (-549.785) (-550.065) * (-553.852) (-555.182) [-550.908] (-550.055) -- 0:00:54
68500 -- [-551.514] (-552.447) (-549.779) (-550.015) * (-553.376) (-552.448) (-550.563) [-551.080] -- 0:00:54
69000 -- (-556.394) (-550.839) [-550.766] (-550.099) * (-555.667) (-551.682) [-549.557] (-551.673) -- 0:00:53
69500 -- (-552.120) (-551.470) (-550.441) [-551.386] * [-550.809] (-553.323) (-550.068) (-552.371) -- 0:01:06
70000 -- [-551.379] (-551.011) (-549.647) (-551.610) * (-551.959) [-551.853] (-552.736) (-555.350) -- 0:01:06
Average standard deviation of split frequencies: 0.025470
70500 -- [-549.258] (-553.468) (-552.783) (-549.991) * (-550.879) (-550.979) (-551.547) [-553.717] -- 0:01:05
71000 -- [-549.254] (-549.683) (-551.082) (-550.464) * [-550.672] (-552.322) (-553.571) (-550.540) -- 0:01:05
71500 -- (-549.758) [-550.523] (-551.110) (-550.701) * (-550.768) (-550.383) (-555.790) [-550.086] -- 0:01:04
72000 -- (-549.836) [-550.004] (-550.828) (-552.673) * (-550.981) [-550.464] (-554.087) (-553.392) -- 0:01:04
72500 -- (-552.043) (-549.331) [-549.790] (-555.808) * [-549.182] (-551.305) (-551.835) (-553.168) -- 0:01:03
73000 -- (-553.397) (-551.792) (-549.771) [-551.943] * (-549.971) (-549.987) [-551.159] (-551.604) -- 0:01:03
73500 -- (-551.762) (-552.009) (-551.890) [-551.186] * [-551.509] (-551.991) (-552.039) (-550.780) -- 0:01:03
74000 -- [-553.537] (-552.467) (-557.143) (-552.811) * [-553.342] (-550.111) (-550.572) (-549.468) -- 0:01:02
74500 -- (-554.363) (-553.700) [-550.977] (-550.730) * [-554.125] (-552.285) (-552.755) (-550.030) -- 0:01:02
75000 -- (-553.998) (-550.478) [-551.243] (-550.443) * (-552.681) [-550.516] (-551.624) (-550.715) -- 0:01:01
Average standard deviation of split frequencies: 0.028355
75500 -- [-552.257] (-549.755) (-551.854) (-550.541) * (-557.330) (-552.257) (-552.288) [-550.660] -- 0:01:01
76000 -- (-550.547) [-550.948] (-555.126) (-549.251) * (-559.226) (-550.433) (-549.781) [-553.524] -- 0:01:00
76500 -- (-550.930) [-552.843] (-552.228) (-551.316) * (-558.110) (-550.072) (-553.502) [-552.477] -- 0:01:00
77000 -- [-551.463] (-550.227) (-549.857) (-552.627) * (-556.596) [-551.129] (-554.278) (-552.168) -- 0:00:59
77500 -- (-549.234) (-549.829) [-550.771] (-551.739) * (-556.724) [-551.219] (-554.096) (-555.064) -- 0:00:59
78000 -- [-551.806] (-553.868) (-552.085) (-552.145) * (-554.601) [-551.390] (-554.315) (-553.994) -- 0:00:59
78500 -- [-550.251] (-551.942) (-556.106) (-551.521) * (-554.187) (-550.248) (-553.080) [-551.457] -- 0:00:58
79000 -- (-551.155) (-551.382) (-552.828) [-552.774] * (-549.957) (-551.012) [-553.934] (-552.411) -- 0:00:58
79500 -- (-554.551) (-550.183) (-553.690) [-550.833] * [-550.030] (-551.413) (-555.922) (-550.394) -- 0:00:57
80000 -- (-551.156) (-549.553) [-551.799] (-552.306) * (-551.134) (-550.711) (-551.962) [-549.666] -- 0:00:57
Average standard deviation of split frequencies: 0.028604
80500 -- (-550.853) (-551.185) [-552.158] (-550.818) * (-550.160) (-551.500) [-550.620] (-551.053) -- 0:00:57
81000 -- (-551.032) (-551.312) [-550.777] (-552.979) * (-553.143) (-552.436) (-550.937) [-550.671] -- 0:00:56
81500 -- (-550.823) [-550.809] (-553.861) (-557.235) * (-554.423) (-551.269) [-553.061] (-551.052) -- 0:00:56
82000 -- (-550.033) [-551.045] (-553.073) (-550.105) * (-552.495) (-550.115) [-555.157] (-550.151) -- 0:00:55
82500 -- [-549.809] (-550.411) (-550.528) (-550.517) * (-550.344) (-550.053) (-554.965) [-551.885] -- 0:00:55
83000 -- [-551.015] (-555.983) (-550.650) (-550.826) * (-550.500) (-550.501) (-553.511) [-551.554] -- 0:00:55
83500 -- [-549.793] (-553.303) (-550.693) (-550.545) * [-550.542] (-552.990) (-552.765) (-551.000) -- 0:00:54
84000 -- (-549.736) (-550.435) (-549.631) [-552.663] * (-551.141) [-549.903] (-554.359) (-550.943) -- 0:00:54
84500 -- (-551.646) [-549.432] (-552.332) (-553.669) * [-552.422] (-550.022) (-553.972) (-551.281) -- 0:00:54
85000 -- [-554.680] (-550.909) (-550.297) (-554.306) * (-554.661) (-552.040) (-557.422) [-552.654] -- 0:00:53
Average standard deviation of split frequencies: 0.026885
85500 -- (-551.942) [-549.920] (-549.898) (-553.270) * (-554.333) (-552.456) [-553.406] (-553.557) -- 0:00:53
86000 -- (-551.601) [-554.419] (-549.748) (-550.982) * (-556.934) (-551.581) (-551.674) [-550.267] -- 0:01:03
86500 -- (-553.367) (-550.544) (-549.605) [-550.930] * [-552.520] (-550.687) (-555.877) (-551.510) -- 0:01:03
87000 -- (-551.175) [-553.036] (-549.513) (-550.700) * (-550.587) (-553.336) (-550.938) [-550.899] -- 0:01:02
87500 -- (-552.903) [-553.842] (-549.932) (-551.117) * [-549.389] (-552.735) (-550.534) (-557.500) -- 0:01:02
88000 -- (-549.488) [-551.061] (-552.843) (-551.137) * (-551.488) (-550.082) (-555.896) [-550.462] -- 0:01:02
88500 -- (-551.681) (-550.830) (-550.267) [-550.989] * (-552.218) [-551.685] (-553.716) (-552.553) -- 0:01:01
89000 -- (-550.507) (-550.680) [-550.928] (-554.795) * (-550.477) [-549.757] (-554.335) (-552.179) -- 0:01:01
89500 -- (-551.086) (-552.289) [-553.782] (-550.230) * (-549.948) (-551.639) (-557.315) [-550.061] -- 0:01:01
90000 -- (-550.121) (-552.597) [-553.549] (-551.476) * (-549.991) (-553.771) [-552.560] (-550.769) -- 0:01:00
Average standard deviation of split frequencies: 0.031196
90500 -- (-553.478) (-550.311) (-552.595) [-550.335] * (-549.618) (-554.752) [-549.670] (-552.253) -- 0:01:00
91000 -- (-552.467) (-551.135) [-556.588] (-549.699) * (-552.198) [-553.426] (-552.199) (-553.735) -- 0:00:59
91500 -- (-553.461) (-550.805) [-552.807] (-552.970) * [-553.054] (-555.720) (-551.500) (-551.040) -- 0:00:59
92000 -- (-553.732) [-552.129] (-551.593) (-552.662) * (-551.293) (-550.442) (-550.116) [-551.047] -- 0:00:59
92500 -- (-549.723) (-553.371) (-552.739) [-552.379] * (-549.844) [-551.127] (-552.859) (-553.965) -- 0:00:58
93000 -- (-550.239) (-552.977) [-554.902] (-551.052) * (-550.966) (-552.727) [-554.584] (-555.357) -- 0:00:58
93500 -- (-549.433) [-553.366] (-554.695) (-551.164) * [-550.214] (-551.727) (-550.500) (-555.006) -- 0:00:58
94000 -- (-550.727) (-551.920) (-556.055) [-549.577] * (-549.572) (-552.613) [-550.696] (-551.342) -- 0:00:57
94500 -- [-549.903] (-553.200) (-555.362) (-550.424) * [-552.928] (-549.734) (-550.913) (-550.921) -- 0:00:57
95000 -- (-551.832) [-552.667] (-554.429) (-552.328) * (-551.368) [-550.406] (-555.091) (-550.980) -- 0:00:57
Average standard deviation of split frequencies: 0.028294
95500 -- (-551.274) [-549.579] (-549.491) (-550.762) * [-549.988] (-549.973) (-551.495) (-558.500) -- 0:00:56
96000 -- (-550.975) (-554.671) (-550.988) [-550.942] * (-552.706) (-550.872) [-551.894] (-553.502) -- 0:00:56
96500 -- (-551.345) [-551.323] (-553.460) (-550.858) * [-555.009] (-553.026) (-551.786) (-550.516) -- 0:00:56
97000 -- (-549.625) (-553.492) [-549.440] (-551.865) * (-549.628) [-551.759] (-549.927) (-550.881) -- 0:00:55
97500 -- (-549.864) [-554.716] (-555.588) (-553.366) * (-549.652) (-552.907) [-554.649] (-551.555) -- 0:00:55
98000 -- [-550.463] (-552.801) (-552.005) (-555.652) * [-551.369] (-553.396) (-553.553) (-550.503) -- 0:00:55
98500 -- [-551.409] (-553.678) (-553.291) (-549.186) * [-552.665] (-551.447) (-552.683) (-552.287) -- 0:00:54
99000 -- [-550.028] (-549.890) (-552.625) (-549.648) * (-550.864) (-552.199) [-551.154] (-551.129) -- 0:00:54
99500 -- (-549.551) [-552.531] (-550.994) (-554.082) * (-553.588) (-556.203) [-553.297] (-552.570) -- 0:00:54
100000 -- (-554.546) [-550.773] (-549.418) (-552.448) * (-552.118) (-553.690) (-549.521) [-553.397] -- 0:00:54
Average standard deviation of split frequencies: 0.028975
100500 -- (-550.402) (-549.931) (-551.538) [-550.119] * (-553.286) [-557.126] (-551.843) (-550.730) -- 0:00:53
101000 -- (-549.449) (-563.244) [-549.742] (-549.756) * (-553.531) (-551.005) [-551.055] (-550.744) -- 0:00:53
101500 -- (-549.684) [-554.797] (-552.432) (-552.862) * (-549.462) [-552.897] (-551.511) (-550.609) -- 0:00:53
102000 -- [-550.050] (-553.013) (-551.222) (-554.121) * (-551.026) [-551.536] (-550.458) (-556.216) -- 0:00:52
102500 -- (-551.010) (-554.574) (-552.160) [-557.178] * (-552.807) (-551.178) [-553.402] (-554.523) -- 0:00:52
103000 -- (-554.399) (-553.350) [-553.495] (-554.454) * [-553.297] (-557.372) (-549.423) (-550.891) -- 0:01:00
103500 -- (-551.395) [-553.130] (-549.860) (-554.337) * [-551.406] (-551.490) (-555.051) (-551.501) -- 0:01:00
104000 -- [-549.615] (-554.152) (-550.654) (-552.940) * (-553.617) [-552.851] (-556.652) (-552.660) -- 0:01:00
104500 -- (-549.937) [-549.979] (-558.688) (-551.910) * (-552.081) (-550.459) (-551.133) [-555.107] -- 0:00:59
105000 -- [-552.841] (-555.795) (-551.642) (-551.626) * (-550.506) [-557.458] (-553.211) (-556.765) -- 0:00:59
Average standard deviation of split frequencies: 0.024067
105500 -- (-553.011) (-552.261) [-551.199] (-550.203) * (-551.844) (-551.667) (-549.849) [-551.942] -- 0:00:59
106000 -- (-551.434) [-550.128] (-549.532) (-550.541) * (-550.528) [-549.746] (-550.295) (-552.331) -- 0:00:59
106500 -- (-555.009) [-549.625] (-552.588) (-551.048) * [-550.079] (-554.279) (-554.863) (-551.900) -- 0:00:58
107000 -- [-551.479] (-551.756) (-554.473) (-550.109) * (-549.927) [-553.757] (-553.120) (-553.693) -- 0:00:58
107500 -- [-551.837] (-552.295) (-550.729) (-550.764) * [-551.793] (-554.215) (-553.159) (-554.675) -- 0:00:58
108000 -- (-553.805) (-550.269) (-549.808) [-552.340] * (-553.400) (-550.566) [-552.724] (-552.026) -- 0:00:57
108500 -- [-549.991] (-552.074) (-553.379) (-550.951) * (-550.891) [-553.874] (-552.791) (-551.612) -- 0:00:57
109000 -- (-553.025) (-549.799) [-550.987] (-553.041) * (-551.649) [-552.776] (-555.136) (-550.527) -- 0:00:57
109500 -- (-553.663) (-552.712) (-553.376) [-551.405] * (-552.926) [-550.555] (-550.645) (-553.149) -- 0:00:56
110000 -- (-553.221) (-550.720) (-553.661) [-555.353] * (-555.701) [-549.866] (-549.811) (-553.658) -- 0:00:56
Average standard deviation of split frequencies: 0.021298
110500 -- (-552.120) (-551.141) (-553.186) [-552.384] * (-551.743) [-549.168] (-556.983) (-550.073) -- 0:00:56
111000 -- (-549.922) [-554.485] (-551.388) (-554.409) * [-550.090] (-555.036) (-551.941) (-551.317) -- 0:00:56
111500 -- (-551.800) (-550.521) [-552.186] (-551.107) * (-552.611) (-554.698) (-550.963) [-549.882] -- 0:00:55
112000 -- (-554.229) (-556.157) (-551.539) [-555.359] * (-553.410) [-553.287] (-551.044) (-550.081) -- 0:00:55
112500 -- [-551.194] (-552.447) (-556.353) (-551.098) * (-555.991) (-550.534) (-553.670) [-552.252] -- 0:00:55
113000 -- [-552.119] (-553.129) (-550.264) (-551.244) * (-550.697) (-549.674) (-554.149) [-549.871] -- 0:00:54
113500 -- (-551.895) [-550.628] (-553.305) (-551.720) * (-551.748) (-550.170) [-549.927] (-551.145) -- 0:00:54
114000 -- [-550.229] (-552.950) (-553.996) (-550.772) * (-554.965) (-554.768) [-549.435] (-554.415) -- 0:00:54
114500 -- [-551.420] (-553.524) (-550.499) (-556.502) * [-550.768] (-551.089) (-550.821) (-552.596) -- 0:00:54
115000 -- [-550.792] (-552.494) (-556.660) (-549.952) * (-550.233) [-553.500] (-552.528) (-551.594) -- 0:00:53
Average standard deviation of split frequencies: 0.020996
115500 -- (-554.444) (-555.132) (-557.986) [-550.153] * (-551.625) (-550.390) [-553.344] (-553.747) -- 0:00:53
116000 -- (-551.134) (-553.554) (-552.601) [-549.826] * (-552.866) (-552.302) [-551.035] (-552.817) -- 0:00:53
116500 -- (-553.658) [-554.030] (-553.080) (-549.290) * [-553.956] (-550.601) (-551.068) (-549.382) -- 0:00:53
117000 -- (-552.765) (-552.017) (-551.659) [-549.884] * (-551.508) (-550.075) [-551.098] (-553.714) -- 0:00:52
117500 -- [-551.336] (-551.122) (-550.384) (-549.738) * [-551.454] (-550.471) (-550.902) (-551.452) -- 0:00:52
118000 -- (-551.462) (-550.959) [-550.785] (-550.901) * (-555.941) [-551.156] (-550.756) (-550.210) -- 0:00:52
118500 -- [-549.635] (-551.865) (-550.104) (-552.440) * (-555.708) (-553.382) [-549.483] (-551.055) -- 0:00:52
119000 -- (-549.474) (-552.833) [-554.735] (-553.104) * (-554.533) [-552.313] (-551.726) (-551.097) -- 0:00:51
119500 -- [-552.547] (-551.155) (-552.590) (-549.921) * [-550.026] (-553.194) (-550.829) (-552.517) -- 0:00:51
120000 -- (-549.868) [-550.689] (-549.570) (-551.731) * (-549.676) [-549.772] (-551.983) (-553.173) -- 0:00:58
Average standard deviation of split frequencies: 0.021487
120500 -- (-549.500) (-550.364) [-550.046] (-551.730) * (-550.281) [-550.347] (-552.890) (-552.038) -- 0:00:58
121000 -- (-553.638) [-550.017] (-552.401) (-556.057) * (-551.073) [-553.097] (-556.089) (-552.048) -- 0:00:58
121500 -- (-551.821) [-551.784] (-549.402) (-549.665) * (-550.353) [-553.842] (-552.774) (-551.859) -- 0:00:57
122000 -- (-551.552) (-553.272) (-552.414) [-549.550] * (-553.231) [-555.607] (-554.241) (-553.785) -- 0:00:57
122500 -- [-551.920] (-551.558) (-551.565) (-549.902) * (-550.846) (-551.811) [-549.717] (-549.618) -- 0:00:57
123000 -- [-553.590] (-550.013) (-550.059) (-553.547) * (-551.639) [-555.064] (-551.998) (-550.870) -- 0:00:57
123500 -- (-550.039) (-550.868) (-550.176) [-551.008] * (-550.796) (-550.488) [-550.139] (-552.302) -- 0:00:56
124000 -- [-549.693] (-549.180) (-550.469) (-554.276) * (-552.012) (-550.552) (-550.458) [-555.538] -- 0:00:56
124500 -- (-549.901) [-550.615] (-550.727) (-554.323) * (-553.734) (-551.163) (-550.101) [-552.881] -- 0:00:56
125000 -- (-550.255) (-554.159) [-552.166] (-551.083) * (-552.049) (-551.353) [-551.669] (-550.617) -- 0:00:56
Average standard deviation of split frequencies: 0.020873
125500 -- (-549.714) (-549.740) [-550.131] (-552.075) * (-553.401) (-550.316) (-551.444) [-549.535] -- 0:00:55
126000 -- (-551.673) (-550.838) [-551.601] (-553.228) * (-555.203) (-551.774) [-553.781] (-551.539) -- 0:00:55
126500 -- (-550.519) (-550.417) [-549.788] (-552.977) * (-552.431) [-554.688] (-556.567) (-552.171) -- 0:00:55
127000 -- [-550.673] (-551.114) (-551.344) (-551.863) * [-550.692] (-550.234) (-553.236) (-552.514) -- 0:00:54
127500 -- (-549.997) (-549.239) [-552.752] (-552.239) * (-550.766) (-549.428) (-551.585) [-556.128] -- 0:00:54
128000 -- (-553.793) (-552.389) [-550.276] (-551.620) * (-550.546) [-550.925] (-551.698) (-553.584) -- 0:00:54
128500 -- (-552.757) (-553.488) [-552.468] (-555.196) * (-549.320) [-550.822] (-550.612) (-556.362) -- 0:00:54
129000 -- [-551.844] (-552.040) (-553.294) (-550.544) * (-551.323) (-551.188) (-550.390) [-551.693] -- 0:00:54
129500 -- (-550.772) (-552.392) [-552.522] (-550.993) * (-549.569) [-553.982] (-551.522) (-555.232) -- 0:00:53
130000 -- (-556.396) (-552.859) (-549.929) [-549.455] * (-550.711) (-552.924) (-553.333) [-551.776] -- 0:00:53
Average standard deviation of split frequencies: 0.023132
130500 -- (-556.270) [-551.996] (-550.085) (-550.750) * [-550.554] (-552.406) (-550.270) (-550.087) -- 0:00:53
131000 -- (-558.333) (-550.850) [-549.802] (-551.853) * (-551.955) (-552.819) [-550.538] (-552.416) -- 0:00:53
131500 -- (-553.982) (-551.137) [-551.159] (-556.515) * (-550.284) (-551.407) [-550.384] (-550.702) -- 0:00:52
132000 -- (-549.825) [-550.758] (-549.526) (-555.410) * (-551.438) [-550.586] (-549.824) (-551.294) -- 0:00:52
132500 -- (-550.340) (-555.106) (-550.142) [-551.931] * (-552.721) (-550.156) [-551.645] (-562.856) -- 0:00:52
133000 -- (-550.120) [-549.935] (-552.045) (-549.701) * (-552.355) (-550.179) [-550.383] (-558.453) -- 0:00:52
133500 -- [-552.686] (-555.191) (-553.168) (-550.050) * (-549.910) (-552.002) (-550.311) [-552.095] -- 0:00:51
134000 -- (-550.523) (-551.402) (-552.890) [-549.250] * (-549.502) [-554.808] (-549.487) (-550.485) -- 0:00:51
134500 -- (-552.159) (-550.409) (-550.616) [-551.200] * (-549.705) [-552.467] (-549.173) (-552.966) -- 0:00:51
135000 -- (-553.295) [-550.079] (-550.448) (-550.167) * (-551.536) [-551.121] (-554.379) (-554.785) -- 0:00:51
Average standard deviation of split frequencies: 0.022338
135500 -- (-550.149) [-550.473] (-549.984) (-550.843) * [-550.515] (-555.902) (-550.568) (-552.232) -- 0:00:51
136000 -- (-555.309) [-549.316] (-549.263) (-554.893) * [-555.132] (-557.318) (-552.300) (-552.063) -- 0:00:50
136500 -- (-552.834) (-550.702) [-551.035] (-552.556) * (-551.675) (-552.214) [-554.453] (-552.124) -- 0:00:56
137000 -- (-550.050) (-552.706) [-553.271] (-551.173) * [-551.906] (-553.842) (-551.939) (-551.076) -- 0:00:56
137500 -- [-550.859] (-554.758) (-554.483) (-552.314) * (-550.193) (-553.032) (-559.622) [-550.681] -- 0:00:56
138000 -- (-550.393) (-551.194) (-553.792) [-551.430] * (-549.813) (-549.847) (-550.979) [-554.396] -- 0:00:56
138500 -- (-553.909) [-550.291] (-549.581) (-553.798) * (-551.900) (-552.311) [-551.589] (-551.658) -- 0:00:55
139000 -- (-552.630) [-550.385] (-552.354) (-554.312) * [-552.318] (-551.875) (-553.991) (-551.566) -- 0:00:55
139500 -- (-554.166) (-550.484) [-552.062] (-552.117) * (-552.530) [-553.458] (-549.764) (-554.535) -- 0:00:55
140000 -- [-551.993] (-555.955) (-555.460) (-550.923) * (-553.004) [-549.877] (-556.736) (-555.347) -- 0:00:55
Average standard deviation of split frequencies: 0.019122
140500 -- (-551.817) (-552.871) (-551.405) [-550.296] * (-550.201) (-551.323) [-550.878] (-550.128) -- 0:00:55
141000 -- (-550.510) [-552.801] (-551.206) (-552.493) * (-551.448) (-553.554) [-556.138] (-553.572) -- 0:00:54
141500 -- (-550.406) [-552.456] (-550.830) (-553.201) * (-553.556) (-549.847) [-549.866] (-551.541) -- 0:00:54
142000 -- (-549.595) (-553.529) [-550.949] (-554.017) * (-554.039) (-552.012) (-554.181) [-549.599] -- 0:00:54
142500 -- (-556.091) (-551.657) [-553.142] (-552.539) * (-552.766) [-553.090] (-550.543) (-549.751) -- 0:00:54
143000 -- [-555.397] (-551.820) (-550.916) (-551.465) * (-550.788) (-552.417) [-550.262] (-552.055) -- 0:00:53
143500 -- [-550.449] (-552.785) (-551.823) (-551.432) * (-550.287) (-549.997) (-551.040) [-550.214] -- 0:00:53
144000 -- (-551.442) [-551.732] (-550.742) (-553.919) * (-550.032) [-551.723] (-550.027) (-550.263) -- 0:00:53
144500 -- [-551.590] (-552.698) (-554.242) (-553.978) * (-558.415) (-552.536) (-552.808) [-549.901] -- 0:00:53
145000 -- (-551.111) (-551.778) [-549.524] (-550.676) * (-556.157) [-552.177] (-552.409) (-553.105) -- 0:00:53
Average standard deviation of split frequencies: 0.018404
145500 -- (-551.138) [-549.477] (-550.867) (-550.540) * [-558.338] (-551.851) (-553.956) (-551.528) -- 0:00:52
146000 -- (-552.738) (-551.608) (-552.503) [-552.269] * (-561.365) [-550.672] (-551.127) (-549.840) -- 0:00:52
146500 -- [-553.703] (-550.557) (-550.160) (-550.391) * (-555.183) (-551.678) (-549.673) [-549.582] -- 0:00:52
147000 -- (-551.816) [-549.363] (-553.319) (-549.621) * (-553.087) (-553.036) (-550.898) [-550.884] -- 0:00:52
147500 -- [-551.693] (-549.878) (-554.108) (-549.628) * (-549.774) [-549.541] (-554.495) (-551.706) -- 0:00:52
148000 -- (-551.184) (-552.269) (-552.923) [-553.371] * (-553.777) (-552.554) (-553.951) [-552.906] -- 0:00:51
148500 -- (-551.385) [-552.054] (-551.562) (-551.909) * (-553.251) (-554.614) (-551.311) [-552.103] -- 0:00:51
149000 -- (-550.861) [-552.748] (-551.052) (-557.233) * (-550.059) (-550.750) [-550.549] (-554.648) -- 0:00:51
149500 -- [-549.770] (-552.478) (-555.387) (-553.660) * [-553.162] (-550.125) (-551.626) (-552.523) -- 0:00:51
150000 -- (-549.516) (-556.482) (-553.926) [-550.689] * (-550.057) (-550.159) [-551.387] (-551.944) -- 0:00:51
Average standard deviation of split frequencies: 0.017556
150500 -- (-551.435) (-553.714) [-552.012] (-551.771) * (-551.804) [-550.793] (-549.968) (-553.898) -- 0:00:50
151000 -- [-551.243] (-553.879) (-551.716) (-552.520) * (-552.328) (-551.169) (-550.305) [-554.049] -- 0:00:50
151500 -- (-553.998) [-550.790] (-550.124) (-549.835) * (-553.052) (-552.091) (-551.255) [-553.828] -- 0:00:50
152000 -- [-550.984] (-550.069) (-550.361) (-551.925) * (-549.627) (-553.598) (-551.461) [-551.984] -- 0:00:50
152500 -- (-554.361) (-551.418) (-553.865) [-549.559] * (-550.512) (-551.820) (-552.819) [-550.226] -- 0:00:50
153000 -- [-549.197] (-549.620) (-551.655) (-551.460) * (-550.312) (-553.914) (-557.234) [-552.580] -- 0:00:49
153500 -- (-551.174) (-549.098) [-550.963] (-550.006) * (-550.114) (-551.311) [-552.225] (-554.134) -- 0:00:55
154000 -- (-552.471) (-550.827) [-553.278] (-554.282) * (-556.515) [-550.413] (-552.245) (-553.297) -- 0:00:54
154500 -- (-551.440) (-551.804) (-552.806) [-553.539] * (-556.363) (-551.078) [-550.415] (-550.842) -- 0:00:54
155000 -- (-552.497) (-550.106) [-551.481] (-552.054) * [-550.971] (-550.051) (-552.195) (-551.724) -- 0:00:54
Average standard deviation of split frequencies: 0.017598
155500 -- [-551.698] (-551.180) (-552.037) (-557.162) * (-554.121) (-550.684) (-550.884) [-551.303] -- 0:00:54
156000 -- (-550.481) (-555.337) [-551.134] (-553.096) * [-551.581] (-550.773) (-557.446) (-550.076) -- 0:00:54
156500 -- [-549.620] (-551.516) (-549.694) (-549.634) * (-550.896) (-551.630) [-555.048] (-553.495) -- 0:00:53
157000 -- (-550.169) (-550.496) (-550.590) [-549.754] * (-555.061) (-550.739) (-553.108) [-551.696] -- 0:00:53
157500 -- (-549.622) (-550.319) [-550.141] (-553.380) * [-551.350] (-552.592) (-552.243) (-551.151) -- 0:00:53
158000 -- (-550.700) (-553.975) (-550.109) [-551.092] * [-554.094] (-550.403) (-551.826) (-551.343) -- 0:00:53
158500 -- [-554.684] (-552.824) (-555.738) (-551.023) * (-550.343) (-551.795) (-553.831) [-550.264] -- 0:00:53
159000 -- [-555.354] (-556.477) (-553.227) (-550.910) * (-552.251) (-554.545) (-550.958) [-551.453] -- 0:00:52
159500 -- [-550.869] (-561.847) (-550.220) (-551.700) * (-551.299) (-555.440) (-550.187) [-551.698] -- 0:00:52
160000 -- (-555.105) (-553.075) (-554.291) [-550.398] * (-551.133) [-550.433] (-553.402) (-549.901) -- 0:00:52
Average standard deviation of split frequencies: 0.018154
160500 -- [-553.812] (-550.547) (-551.688) (-550.949) * [-554.215] (-552.624) (-552.665) (-552.082) -- 0:00:52
161000 -- (-552.742) [-552.450] (-550.702) (-551.845) * (-551.124) [-550.388] (-552.707) (-553.229) -- 0:00:52
161500 -- (-550.386) (-551.622) (-551.187) [-549.694] * (-552.512) [-549.653] (-554.062) (-551.540) -- 0:00:51
162000 -- (-550.897) (-554.780) (-551.272) [-551.800] * (-550.947) (-549.250) [-554.496] (-554.029) -- 0:00:51
162500 -- [-553.388] (-553.109) (-550.347) (-550.224) * (-553.250) (-550.245) [-551.034] (-551.825) -- 0:00:51
163000 -- (-551.102) (-552.383) [-550.177] (-549.146) * (-552.451) (-549.902) [-549.934] (-552.235) -- 0:00:51
163500 -- (-554.510) (-550.517) [-551.553] (-555.430) * [-553.843] (-549.679) (-549.539) (-550.406) -- 0:00:51
164000 -- (-557.841) (-551.340) (-552.282) [-549.570] * (-551.102) [-549.966] (-551.391) (-554.043) -- 0:00:50
164500 -- (-552.888) (-550.461) (-554.628) [-551.406] * (-551.769) (-551.818) [-550.918] (-550.462) -- 0:00:50
165000 -- (-549.730) [-550.418] (-555.480) (-550.874) * (-551.443) [-553.477] (-553.473) (-551.159) -- 0:00:50
Average standard deviation of split frequencies: 0.015395
165500 -- [-553.321] (-555.565) (-550.878) (-551.028) * [-550.118] (-553.723) (-551.456) (-550.004) -- 0:00:50
166000 -- (-553.003) (-551.154) (-550.434) [-552.353] * (-552.188) (-551.442) (-552.750) [-550.056] -- 0:00:50
166500 -- (-551.528) [-550.477] (-550.988) (-552.886) * (-550.589) (-552.321) [-552.286] (-550.251) -- 0:00:50
167000 -- (-551.187) (-550.749) (-550.800) [-550.863] * (-550.924) [-551.571] (-551.305) (-550.810) -- 0:00:49
167500 -- (-551.889) (-549.989) [-555.592] (-552.170) * (-551.693) (-549.976) [-549.618] (-550.953) -- 0:00:49
168000 -- (-550.787) (-550.722) [-551.194] (-552.478) * (-552.474) [-552.349] (-552.129) (-550.315) -- 0:00:49
168500 -- [-549.327] (-549.935) (-550.107) (-551.567) * (-553.042) [-550.548] (-550.023) (-550.761) -- 0:00:49
169000 -- (-550.468) [-552.241] (-549.780) (-552.073) * (-552.461) (-552.444) [-551.735] (-551.662) -- 0:00:49
169500 -- (-550.027) (-551.749) [-549.845] (-550.100) * [-552.586] (-551.184) (-551.010) (-551.671) -- 0:00:48
170000 -- (-553.027) (-553.053) (-551.916) [-551.326] * [-550.834] (-555.047) (-550.895) (-553.492) -- 0:00:53
Average standard deviation of split frequencies: 0.018317
170500 -- [-554.728] (-552.496) (-552.213) (-551.220) * [-551.852] (-552.810) (-550.690) (-549.651) -- 0:00:53
171000 -- (-552.822) (-555.072) (-551.659) [-554.791] * (-552.040) (-553.758) (-549.651) [-551.986] -- 0:00:53
171500 -- (-553.983) (-555.102) (-550.193) [-551.450] * [-550.790] (-554.829) (-551.208) (-550.816) -- 0:00:53
172000 -- (-553.127) (-551.368) [-553.980] (-550.492) * (-550.300) (-552.225) [-550.132] (-554.518) -- 0:00:52
172500 -- (-552.045) (-552.787) (-553.908) [-554.156] * (-554.039) (-556.934) [-552.502] (-552.677) -- 0:00:52
173000 -- (-549.668) [-554.449] (-551.360) (-553.896) * (-551.722) [-554.124] (-549.973) (-551.806) -- 0:00:52
173500 -- (-549.830) (-553.487) [-549.551] (-550.064) * (-549.153) [-553.413] (-552.501) (-549.792) -- 0:00:52
174000 -- (-553.512) (-552.031) (-551.704) [-550.366] * (-550.335) (-552.059) [-550.392] (-551.479) -- 0:00:52
174500 -- (-551.461) (-555.923) (-550.592) [-550.202] * [-552.032] (-551.734) (-551.581) (-550.922) -- 0:00:52
175000 -- (-550.215) [-550.935] (-552.214) (-551.673) * (-550.997) (-552.172) [-559.103] (-551.783) -- 0:00:51
Average standard deviation of split frequencies: 0.019694
175500 -- [-550.815] (-550.304) (-551.216) (-550.939) * (-553.639) (-552.222) (-551.776) [-552.980] -- 0:00:51
176000 -- (-551.459) (-555.577) [-550.649] (-551.984) * (-551.712) (-550.339) [-550.238] (-550.875) -- 0:00:51
176500 -- (-550.254) (-554.076) (-552.037) [-553.322] * (-552.284) [-549.574] (-552.636) (-554.801) -- 0:00:51
177000 -- (-551.202) [-550.901] (-550.444) (-554.389) * (-554.538) (-549.328) [-550.409] (-552.749) -- 0:00:51
177500 -- (-551.528) (-553.379) [-549.913] (-550.628) * [-551.762] (-549.511) (-551.340) (-552.568) -- 0:00:50
178000 -- (-555.075) [-552.028] (-552.955) (-553.347) * (-552.632) (-551.323) (-550.928) [-552.701] -- 0:00:50
178500 -- (-553.810) (-551.109) [-554.324] (-554.266) * (-550.886) (-551.575) [-552.672] (-552.452) -- 0:00:50
179000 -- (-552.149) (-552.626) [-549.551] (-550.837) * (-551.812) (-554.810) (-550.753) [-551.384] -- 0:00:50
179500 -- (-550.150) (-550.475) [-551.046] (-551.497) * (-550.447) (-553.359) (-550.211) [-551.329] -- 0:00:50
180000 -- (-550.732) (-551.433) (-549.655) [-555.582] * [-550.727] (-553.909) (-550.652) (-551.948) -- 0:00:50
Average standard deviation of split frequencies: 0.019135
180500 -- (-551.346) (-556.932) [-556.540] (-552.222) * (-550.710) (-553.743) [-552.494] (-552.027) -- 0:00:49
181000 -- (-552.995) (-552.364) (-553.794) [-552.164] * (-550.708) (-553.333) (-554.144) [-554.134] -- 0:00:49
181500 -- [-552.143] (-551.776) (-561.406) (-552.463) * (-553.572) [-550.894] (-553.744) (-550.910) -- 0:00:49
182000 -- (-554.211) [-551.282] (-552.200) (-551.940) * (-553.681) (-551.427) [-553.079] (-551.317) -- 0:00:49
182500 -- (-550.161) (-551.614) [-553.332] (-550.398) * (-551.399) (-550.976) [-550.985] (-551.305) -- 0:00:49
183000 -- (-550.679) (-551.473) [-553.251] (-552.127) * (-550.721) (-551.784) (-550.258) [-550.042] -- 0:00:49
183500 -- (-552.654) (-550.621) (-557.967) [-554.633] * (-549.211) (-552.056) [-553.949] (-552.348) -- 0:00:48
184000 -- (-552.571) [-550.365] (-554.691) (-560.710) * [-551.376] (-550.598) (-552.303) (-555.203) -- 0:00:48
184500 -- [-550.776] (-551.041) (-550.572) (-552.000) * (-552.898) (-550.743) [-553.548] (-550.533) -- 0:00:48
185000 -- (-550.927) (-552.776) (-553.765) [-549.982] * (-550.777) [-551.759] (-555.126) (-551.923) -- 0:00:48
Average standard deviation of split frequencies: 0.017868
185500 -- (-550.374) (-556.146) [-552.614] (-553.014) * (-556.189) (-551.382) (-549.898) [-550.185] -- 0:00:48
186000 -- [-550.933] (-554.483) (-551.722) (-552.813) * (-555.282) (-554.908) [-549.932] (-551.030) -- 0:00:48
186500 -- (-551.116) (-552.368) [-550.500] (-553.514) * (-555.023) (-552.737) (-553.190) [-550.750] -- 0:00:47
187000 -- [-554.036] (-552.129) (-551.524) (-551.351) * (-553.271) (-550.440) [-550.898] (-550.224) -- 0:00:52
187500 -- (-553.946) (-550.519) [-553.598] (-551.082) * (-552.261) (-551.948) [-549.890] (-551.247) -- 0:00:52
188000 -- (-553.512) [-549.421] (-550.663) (-558.217) * (-551.196) (-550.897) (-549.304) [-549.846] -- 0:00:51
188500 -- [-552.077] (-549.610) (-554.235) (-550.659) * [-550.256] (-556.230) (-551.486) (-552.016) -- 0:00:51
189000 -- (-553.916) (-552.861) (-558.985) [-551.458] * [-550.383] (-550.549) (-554.212) (-550.833) -- 0:00:51
189500 -- (-551.714) [-553.581] (-553.064) (-552.044) * (-553.585) (-551.522) (-553.423) [-551.980] -- 0:00:51
190000 -- (-554.800) (-552.301) (-552.894) [-553.404] * (-557.371) [-549.263] (-552.285) (-551.645) -- 0:00:51
Average standard deviation of split frequencies: 0.019129
190500 -- [-552.599] (-558.674) (-554.150) (-551.696) * [-552.885] (-549.653) (-549.247) (-550.098) -- 0:00:50
191000 -- (-549.740) [-550.146] (-552.832) (-549.866) * (-551.520) (-549.626) [-549.737] (-554.615) -- 0:00:50
191500 -- (-553.295) (-553.167) [-554.724] (-550.604) * (-552.262) (-549.810) [-550.388] (-554.378) -- 0:00:50
192000 -- (-553.207) [-552.058] (-552.139) (-550.728) * (-552.199) [-550.602] (-552.101) (-557.382) -- 0:00:50
192500 -- (-553.140) (-555.602) (-553.805) [-551.395] * (-549.922) [-553.105] (-549.384) (-558.626) -- 0:00:50
193000 -- (-551.278) (-550.995) [-554.719] (-551.524) * (-552.392) (-551.034) [-550.809] (-552.353) -- 0:00:50
193500 -- (-552.510) [-550.329] (-550.983) (-552.965) * (-551.369) [-554.361] (-553.424) (-551.699) -- 0:00:50
194000 -- (-551.009) (-556.998) [-551.579] (-552.266) * (-556.698) (-556.033) (-549.958) [-549.525] -- 0:00:49
194500 -- (-549.520) [-551.853] (-553.630) (-552.041) * (-551.921) (-550.838) (-550.916) [-550.964] -- 0:00:49
195000 -- (-549.734) [-553.045] (-556.801) (-554.551) * (-550.474) (-555.215) [-549.594] (-551.409) -- 0:00:49
Average standard deviation of split frequencies: 0.020254
195500 -- (-553.459) (-551.385) (-554.027) [-555.012] * (-550.205) (-551.500) [-550.970] (-551.177) -- 0:00:49
196000 -- [-556.084] (-552.820) (-551.414) (-552.459) * (-550.269) [-550.499] (-552.812) (-549.850) -- 0:00:49
196500 -- (-551.558) (-549.278) [-552.274] (-550.136) * [-550.142] (-550.679) (-550.572) (-550.278) -- 0:00:49
197000 -- (-552.425) [-550.648] (-549.966) (-551.902) * [-550.727] (-550.866) (-549.729) (-549.959) -- 0:00:48
197500 -- (-551.125) (-550.858) [-551.041] (-551.299) * [-552.052] (-549.970) (-549.593) (-552.192) -- 0:00:48
198000 -- (-550.148) (-549.693) (-550.790) [-552.228] * (-550.273) [-549.523] (-552.153) (-549.430) -- 0:00:48
198500 -- [-549.783] (-549.676) (-553.675) (-550.862) * (-550.916) (-556.055) (-554.443) [-551.029] -- 0:00:48
199000 -- (-551.933) (-551.699) [-551.987] (-552.443) * [-550.635] (-550.022) (-551.012) (-550.136) -- 0:00:48
199500 -- (-550.415) (-552.948) [-549.361] (-549.859) * (-554.769) [-550.565] (-550.289) (-549.109) -- 0:00:48
200000 -- (-552.607) (-549.740) [-557.456] (-550.771) * (-552.624) (-552.724) (-550.249) [-553.158] -- 0:00:48
Average standard deviation of split frequencies: 0.020728
200500 -- (-550.254) [-551.061] (-551.375) (-554.087) * (-551.476) [-554.653] (-549.566) (-555.273) -- 0:00:47
201000 -- (-553.183) (-549.455) [-549.479] (-550.556) * (-552.970) [-553.077] (-551.819) (-555.584) -- 0:00:47
201500 -- (-549.567) (-551.098) (-553.318) [-551.425] * (-554.521) (-551.305) [-551.221] (-550.272) -- 0:00:47
202000 -- (-552.918) (-551.075) (-550.786) [-552.384] * (-549.954) [-552.346] (-552.683) (-549.334) -- 0:00:47
202500 -- (-552.341) (-549.589) (-551.013) [-550.779] * (-555.421) (-555.878) (-553.071) [-551.681] -- 0:00:47
203000 -- (-550.709) [-549.850] (-551.169) (-551.066) * (-551.919) (-555.667) [-549.174] (-553.318) -- 0:00:47
203500 -- (-551.725) (-550.386) (-552.194) [-549.737] * (-550.007) (-553.748) [-550.108] (-552.589) -- 0:00:46
204000 -- (-549.301) (-549.884) [-550.247] (-550.238) * (-551.269) (-562.032) [-553.960] (-552.790) -- 0:00:50
204500 -- (-551.673) (-551.092) (-551.132) [-551.481] * (-549.427) (-552.041) (-550.191) [-549.462] -- 0:00:50
205000 -- [-549.484] (-552.414) (-550.504) (-550.668) * [-553.495] (-549.490) (-553.862) (-550.132) -- 0:00:50
Average standard deviation of split frequencies: 0.019451
205500 -- (-549.986) [-557.929] (-551.340) (-552.398) * [-551.628] (-550.752) (-551.337) (-554.388) -- 0:00:50
206000 -- [-549.732] (-556.264) (-554.038) (-553.778) * (-550.637) (-551.496) (-551.337) [-552.937] -- 0:00:50
206500 -- [-551.348] (-550.092) (-550.997) (-550.050) * (-551.646) (-551.287) [-550.143] (-551.098) -- 0:00:49
207000 -- [-551.997] (-553.751) (-551.752) (-552.621) * (-557.601) [-549.861] (-549.456) (-552.346) -- 0:00:49
207500 -- (-550.692) (-551.165) (-550.192) [-550.720] * [-552.910] (-550.728) (-554.621) (-551.649) -- 0:00:49
208000 -- (-551.012) [-551.060] (-551.659) (-552.679) * (-555.885) (-552.478) [-550.549] (-555.480) -- 0:00:49
208500 -- (-552.718) [-553.536] (-549.656) (-551.459) * (-554.672) (-553.713) [-551.604] (-551.361) -- 0:00:49
209000 -- (-553.079) (-552.440) [-549.508] (-551.585) * (-550.094) (-552.125) [-549.589] (-550.960) -- 0:00:49
209500 -- (-551.031) (-551.827) [-553.661] (-550.154) * [-552.338] (-550.763) (-551.227) (-551.684) -- 0:00:49
210000 -- (-550.620) [-550.387] (-555.105) (-550.056) * (-552.151) (-550.303) (-550.403) [-550.930] -- 0:00:48
Average standard deviation of split frequencies: 0.018274
210500 -- (-553.396) (-552.627) [-549.510] (-550.684) * (-552.637) (-550.432) (-552.468) [-552.785] -- 0:00:48
211000 -- (-553.960) (-549.996) (-550.846) [-549.668] * [-552.701] (-549.489) (-550.805) (-549.766) -- 0:00:48
211500 -- (-551.738) (-549.902) (-552.125) [-551.127] * [-552.197] (-553.755) (-550.875) (-550.072) -- 0:00:48
212000 -- (-552.370) [-553.445] (-551.237) (-549.959) * (-549.627) [-550.560] (-551.778) (-550.950) -- 0:00:48
212500 -- [-551.430] (-549.977) (-551.209) (-549.367) * (-550.474) (-550.217) (-550.919) [-553.492] -- 0:00:48
213000 -- [-551.640] (-551.698) (-553.031) (-550.609) * (-551.216) [-551.423] (-555.664) (-550.178) -- 0:00:48
213500 -- (-552.931) (-552.665) [-551.328] (-551.008) * (-551.171) [-551.412] (-552.709) (-550.569) -- 0:00:47
214000 -- (-550.526) (-553.145) [-550.353] (-550.833) * (-550.732) [-552.144] (-552.981) (-554.546) -- 0:00:47
214500 -- (-550.899) [-549.888] (-555.122) (-550.197) * (-550.642) (-550.888) (-553.275) [-552.922] -- 0:00:47
215000 -- (-551.461) (-552.639) (-550.478) [-550.883] * (-552.379) [-552.510] (-552.946) (-557.406) -- 0:00:47
Average standard deviation of split frequencies: 0.019770
215500 -- (-552.882) (-553.032) [-551.016] (-554.351) * (-549.630) (-550.649) (-550.302) [-550.395] -- 0:00:47
216000 -- (-551.672) (-552.498) [-550.208] (-555.967) * (-551.012) (-554.979) (-551.173) [-551.573] -- 0:00:47
216500 -- (-554.103) [-550.791] (-553.485) (-558.978) * (-550.775) [-550.874] (-550.562) (-553.010) -- 0:00:47
217000 -- [-551.267] (-553.589) (-552.452) (-550.449) * (-550.497) (-550.351) [-550.267] (-550.143) -- 0:00:46
217500 -- (-550.665) (-551.596) (-553.941) [-554.121] * (-551.427) (-551.587) (-554.201) [-551.288] -- 0:00:46
218000 -- (-550.603) (-551.525) (-552.307) [-551.926] * (-551.386) [-552.279] (-551.610) (-552.165) -- 0:00:46
218500 -- [-552.485] (-554.498) (-553.930) (-552.081) * (-550.142) (-550.612) (-551.337) [-551.388] -- 0:00:46
219000 -- (-551.436) (-551.172) [-550.414] (-551.335) * (-553.555) [-550.744] (-551.568) (-550.351) -- 0:00:46
219500 -- (-551.294) (-551.535) (-550.706) [-550.620] * (-552.605) (-554.399) [-551.756] (-550.878) -- 0:00:46
220000 -- (-549.214) [-552.474] (-550.277) (-550.989) * [-550.518] (-551.448) (-556.522) (-552.927) -- 0:00:46
Average standard deviation of split frequencies: 0.019729
220500 -- (-550.234) (-553.750) [-551.373] (-550.991) * (-551.008) (-550.547) [-551.165] (-550.478) -- 0:00:45
221000 -- (-554.768) (-554.373) (-554.292) [-549.940] * [-551.520] (-550.706) (-550.909) (-551.011) -- 0:00:49
221500 -- (-553.089) (-550.372) (-551.112) [-549.619] * (-555.769) (-551.320) [-551.145] (-551.052) -- 0:00:49
222000 -- (-552.611) (-549.403) [-551.616] (-551.074) * (-550.128) (-552.294) (-550.672) [-551.415] -- 0:00:49
222500 -- [-551.894] (-552.188) (-553.497) (-552.226) * (-550.402) (-553.039) (-549.900) [-550.665] -- 0:00:48
223000 -- (-551.077) (-554.557) [-551.814] (-554.139) * (-550.680) (-550.681) [-552.688] (-553.992) -- 0:00:48
223500 -- (-551.535) (-553.017) (-551.380) [-551.272] * [-551.098] (-550.331) (-551.069) (-555.215) -- 0:00:48
224000 -- (-553.219) [-550.929] (-551.153) (-550.079) * (-553.058) [-550.068] (-551.932) (-550.146) -- 0:00:48
224500 -- [-550.845] (-551.787) (-550.120) (-551.341) * (-552.188) (-550.193) (-557.627) [-549.334] -- 0:00:48
225000 -- (-553.751) (-552.921) [-553.054] (-549.752) * [-549.259] (-550.838) (-550.049) (-549.849) -- 0:00:48
Average standard deviation of split frequencies: 0.019264
225500 -- (-552.257) (-553.178) (-554.484) [-549.914] * (-553.089) (-550.290) [-552.720] (-549.918) -- 0:00:48
226000 -- (-556.213) (-554.906) [-553.496] (-552.021) * (-557.320) (-550.205) (-549.383) [-550.693] -- 0:00:47
226500 -- (-553.845) (-551.207) (-556.533) [-553.043] * [-552.677] (-551.539) (-550.499) (-551.556) -- 0:00:47
227000 -- (-549.837) (-550.687) [-551.356] (-552.367) * (-552.169) (-553.109) (-552.340) [-550.898] -- 0:00:47
227500 -- [-555.529] (-551.402) (-550.667) (-558.282) * (-549.834) (-553.435) [-549.218] (-549.783) -- 0:00:47
228000 -- (-552.848) (-553.079) (-552.063) [-553.825] * (-550.079) (-553.555) (-549.557) [-549.759] -- 0:00:47
228500 -- (-550.512) (-551.460) [-552.858] (-551.871) * [-550.310] (-549.764) (-549.411) (-551.756) -- 0:00:47
229000 -- [-550.510] (-551.067) (-555.540) (-551.758) * (-551.447) [-551.199] (-551.789) (-551.132) -- 0:00:47
229500 -- [-549.816] (-552.121) (-549.290) (-550.344) * (-550.723) (-551.409) (-552.825) [-550.330] -- 0:00:47
230000 -- (-554.340) (-558.060) (-550.307) [-549.783] * (-552.317) (-553.016) [-552.439] (-550.560) -- 0:00:46
Average standard deviation of split frequencies: 0.017551
230500 -- [-551.818] (-551.190) (-549.245) (-550.731) * (-553.187) [-551.432] (-553.487) (-552.041) -- 0:00:46
231000 -- [-550.776] (-551.145) (-551.101) (-555.079) * (-552.270) [-552.272] (-550.920) (-550.611) -- 0:00:46
231500 -- (-553.222) (-552.805) (-550.616) [-551.542] * [-551.770] (-552.558) (-550.182) (-550.274) -- 0:00:46
232000 -- (-552.445) [-551.031] (-550.641) (-552.954) * (-550.907) (-552.279) [-549.631] (-549.765) -- 0:00:46
232500 -- (-555.024) (-550.917) [-551.333] (-550.051) * (-551.722) [-551.586] (-551.105) (-553.165) -- 0:00:46
233000 -- [-549.252] (-549.915) (-555.187) (-549.622) * (-550.646) (-554.055) (-551.283) [-551.929] -- 0:00:46
233500 -- [-550.273] (-550.312) (-555.219) (-550.770) * [-550.714] (-551.157) (-552.061) (-549.696) -- 0:00:45
234000 -- (-550.994) [-554.264] (-553.571) (-551.246) * (-550.423) (-557.410) (-551.494) [-550.138] -- 0:00:45
234500 -- (-550.129) [-552.486] (-551.681) (-554.516) * (-550.910) (-552.057) (-552.733) [-549.688] -- 0:00:45
235000 -- [-550.498] (-552.423) (-551.300) (-551.516) * (-550.647) [-556.331] (-550.393) (-552.156) -- 0:00:45
Average standard deviation of split frequencies: 0.016479
235500 -- [-552.194] (-553.242) (-549.735) (-550.830) * (-556.071) (-552.385) [-550.559] (-552.598) -- 0:00:45
236000 -- (-551.826) (-550.346) [-552.386] (-549.189) * (-551.154) [-551.091] (-551.699) (-554.949) -- 0:00:45
236500 -- (-550.365) (-550.138) [-551.624] (-549.710) * (-549.807) [-550.299] (-550.805) (-554.303) -- 0:00:45
237000 -- (-555.115) [-551.288] (-553.021) (-552.816) * (-552.145) (-550.927) [-550.470] (-551.852) -- 0:00:45
237500 -- (-553.344) [-553.926] (-550.506) (-550.369) * (-552.317) (-550.369) (-550.919) [-550.643] -- 0:00:48
238000 -- (-550.997) [-554.504] (-551.219) (-553.328) * (-551.463) (-550.592) [-551.326] (-550.910) -- 0:00:48
238500 -- (-550.745) (-550.447) (-550.175) [-552.080] * [-552.625] (-553.078) (-552.022) (-551.045) -- 0:00:47
239000 -- (-554.371) [-552.118] (-552.303) (-552.893) * [-551.613] (-550.372) (-551.526) (-550.350) -- 0:00:47
239500 -- (-551.215) [-551.826] (-552.218) (-555.800) * (-552.631) (-550.069) (-555.677) [-549.714] -- 0:00:47
240000 -- (-552.147) [-551.270] (-551.119) (-550.942) * (-551.538) (-549.445) [-552.699] (-549.499) -- 0:00:47
Average standard deviation of split frequencies: 0.017996
240500 -- [-549.992] (-550.593) (-552.158) (-550.100) * (-550.353) (-550.719) (-554.441) [-551.998] -- 0:00:47
241000 -- (-549.432) (-553.326) (-553.275) [-550.093] * (-553.091) [-550.131] (-557.668) (-552.492) -- 0:00:47
241500 -- (-555.212) [-553.759] (-557.087) (-551.769) * [-549.213] (-550.788) (-555.291) (-553.448) -- 0:00:47
242000 -- [-551.643] (-555.208) (-550.958) (-550.671) * (-549.666) [-550.943] (-553.028) (-550.244) -- 0:00:46
242500 -- [-552.179] (-557.544) (-550.780) (-553.760) * [-549.935] (-550.899) (-551.630) (-550.624) -- 0:00:46
243000 -- (-553.964) (-551.940) (-555.044) [-551.864] * (-550.374) (-550.385) (-550.520) [-550.726] -- 0:00:46
243500 -- (-550.502) (-552.167) (-551.356) [-552.120] * [-549.793] (-551.051) (-550.637) (-551.854) -- 0:00:46
244000 -- (-552.094) (-552.845) (-552.284) [-551.139] * [-550.191] (-549.618) (-550.384) (-551.986) -- 0:00:46
244500 -- [-549.249] (-553.698) (-552.538) (-551.048) * [-555.227] (-549.592) (-550.033) (-550.161) -- 0:00:46
245000 -- (-551.204) (-553.769) [-550.892] (-549.429) * (-558.350) (-553.547) (-553.354) [-552.271] -- 0:00:46
Average standard deviation of split frequencies: 0.016182
245500 -- (-550.435) (-555.698) (-550.958) [-549.698] * (-552.754) [-551.539] (-554.299) (-550.090) -- 0:00:46
246000 -- (-549.695) (-550.652) [-550.553] (-550.941) * (-551.918) [-552.186] (-551.373) (-549.645) -- 0:00:45
246500 -- (-549.394) (-552.278) [-550.865] (-550.655) * (-552.243) [-550.745] (-551.418) (-549.568) -- 0:00:45
247000 -- (-549.343) [-554.060] (-553.894) (-554.530) * (-550.760) [-554.756] (-551.636) (-550.537) -- 0:00:45
247500 -- (-549.542) [-550.923] (-549.807) (-552.861) * [-549.499] (-554.631) (-552.924) (-551.425) -- 0:00:45
248000 -- (-550.722) (-550.886) (-551.217) [-549.243] * (-551.009) [-550.456] (-550.746) (-550.421) -- 0:00:45
248500 -- (-551.443) [-551.027] (-550.037) (-551.897) * (-551.324) [-550.045] (-551.768) (-553.230) -- 0:00:45
249000 -- [-551.955] (-553.865) (-549.718) (-549.976) * (-550.280) [-550.357] (-555.465) (-554.495) -- 0:00:45
249500 -- (-553.407) (-551.940) (-553.389) [-550.319] * (-550.533) (-553.574) (-554.425) [-551.285] -- 0:00:45
250000 -- (-550.773) (-553.700) [-553.639] (-550.008) * (-551.882) (-552.222) (-551.645) [-553.499] -- 0:00:45
Average standard deviation of split frequencies: 0.016403
250500 -- (-553.647) [-553.080] (-552.078) (-552.493) * (-552.511) (-554.933) [-551.012] (-556.933) -- 0:00:44
251000 -- (-549.886) (-549.719) (-549.764) [-551.687] * (-552.651) (-553.404) (-549.984) [-555.992] -- 0:00:44
251500 -- (-550.969) (-549.892) (-552.211) [-553.364] * (-555.407) [-550.663] (-552.152) (-555.108) -- 0:00:44
252000 -- (-551.850) (-550.273) [-550.957] (-550.713) * (-551.156) (-553.310) (-551.050) [-550.746] -- 0:00:44
252500 -- (-554.835) (-549.669) (-555.733) [-553.968] * (-552.308) [-551.253] (-550.814) (-556.323) -- 0:00:44
253000 -- [-551.649] (-551.456) (-553.125) (-556.123) * (-552.376) (-554.222) [-550.244] (-552.702) -- 0:00:44
253500 -- (-556.377) [-550.973] (-553.648) (-549.847) * (-550.462) (-551.220) [-553.445] (-554.613) -- 0:00:44
254000 -- (-552.677) [-553.062] (-553.404) (-550.819) * (-554.986) (-550.838) (-550.236) [-550.866] -- 0:00:44
254500 -- (-556.619) [-550.051] (-549.840) (-555.656) * (-554.171) [-549.949] (-550.412) (-553.210) -- 0:00:46
255000 -- (-554.399) [-550.279] (-550.846) (-554.620) * (-552.977) [-550.270] (-553.756) (-553.007) -- 0:00:46
Average standard deviation of split frequencies: 0.017084
255500 -- (-553.564) [-550.833] (-556.071) (-551.341) * (-553.951) [-552.265] (-552.209) (-552.420) -- 0:00:46
256000 -- [-551.670] (-550.693) (-553.078) (-549.912) * (-554.273) (-552.110) (-551.112) [-553.289] -- 0:00:46
256500 -- (-552.902) (-551.294) (-551.716) [-551.773] * [-549.685] (-549.442) (-552.250) (-557.841) -- 0:00:46
257000 -- (-550.160) (-550.580) [-550.085] (-551.335) * (-550.560) [-551.529] (-550.338) (-551.417) -- 0:00:46
257500 -- (-551.426) (-553.568) [-555.503] (-556.234) * (-551.274) (-551.502) [-553.573] (-555.800) -- 0:00:46
258000 -- (-553.057) [-553.690] (-551.130) (-552.844) * [-550.227] (-552.264) (-550.423) (-551.860) -- 0:00:46
258500 -- (-550.191) [-553.071] (-555.923) (-551.856) * (-550.009) [-551.546] (-551.746) (-553.824) -- 0:00:45
259000 -- [-550.334] (-551.724) (-550.914) (-549.592) * (-550.200) (-556.533) [-550.222] (-550.252) -- 0:00:45
259500 -- (-550.101) (-552.433) [-550.319] (-549.684) * (-551.139) [-550.091] (-553.493) (-550.314) -- 0:00:45
260000 -- [-550.646] (-552.134) (-550.971) (-550.036) * (-550.615) [-549.649] (-551.064) (-550.879) -- 0:00:45
Average standard deviation of split frequencies: 0.015824
260500 -- (-551.749) [-552.895] (-551.754) (-549.604) * (-552.536) (-549.567) [-549.490] (-551.237) -- 0:00:45
261000 -- (-557.270) (-551.859) [-550.553] (-551.671) * (-553.355) [-549.933] (-553.882) (-552.737) -- 0:00:45
261500 -- (-553.341) [-550.524] (-553.109) (-550.115) * (-559.192) [-553.432] (-551.664) (-552.816) -- 0:00:45
262000 -- [-553.426] (-551.855) (-553.590) (-551.182) * [-551.572] (-560.036) (-553.716) (-550.217) -- 0:00:45
262500 -- (-552.435) (-550.272) [-555.268] (-552.891) * [-554.220] (-551.272) (-553.595) (-554.143) -- 0:00:44
263000 -- (-551.482) [-553.583] (-552.990) (-549.785) * (-553.811) [-550.655] (-552.205) (-550.483) -- 0:00:44
263500 -- (-551.899) [-551.643] (-551.739) (-551.835) * (-550.530) [-549.134] (-553.124) (-551.638) -- 0:00:44
264000 -- [-552.840] (-553.724) (-551.534) (-552.342) * (-553.865) (-549.513) [-550.418] (-552.467) -- 0:00:44
264500 -- (-557.501) (-553.641) [-552.138] (-559.670) * (-552.448) (-550.626) [-558.273] (-554.952) -- 0:00:44
265000 -- (-550.391) (-549.973) (-552.116) [-553.839] * [-553.316] (-551.831) (-550.057) (-552.325) -- 0:00:44
Average standard deviation of split frequencies: 0.016471
265500 -- (-552.306) (-551.054) [-551.874] (-553.796) * (-552.895) (-552.674) [-551.123] (-554.896) -- 0:00:44
266000 -- [-549.831] (-552.356) (-550.041) (-549.960) * (-553.313) (-550.441) (-551.018) [-555.314] -- 0:00:44
266500 -- (-550.514) (-551.459) [-553.697] (-552.320) * (-554.335) [-550.332] (-551.191) (-551.113) -- 0:00:44
267000 -- (-550.024) [-551.366] (-555.005) (-551.414) * (-550.498) (-550.911) [-549.924] (-549.536) -- 0:00:43
267500 -- [-550.605] (-553.005) (-550.437) (-550.321) * (-550.457) (-551.583) (-552.431) [-550.422] -- 0:00:43
268000 -- [-550.148] (-555.525) (-552.332) (-550.788) * (-552.929) [-551.486] (-552.843) (-549.732) -- 0:00:43
268500 -- (-551.288) (-551.026) [-551.578] (-552.695) * [-551.549] (-551.174) (-552.609) (-551.846) -- 0:00:43
269000 -- [-550.276] (-554.098) (-550.778) (-552.335) * [-552.700] (-550.232) (-551.572) (-551.580) -- 0:00:43
269500 -- (-551.244) (-554.019) (-551.662) [-551.127] * (-552.105) [-550.882] (-555.022) (-549.814) -- 0:00:43
270000 -- (-555.783) (-552.616) (-550.607) [-552.252] * (-550.663) [-550.776] (-553.093) (-549.781) -- 0:00:43
Average standard deviation of split frequencies: 0.014260
270500 -- (-550.487) (-551.981) (-553.182) [-552.239] * (-549.957) [-552.273] (-551.544) (-553.247) -- 0:00:43
271000 -- [-550.893] (-549.849) (-553.810) (-549.984) * (-549.485) (-551.107) [-552.791] (-550.838) -- 0:00:43
271500 -- [-551.280] (-551.647) (-550.999) (-551.921) * (-551.160) [-552.833] (-549.695) (-557.607) -- 0:00:45
272000 -- [-549.751] (-550.560) (-550.705) (-549.559) * (-553.278) (-551.305) (-555.040) [-552.376] -- 0:00:45
272500 -- (-552.396) (-550.983) [-553.944] (-549.848) * (-550.796) (-552.126) [-549.616] (-550.643) -- 0:00:45
273000 -- [-550.731] (-552.141) (-554.881) (-551.282) * [-551.021] (-551.955) (-550.417) (-550.353) -- 0:00:45
273500 -- [-551.488] (-551.714) (-551.590) (-549.968) * (-551.633) [-551.013] (-550.373) (-551.089) -- 0:00:45
274000 -- [-549.999] (-552.229) (-549.917) (-550.272) * (-553.385) [-550.673] (-552.168) (-549.964) -- 0:00:45
274500 -- (-550.834) (-553.058) [-551.263] (-549.500) * [-551.063] (-550.881) (-551.820) (-554.005) -- 0:00:44
275000 -- (-551.300) [-557.506] (-552.330) (-555.824) * (-554.427) [-550.098] (-551.145) (-552.479) -- 0:00:44
Average standard deviation of split frequencies: 0.014625
275500 -- [-549.947] (-554.806) (-558.588) (-553.830) * [-551.387] (-549.598) (-551.567) (-553.323) -- 0:00:44
276000 -- (-556.154) (-553.703) (-554.088) [-551.427] * [-551.286] (-552.024) (-550.029) (-553.822) -- 0:00:44
276500 -- (-555.628) (-554.854) [-550.357] (-552.787) * (-550.540) [-550.809] (-553.623) (-551.629) -- 0:00:44
277000 -- (-556.573) (-552.301) [-552.578] (-554.029) * [-555.199] (-550.809) (-549.795) (-551.743) -- 0:00:44
277500 -- [-553.566] (-554.156) (-553.137) (-554.787) * (-551.737) (-554.170) [-550.304] (-549.549) -- 0:00:44
278000 -- (-549.639) (-555.791) [-551.252] (-552.046) * [-551.004] (-551.707) (-556.251) (-551.412) -- 0:00:44
278500 -- (-549.761) [-551.753] (-555.478) (-549.967) * (-552.606) [-553.364] (-555.294) (-549.625) -- 0:00:44
279000 -- (-551.871) [-551.097] (-553.728) (-553.965) * [-552.319] (-550.868) (-553.341) (-549.669) -- 0:00:43
279500 -- (-551.917) [-551.076] (-551.606) (-551.428) * (-551.057) (-552.712) (-549.374) [-550.735] -- 0:00:43
280000 -- (-554.701) [-551.486] (-552.683) (-551.830) * (-551.608) [-555.870] (-555.912) (-551.147) -- 0:00:43
Average standard deviation of split frequencies: 0.015221
280500 -- (-555.732) (-552.121) [-551.875] (-550.147) * (-552.243) [-551.383] (-554.204) (-557.226) -- 0:00:43
281000 -- (-551.417) (-550.694) [-555.772] (-554.712) * (-555.923) (-551.121) [-556.806] (-551.457) -- 0:00:43
281500 -- (-553.598) (-556.761) (-552.389) [-556.304] * (-551.543) (-551.544) (-554.029) [-551.281] -- 0:00:43
282000 -- (-552.128) [-551.715] (-552.339) (-552.188) * [-552.382] (-551.252) (-553.248) (-550.619) -- 0:00:43
282500 -- [-552.027] (-552.479) (-555.398) (-555.045) * [-552.056] (-553.091) (-552.123) (-552.607) -- 0:00:43
283000 -- (-551.284) (-551.782) (-555.750) [-553.804] * (-550.664) [-551.717] (-550.175) (-551.391) -- 0:00:43
283500 -- (-549.795) (-550.460) [-551.087] (-552.126) * [-550.473] (-551.937) (-549.664) (-549.737) -- 0:00:42
284000 -- (-551.795) (-550.777) [-551.892] (-554.565) * (-552.185) (-550.851) [-549.874] (-550.072) -- 0:00:42
284500 -- (-553.395) [-553.509] (-553.630) (-557.046) * (-551.690) (-550.847) (-551.526) [-549.665] -- 0:00:42
285000 -- (-552.372) [-550.558] (-555.778) (-550.888) * (-554.519) (-551.311) (-552.281) [-549.556] -- 0:00:42
Average standard deviation of split frequencies: 0.016391
285500 -- [-550.346] (-549.855) (-549.425) (-549.545) * (-549.901) (-551.025) [-549.544] (-550.074) -- 0:00:42
286000 -- (-551.245) (-550.134) [-549.505] (-551.776) * (-552.611) (-551.142) (-551.918) [-549.672] -- 0:00:42
286500 -- (-551.568) (-553.005) (-551.932) [-551.906] * (-553.758) (-552.487) [-552.314] (-550.607) -- 0:00:42
287000 -- (-552.206) [-550.110] (-551.428) (-553.217) * (-554.108) [-551.852] (-553.120) (-552.552) -- 0:00:42
287500 -- (-554.611) (-552.352) (-555.164) [-553.063] * [-552.777] (-552.794) (-551.228) (-550.642) -- 0:00:42
288000 -- (-551.127) [-553.503] (-554.246) (-550.728) * (-553.672) (-550.417) (-553.973) [-549.586] -- 0:00:44
288500 -- (-553.215) (-552.066) (-556.018) [-550.513] * (-553.072) (-553.463) [-550.064] (-552.688) -- 0:00:44
289000 -- (-554.457) (-553.364) [-550.778] (-553.906) * (-552.827) (-550.180) [-549.288] (-550.562) -- 0:00:44
289500 -- (-553.538) (-552.828) (-551.347) [-549.806] * (-551.540) (-552.815) (-550.803) [-551.815] -- 0:00:44
290000 -- [-550.624] (-550.430) (-554.110) (-550.233) * (-550.519) [-551.023] (-552.446) (-558.537) -- 0:00:44
Average standard deviation of split frequencies: 0.016398
290500 -- [-549.901] (-550.805) (-552.578) (-550.386) * (-553.765) (-553.178) (-552.100) [-552.834] -- 0:00:43
291000 -- (-552.507) (-550.569) (-552.064) [-551.573] * (-554.262) (-557.275) (-557.635) [-551.930] -- 0:00:43
291500 -- (-549.821) (-551.211) (-551.326) [-549.891] * (-551.514) [-551.642] (-550.860) (-554.311) -- 0:00:43
292000 -- (-552.360) [-551.339] (-557.277) (-551.142) * [-552.564] (-550.094) (-551.608) (-552.781) -- 0:00:43
292500 -- (-552.247) (-550.469) (-553.602) [-551.706] * (-552.010) [-552.390] (-554.370) (-558.248) -- 0:00:43
293000 -- (-550.700) (-558.184) [-550.764] (-550.538) * (-550.128) (-550.684) [-552.955] (-554.598) -- 0:00:43
293500 -- (-550.348) (-554.801) [-551.029] (-549.949) * (-551.865) [-552.616] (-551.722) (-554.151) -- 0:00:43
294000 -- (-551.711) (-553.318) (-550.543) [-549.468] * (-550.935) [-551.121] (-549.894) (-551.641) -- 0:00:43
294500 -- (-550.778) (-553.465) (-556.611) [-550.429] * (-550.532) (-553.160) (-553.427) [-550.253] -- 0:00:43
295000 -- (-550.614) (-555.183) [-551.895] (-549.682) * [-550.722] (-552.394) (-553.471) (-549.328) -- 0:00:43
Average standard deviation of split frequencies: 0.016811
295500 -- (-553.801) [-550.293] (-553.019) (-550.681) * (-550.466) (-552.675) [-550.284] (-550.259) -- 0:00:42
296000 -- (-553.217) [-550.987] (-550.885) (-550.159) * (-550.251) (-552.027) (-550.568) [-550.001] -- 0:00:42
296500 -- (-551.950) (-549.870) (-550.529) [-550.260] * (-556.354) (-556.023) (-550.635) [-552.032] -- 0:00:42
297000 -- (-549.456) (-550.889) [-550.730] (-554.146) * (-554.452) (-551.320) [-550.044] (-551.335) -- 0:00:42
297500 -- (-553.063) (-554.470) [-555.219] (-555.940) * (-553.564) (-550.774) (-554.345) [-550.935] -- 0:00:42
298000 -- (-551.893) (-553.006) [-550.134] (-551.585) * (-553.290) (-551.710) (-551.857) [-551.153] -- 0:00:42
298500 -- (-550.037) (-551.889) (-554.015) [-550.810] * [-554.593] (-549.373) (-550.879) (-550.138) -- 0:00:42
299000 -- (-550.036) (-552.552) [-554.617] (-550.627) * (-553.975) (-551.712) [-549.949] (-552.164) -- 0:00:42
299500 -- (-551.169) (-551.348) [-552.256] (-549.818) * (-552.145) (-550.675) (-549.897) [-550.897] -- 0:00:42
300000 -- (-550.329) (-552.405) (-551.942) [-550.625] * (-552.801) [-550.088] (-553.181) (-552.596) -- 0:00:42
Average standard deviation of split frequencies: 0.017508
300500 -- (-551.836) (-554.569) (-550.630) [-550.182] * (-554.188) (-556.834) [-550.532] (-553.106) -- 0:00:41
301000 -- (-552.215) [-550.704] (-549.860) (-551.420) * (-551.502) (-555.194) [-549.436] (-553.470) -- 0:00:41
301500 -- (-550.260) (-559.669) (-550.277) [-553.729] * (-552.187) (-553.387) [-553.250] (-551.233) -- 0:00:41
302000 -- (-550.709) (-552.737) [-551.801] (-549.898) * (-554.247) (-554.791) (-552.918) [-552.121] -- 0:00:41
302500 -- (-550.777) (-553.408) [-552.854] (-550.485) * [-554.646] (-558.363) (-552.324) (-552.004) -- 0:00:41
303000 -- (-554.636) [-550.664] (-555.341) (-552.781) * (-553.036) [-550.956] (-550.647) (-554.181) -- 0:00:41
303500 -- (-549.952) (-551.776) (-550.664) [-554.530] * (-552.287) [-550.466] (-551.492) (-554.373) -- 0:00:41
304000 -- (-550.062) (-556.128) [-550.410] (-554.809) * (-552.170) (-549.890) [-551.863] (-551.962) -- 0:00:41
304500 -- (-555.067) (-551.762) (-550.647) [-551.208] * (-556.658) (-549.772) (-554.566) [-552.636] -- 0:00:41
305000 -- (-552.237) (-551.254) (-550.343) [-551.001] * (-558.062) (-553.586) [-552.693] (-552.384) -- 0:00:43
Average standard deviation of split frequencies: 0.017031
305500 -- (-552.081) (-550.349) (-553.132) [-549.448] * (-554.222) (-552.351) [-551.839] (-558.202) -- 0:00:43
306000 -- (-552.287) (-551.692) [-553.209] (-550.809) * (-553.798) (-552.284) [-550.727] (-550.348) -- 0:00:43
306500 -- (-554.896) (-550.703) (-554.600) [-551.179] * (-551.570) (-551.774) [-553.179] (-550.277) -- 0:00:42
307000 -- [-554.632] (-550.481) (-550.556) (-550.308) * [-553.633] (-553.857) (-551.699) (-551.407) -- 0:00:42
307500 -- (-552.808) (-554.013) (-550.412) [-551.520] * (-550.648) [-552.100] (-554.121) (-554.302) -- 0:00:42
308000 -- (-552.202) (-551.373) [-550.420] (-551.174) * (-550.702) (-550.690) (-551.238) [-551.677] -- 0:00:42
308500 -- [-552.743] (-549.967) (-549.785) (-551.450) * [-552.391] (-551.008) (-553.555) (-555.272) -- 0:00:42
309000 -- [-551.390] (-552.073) (-550.164) (-555.950) * (-550.642) (-552.825) [-550.785] (-555.199) -- 0:00:42
309500 -- [-551.158] (-552.198) (-550.880) (-550.260) * (-551.302) (-550.181) (-551.278) [-550.162] -- 0:00:42
310000 -- (-550.900) (-553.379) [-551.759] (-550.914) * (-551.817) (-549.772) [-550.227] (-550.404) -- 0:00:42
Average standard deviation of split frequencies: 0.015174
310500 -- [-553.020] (-551.703) (-550.220) (-552.628) * [-551.761] (-549.798) (-551.222) (-551.864) -- 0:00:42
311000 -- (-556.781) [-555.149] (-551.293) (-550.881) * (-555.863) (-550.408) [-550.988] (-549.233) -- 0:00:42
311500 -- [-555.170] (-550.919) (-551.445) (-551.670) * (-555.150) [-551.231] (-552.096) (-554.083) -- 0:00:41
312000 -- (-551.637) [-550.811] (-551.018) (-551.681) * (-550.875) (-551.317) (-553.292) [-552.027] -- 0:00:41
312500 -- (-552.864) (-550.757) [-551.390] (-551.046) * (-549.963) [-550.565] (-551.056) (-552.614) -- 0:00:41
313000 -- (-552.879) [-551.833] (-550.444) (-551.264) * (-551.973) (-554.798) (-550.817) [-552.723] -- 0:00:41
313500 -- (-550.265) (-552.931) [-549.889] (-553.346) * (-551.490) (-552.614) [-550.856] (-551.229) -- 0:00:41
314000 -- (-551.087) (-556.170) [-551.104] (-551.210) * [-552.164] (-551.637) (-551.224) (-551.194) -- 0:00:41
314500 -- (-554.062) (-551.896) (-552.101) [-552.697] * [-551.507] (-551.865) (-551.254) (-550.602) -- 0:00:41
315000 -- (-551.078) [-555.319] (-552.966) (-550.661) * (-550.856) (-550.651) [-551.093] (-552.033) -- 0:00:41
Average standard deviation of split frequencies: 0.014918
315500 -- (-554.070) [-557.510] (-549.481) (-550.028) * [-550.380] (-551.711) (-550.524) (-551.290) -- 0:00:41
316000 -- (-555.023) [-550.782] (-551.655) (-553.266) * [-551.835] (-549.905) (-551.288) (-550.855) -- 0:00:41
316500 -- (-552.945) [-549.627] (-551.331) (-551.892) * [-550.529] (-550.210) (-552.763) (-549.633) -- 0:00:41
317000 -- (-550.070) (-550.449) (-550.602) [-550.311] * (-551.957) (-556.227) [-551.745] (-551.331) -- 0:00:40
317500 -- (-552.587) (-555.261) (-551.522) [-549.727] * (-551.358) (-549.729) (-550.476) [-550.005] -- 0:00:40
318000 -- (-554.350) [-551.561] (-552.678) (-549.358) * (-552.879) (-551.324) [-550.914] (-549.763) -- 0:00:40
318500 -- [-552.592] (-549.659) (-552.245) (-557.629) * (-551.923) (-553.120) [-551.103] (-550.384) -- 0:00:40
319000 -- (-551.734) [-550.629] (-550.293) (-551.672) * (-552.370) [-550.420] (-550.168) (-552.182) -- 0:00:40
319500 -- (-552.762) (-550.336) (-552.118) [-551.095] * (-553.117) (-550.060) [-550.357] (-550.427) -- 0:00:40
320000 -- (-551.473) (-552.145) (-549.964) [-551.717] * (-553.516) [-552.560] (-550.987) (-550.419) -- 0:00:40
Average standard deviation of split frequencies: 0.015027
320500 -- (-551.696) (-551.230) (-553.962) [-554.076] * (-553.605) [-552.412] (-549.752) (-550.481) -- 0:00:40
321000 -- (-550.054) [-551.024] (-551.324) (-554.849) * (-551.365) (-557.501) (-554.367) [-549.987] -- 0:00:40
321500 -- (-549.653) (-552.777) (-551.085) [-550.931] * (-552.587) (-557.505) (-555.631) [-552.897] -- 0:00:42
322000 -- (-552.672) [-551.056] (-554.354) (-550.313) * [-552.596] (-557.599) (-556.229) (-550.375) -- 0:00:42
322500 -- (-554.231) [-552.018] (-550.902) (-551.591) * (-550.350) (-549.810) [-553.852] (-551.441) -- 0:00:42
323000 -- (-550.550) (-552.355) [-553.274] (-550.733) * (-550.416) (-553.592) [-552.493] (-550.185) -- 0:00:41
323500 -- [-551.661] (-551.318) (-551.778) (-549.228) * (-552.866) (-553.941) (-556.040) [-552.373] -- 0:00:41
324000 -- [-552.233] (-551.499) (-554.532) (-552.443) * (-551.987) (-552.908) (-552.062) [-554.121] -- 0:00:41
324500 -- (-556.207) [-551.610] (-554.495) (-551.602) * [-552.706] (-553.271) (-552.752) (-553.469) -- 0:00:41
325000 -- [-550.596] (-553.472) (-552.153) (-551.334) * (-554.715) (-550.783) (-550.466) [-551.340] -- 0:00:41
Average standard deviation of split frequencies: 0.014380
325500 -- (-553.111) (-556.411) [-551.500] (-550.405) * (-551.136) (-551.609) [-551.325] (-551.279) -- 0:00:41
326000 -- (-550.114) (-551.448) [-552.554] (-553.192) * (-550.207) (-551.388) (-550.508) [-550.177] -- 0:00:41
326500 -- (-549.986) (-553.874) (-551.931) [-552.086] * (-550.056) (-552.118) (-550.642) [-553.908] -- 0:00:41
327000 -- [-550.510] (-550.770) (-551.494) (-555.600) * (-553.121) (-549.451) (-549.786) [-549.606] -- 0:00:41
327500 -- (-549.911) (-550.397) [-551.291] (-552.284) * (-550.333) [-551.721] (-550.067) (-551.771) -- 0:00:41
328000 -- (-549.463) [-549.496] (-551.931) (-550.840) * (-551.359) (-550.061) (-549.984) [-555.343] -- 0:00:40
328500 -- [-550.733] (-552.653) (-553.177) (-551.922) * (-550.486) [-553.034] (-554.258) (-554.198) -- 0:00:40
329000 -- [-550.200] (-549.956) (-552.906) (-550.737) * (-555.095) (-550.130) (-556.873) [-549.571] -- 0:00:40
329500 -- [-552.392] (-554.519) (-555.670) (-549.771) * [-552.148] (-550.317) (-552.346) (-549.693) -- 0:00:40
330000 -- (-555.158) (-549.460) (-555.189) [-551.075] * (-558.531) [-551.026] (-553.555) (-554.516) -- 0:00:40
Average standard deviation of split frequencies: 0.013623
330500 -- (-551.620) [-550.383] (-552.377) (-552.459) * (-555.457) (-556.890) (-553.454) [-551.347] -- 0:00:40
331000 -- [-556.542] (-551.653) (-552.834) (-551.554) * (-552.134) [-550.365] (-553.536) (-551.822) -- 0:00:40
331500 -- (-553.489) (-553.438) [-554.351] (-551.645) * (-551.624) [-551.065] (-553.900) (-551.205) -- 0:00:40
332000 -- (-552.719) [-550.819] (-554.809) (-551.006) * (-551.152) [-551.411] (-552.486) (-552.324) -- 0:00:40
332500 -- [-550.198] (-550.070) (-553.803) (-551.468) * [-551.666] (-551.657) (-552.174) (-553.704) -- 0:00:40
333000 -- (-550.097) [-549.714] (-549.687) (-549.408) * (-551.330) (-557.175) [-549.353] (-552.057) -- 0:00:40
333500 -- (-553.065) (-554.995) [-550.935] (-552.746) * (-553.278) (-550.770) (-549.813) [-550.745] -- 0:00:39
334000 -- [-550.768] (-553.404) (-551.093) (-551.938) * (-552.888) [-549.930] (-552.482) (-550.555) -- 0:00:39
334500 -- (-550.109) (-550.567) [-553.139] (-553.680) * (-552.814) (-553.106) (-550.676) [-551.019] -- 0:00:39
335000 -- (-551.597) (-550.415) (-554.232) [-553.529] * [-550.446] (-552.970) (-552.708) (-549.536) -- 0:00:39
Average standard deviation of split frequencies: 0.013484
335500 -- (-552.191) (-554.882) (-552.700) [-551.726] * (-557.616) (-551.830) (-552.705) [-553.694] -- 0:00:39
336000 -- (-552.193) (-550.312) [-551.052] (-557.887) * (-555.695) (-551.064) [-550.333] (-552.033) -- 0:00:39
336500 -- [-552.860] (-550.357) (-549.617) (-558.673) * (-552.732) (-550.525) [-552.709] (-549.902) -- 0:00:39
337000 -- (-558.534) [-551.792] (-551.694) (-555.327) * [-550.542] (-553.146) (-550.753) (-552.878) -- 0:00:39
337500 -- (-550.700) (-550.888) [-553.623] (-549.479) * (-552.705) (-550.535) [-552.969] (-552.085) -- 0:00:41
338000 -- (-553.436) [-554.185] (-554.504) (-550.712) * (-551.915) (-551.072) [-550.192] (-553.433) -- 0:00:41
338500 -- [-556.360] (-549.845) (-550.287) (-554.635) * (-550.558) [-551.467] (-551.895) (-551.676) -- 0:00:41
339000 -- (-552.255) [-550.945] (-552.727) (-550.461) * (-551.893) [-552.229] (-553.876) (-557.749) -- 0:00:40
339500 -- (-555.658) (-552.025) [-550.624] (-551.579) * [-552.244] (-553.883) (-552.794) (-554.661) -- 0:00:40
340000 -- (-552.355) [-552.666] (-552.431) (-553.956) * (-551.959) (-551.324) [-551.822] (-551.802) -- 0:00:40
Average standard deviation of split frequencies: 0.012838
340500 -- (-551.741) (-553.780) [-550.664] (-551.199) * (-562.341) [-550.923] (-552.490) (-551.602) -- 0:00:40
341000 -- (-550.255) (-552.017) (-551.570) [-550.209] * (-554.043) (-550.739) [-552.818] (-551.167) -- 0:00:40
341500 -- [-551.122] (-552.421) (-552.682) (-552.209) * (-554.331) (-552.851) (-553.260) [-552.404] -- 0:00:40
342000 -- (-555.020) (-551.475) (-551.165) [-552.752] * (-555.218) (-551.704) [-551.404] (-551.496) -- 0:00:40
342500 -- (-552.809) (-551.034) [-551.814] (-549.636) * [-551.846] (-551.555) (-549.701) (-551.553) -- 0:00:40
343000 -- [-552.327] (-551.437) (-553.907) (-549.648) * (-550.187) (-551.454) (-550.247) [-549.731] -- 0:00:40
343500 -- (-554.032) (-551.264) [-550.449] (-550.256) * [-550.433] (-554.638) (-551.723) (-556.293) -- 0:00:40
344000 -- [-555.009] (-552.398) (-550.088) (-551.970) * (-550.600) (-551.494) (-555.485) [-551.487] -- 0:00:40
344500 -- (-552.825) (-552.235) [-549.538] (-550.589) * [-552.767] (-549.128) (-555.452) (-555.909) -- 0:00:39
345000 -- (-551.885) (-552.394) (-552.487) [-555.145] * [-553.068] (-550.479) (-549.885) (-552.288) -- 0:00:39
Average standard deviation of split frequencies: 0.011975
345500 -- (-554.845) [-551.133] (-551.690) (-551.708) * [-550.999] (-553.092) (-553.018) (-550.699) -- 0:00:39
346000 -- (-554.623) (-550.972) (-555.397) [-551.300] * [-551.673] (-553.427) (-551.810) (-552.503) -- 0:00:39
346500 -- (-552.078) [-550.860] (-555.416) (-552.435) * [-551.204] (-551.450) (-550.553) (-550.924) -- 0:00:39
347000 -- (-554.009) (-550.071) (-554.757) [-551.092] * (-556.506) (-553.455) [-551.913] (-550.879) -- 0:00:39
347500 -- (-550.860) [-551.413] (-552.304) (-551.267) * (-553.457) [-552.934] (-550.974) (-554.214) -- 0:00:39
348000 -- (-554.276) (-550.798) (-554.409) [-552.683] * (-552.559) (-552.930) (-551.984) [-551.156] -- 0:00:39
348500 -- (-551.818) (-549.980) (-549.815) [-549.788] * (-552.548) [-552.897] (-554.502) (-550.904) -- 0:00:39
349000 -- (-551.833) (-551.776) [-550.621] (-552.655) * (-552.184) (-550.180) (-554.536) [-554.240] -- 0:00:39
349500 -- (-551.460) (-551.032) [-549.522] (-551.435) * (-549.252) (-549.879) (-551.672) [-550.349] -- 0:00:39
350000 -- [-550.800] (-551.597) (-550.693) (-551.403) * (-549.866) [-550.363] (-551.267) (-554.039) -- 0:00:39
Average standard deviation of split frequencies: 0.011229
350500 -- (-553.158) [-550.818] (-550.357) (-551.805) * [-553.213] (-552.460) (-555.176) (-551.538) -- 0:00:38
351000 -- [-550.747] (-550.092) (-551.752) (-555.419) * [-554.121] (-550.841) (-554.711) (-551.071) -- 0:00:38
351500 -- (-555.103) [-552.995] (-550.957) (-550.470) * [-550.432] (-555.559) (-551.639) (-553.358) -- 0:00:38
352000 -- (-549.942) [-551.363] (-556.042) (-551.120) * [-550.675] (-552.169) (-554.897) (-551.273) -- 0:00:38
352500 -- [-549.568] (-552.606) (-551.664) (-550.795) * [-551.283] (-553.528) (-554.055) (-553.431) -- 0:00:38
353000 -- (-550.401) (-551.455) [-551.412] (-550.827) * [-551.377] (-551.897) (-551.791) (-550.814) -- 0:00:38
353500 -- (-550.568) (-549.847) [-549.971] (-552.340) * [-552.034] (-551.053) (-549.833) (-552.778) -- 0:00:38
354000 -- (-551.140) (-551.546) [-549.362] (-551.724) * (-553.089) [-551.264] (-550.504) (-549.730) -- 0:00:40
354500 -- (-551.888) (-551.442) [-550.307] (-550.348) * (-553.014) [-551.326] (-551.638) (-552.248) -- 0:00:40
355000 -- (-557.326) (-552.002) [-551.342] (-553.010) * [-552.785] (-551.005) (-551.183) (-551.977) -- 0:00:39
Average standard deviation of split frequencies: 0.011061
355500 -- [-550.359] (-549.752) (-549.998) (-553.660) * (-553.073) (-550.757) (-550.602) [-552.428] -- 0:00:39
356000 -- (-553.447) (-552.231) [-550.840] (-554.065) * (-552.048) (-550.712) [-553.563] (-555.972) -- 0:00:39
356500 -- (-550.172) [-555.987] (-555.654) (-551.114) * (-550.724) (-550.347) (-551.797) [-551.354] -- 0:00:39
357000 -- (-550.574) (-551.615) [-551.285] (-551.949) * (-551.325) (-553.223) (-552.550) [-553.482] -- 0:00:39
357500 -- [-550.278] (-552.656) (-551.125) (-551.595) * [-551.002] (-551.695) (-553.866) (-551.706) -- 0:00:39
358000 -- (-550.295) (-551.562) (-552.518) [-550.094] * (-551.851) (-551.121) (-551.802) [-550.048] -- 0:00:39
358500 -- (-551.969) [-550.164] (-552.317) (-551.463) * (-550.528) [-550.874] (-554.318) (-554.065) -- 0:00:39
359000 -- [-551.513] (-551.103) (-551.897) (-552.747) * (-550.392) (-552.660) (-551.397) [-550.793] -- 0:00:39
359500 -- [-550.999] (-552.100) (-551.101) (-550.133) * [-550.782] (-550.069) (-549.974) (-549.961) -- 0:00:39
360000 -- (-551.681) [-550.465] (-549.664) (-549.528) * (-550.068) [-550.025] (-556.536) (-552.423) -- 0:00:39
Average standard deviation of split frequencies: 0.009884
360500 -- (-550.477) (-555.228) [-550.352] (-551.291) * (-552.209) [-553.645] (-550.220) (-553.231) -- 0:00:39
361000 -- (-549.591) [-551.976] (-552.639) (-555.205) * (-549.700) [-553.301] (-549.905) (-549.558) -- 0:00:38
361500 -- [-550.865] (-549.617) (-549.760) (-553.891) * (-550.995) (-549.607) (-555.150) [-551.326] -- 0:00:38
362000 -- [-549.984] (-549.269) (-551.274) (-551.255) * (-550.333) (-553.450) (-553.720) [-549.450] -- 0:00:38
362500 -- [-550.949] (-550.946) (-551.622) (-555.249) * [-550.435] (-556.076) (-551.365) (-550.890) -- 0:00:38
363000 -- (-552.743) [-553.274] (-551.133) (-550.087) * (-551.426) [-550.162] (-554.684) (-549.503) -- 0:00:38
363500 -- (-550.411) [-549.757] (-550.293) (-551.292) * (-552.897) (-550.824) (-550.102) [-553.301] -- 0:00:38
364000 -- (-553.581) [-552.430] (-550.978) (-552.802) * (-552.363) (-550.369) [-553.559] (-560.959) -- 0:00:38
364500 -- (-552.452) [-550.150] (-552.258) (-552.298) * [-553.130] (-549.645) (-553.411) (-551.950) -- 0:00:38
365000 -- (-550.119) (-550.924) (-552.961) [-551.107] * (-551.107) (-549.445) (-555.024) [-551.875] -- 0:00:38
Average standard deviation of split frequencies: 0.009471
365500 -- (-551.337) (-551.436) [-549.915] (-550.493) * (-553.863) [-551.595] (-550.034) (-551.284) -- 0:00:38
366000 -- (-553.609) [-550.131] (-554.513) (-552.894) * (-553.407) (-553.215) [-549.597] (-551.201) -- 0:00:38
366500 -- (-551.630) (-552.526) (-550.712) [-549.690] * (-552.318) [-554.257] (-554.265) (-551.888) -- 0:00:38
367000 -- (-553.530) (-551.712) (-553.556) [-551.627] * (-551.229) (-553.374) [-550.782] (-550.171) -- 0:00:37
367500 -- (-553.605) (-550.717) [-550.195] (-551.651) * (-550.566) (-551.106) (-551.222) [-554.761] -- 0:00:37
368000 -- [-553.156] (-550.837) (-551.776) (-553.340) * [-552.004] (-550.009) (-550.236) (-552.545) -- 0:00:37
368500 -- (-554.813) [-554.209] (-551.062) (-552.996) * (-550.612) (-550.478) (-551.640) [-553.548] -- 0:00:37
369000 -- (-549.619) [-550.426] (-551.378) (-551.566) * (-552.765) (-551.587) [-553.109] (-550.220) -- 0:00:37
369500 -- (-552.555) (-553.319) (-554.364) [-549.699] * (-552.442) (-554.006) [-550.224] (-551.385) -- 0:00:37
370000 -- (-556.298) [-551.469] (-551.079) (-550.550) * [-552.330] (-550.293) (-552.708) (-551.463) -- 0:00:37
Average standard deviation of split frequencies: 0.010399
370500 -- [-551.547] (-551.087) (-554.171) (-551.706) * (-554.512) (-550.867) [-549.898] (-553.040) -- 0:00:37
371000 -- [-551.575] (-550.445) (-550.164) (-553.215) * (-553.668) (-550.910) (-552.711) [-550.725] -- 0:00:38
371500 -- (-553.903) [-550.502] (-549.570) (-549.692) * (-550.425) (-550.426) [-550.019] (-550.969) -- 0:00:38
372000 -- (-551.682) (-550.660) (-550.806) [-550.295] * [-550.363] (-550.217) (-549.879) (-550.283) -- 0:00:38
372500 -- (-550.351) [-552.487] (-550.340) (-550.345) * (-549.523) (-552.205) (-556.612) [-552.012] -- 0:00:38
373000 -- (-550.617) (-554.638) (-550.474) [-552.168] * (-551.893) (-550.789) (-550.911) [-550.727] -- 0:00:38
373500 -- (-553.015) (-553.051) [-550.855] (-553.740) * (-551.383) (-550.299) [-551.952] (-550.783) -- 0:00:38
374000 -- (-553.139) (-551.648) (-554.301) [-550.205] * (-552.556) (-549.824) (-552.412) [-550.834] -- 0:00:38
374500 -- (-554.436) [-550.992] (-552.752) (-550.554) * (-550.645) [-551.396] (-550.582) (-554.314) -- 0:00:38
375000 -- [-554.231] (-550.217) (-552.283) (-552.657) * (-554.467) (-552.695) [-551.967] (-556.887) -- 0:00:38
Average standard deviation of split frequencies: 0.011049
375500 -- (-552.129) [-550.213] (-551.074) (-550.358) * [-551.056] (-551.285) (-551.843) (-555.167) -- 0:00:38
376000 -- (-550.983) (-554.569) (-549.988) [-551.807] * (-551.434) (-556.306) (-549.730) [-552.744] -- 0:00:38
376500 -- (-553.978) (-552.628) (-554.077) [-550.869] * (-553.453) (-550.754) [-553.214] (-550.503) -- 0:00:38
377000 -- (-551.077) (-550.010) [-552.063] (-550.419) * (-552.635) (-549.656) (-554.651) [-552.431] -- 0:00:38
377500 -- (-550.611) (-553.545) (-550.354) [-553.413] * (-551.926) [-552.192] (-549.771) (-550.283) -- 0:00:37
378000 -- (-550.370) (-551.333) (-555.904) [-552.595] * (-552.666) (-551.470) [-549.950] (-551.462) -- 0:00:37
378500 -- (-549.596) (-553.800) (-551.691) [-550.961] * [-550.053] (-551.664) (-553.018) (-552.135) -- 0:00:37
379000 -- [-549.329] (-551.917) (-556.964) (-550.605) * (-551.384) (-551.411) (-553.593) [-550.564] -- 0:00:37
379500 -- [-550.303] (-552.694) (-550.874) (-552.306) * (-551.021) (-552.802) (-553.400) [-550.015] -- 0:00:37
380000 -- (-550.999) [-550.921] (-552.149) (-552.536) * (-551.437) (-552.248) [-554.176] (-550.304) -- 0:00:37
Average standard deviation of split frequencies: 0.010062
380500 -- (-551.523) [-551.389] (-552.210) (-551.809) * (-552.654) (-551.184) [-551.010] (-550.605) -- 0:00:37
381000 -- (-559.978) [-550.716] (-553.265) (-552.376) * [-552.006] (-551.387) (-555.139) (-553.342) -- 0:00:37
381500 -- (-556.918) (-552.034) [-552.305] (-551.767) * (-551.158) (-551.539) (-558.176) [-551.738] -- 0:00:37
382000 -- [-553.926] (-551.117) (-551.030) (-551.726) * [-553.449] (-557.971) (-551.803) (-551.299) -- 0:00:37
382500 -- (-553.311) (-551.538) (-550.390) [-551.138] * (-551.404) (-558.300) (-553.829) [-551.223] -- 0:00:37
383000 -- [-550.841] (-553.135) (-554.097) (-550.036) * (-551.618) (-555.389) (-551.671) [-552.200] -- 0:00:37
383500 -- (-550.849) [-550.813] (-551.263) (-552.842) * [-549.187] (-553.359) (-550.876) (-550.535) -- 0:00:36
384000 -- (-551.729) [-550.962] (-556.313) (-554.184) * (-549.358) (-553.876) (-550.983) [-550.294] -- 0:00:36
384500 -- (-550.534) (-553.851) [-553.564] (-553.646) * (-550.984) [-550.047] (-549.254) (-551.300) -- 0:00:36
385000 -- (-551.309) (-551.651) [-552.012] (-552.565) * (-554.448) (-551.078) (-553.649) [-549.332] -- 0:00:36
Average standard deviation of split frequencies: 0.010449
385500 -- (-551.403) (-555.988) (-557.470) [-551.620] * (-551.725) [-552.205] (-550.392) (-551.317) -- 0:00:36
386000 -- (-550.318) (-551.736) (-549.830) [-550.722] * [-555.473] (-553.614) (-550.838) (-551.160) -- 0:00:36
386500 -- (-554.170) (-553.291) (-551.414) [-550.175] * (-550.307) (-549.480) (-551.946) [-551.055] -- 0:00:36
387000 -- [-556.555] (-554.054) (-552.940) (-551.161) * (-551.740) [-549.660] (-552.617) (-549.204) -- 0:00:36
387500 -- (-552.939) (-550.903) (-551.573) [-551.822] * (-550.450) (-552.365) [-549.800] (-551.010) -- 0:00:37
388000 -- (-550.819) (-550.822) [-552.429] (-554.077) * (-554.808) [-552.232] (-551.142) (-553.707) -- 0:00:37
388500 -- (-549.846) [-551.000] (-554.071) (-551.709) * [-549.701] (-552.151) (-549.410) (-552.827) -- 0:00:37
389000 -- (-552.138) [-553.205] (-554.353) (-550.910) * (-551.677) (-551.738) (-550.036) [-553.397] -- 0:00:37
389500 -- (-551.411) (-552.153) [-551.099] (-550.572) * (-550.046) [-551.535] (-550.315) (-551.526) -- 0:00:37
390000 -- (-552.674) (-551.615) (-555.111) [-549.730] * (-550.373) [-551.458] (-551.303) (-552.302) -- 0:00:37
Average standard deviation of split frequencies: 0.010123
390500 -- (-551.668) [-552.296] (-549.832) (-551.542) * (-552.126) (-554.001) (-552.003) [-551.265] -- 0:00:37
391000 -- (-551.878) (-554.311) (-553.543) [-550.006] * (-552.423) [-549.618] (-551.914) (-550.231) -- 0:00:37
391500 -- (-550.314) [-551.227] (-551.954) (-551.939) * (-551.588) (-549.546) (-552.762) [-552.223] -- 0:00:37
392000 -- (-551.347) (-551.497) (-549.615) [-551.296] * (-549.283) [-549.268] (-555.786) (-550.565) -- 0:00:37
392500 -- [-552.724] (-551.536) (-549.663) (-552.035) * [-549.314] (-549.501) (-560.068) (-551.117) -- 0:00:37
393000 -- (-552.098) (-551.098) [-553.620] (-552.939) * [-549.956] (-550.803) (-549.713) (-549.552) -- 0:00:37
393500 -- (-554.084) (-552.980) (-553.951) [-552.906] * (-552.390) [-549.598] (-550.488) (-550.946) -- 0:00:36
394000 -- (-549.287) [-551.584] (-552.523) (-557.666) * (-551.006) (-551.427) (-553.166) [-550.860] -- 0:00:36
394500 -- (-550.527) [-552.143] (-551.233) (-552.149) * (-551.978) (-550.273) [-550.231] (-550.630) -- 0:00:36
395000 -- [-551.970] (-550.684) (-554.205) (-553.299) * (-550.574) (-553.208) (-551.553) [-553.071] -- 0:00:36
Average standard deviation of split frequencies: 0.010780
395500 -- (-552.517) (-550.208) (-554.023) [-550.086] * (-550.412) [-550.169] (-549.989) (-552.308) -- 0:00:36
396000 -- (-551.572) [-550.664] (-549.758) (-551.303) * [-550.813] (-551.233) (-551.816) (-554.596) -- 0:00:36
396500 -- [-551.314] (-551.375) (-552.287) (-553.665) * [-552.581] (-550.360) (-549.999) (-552.934) -- 0:00:36
397000 -- (-555.223) (-557.976) [-551.466] (-555.705) * [-550.353] (-550.604) (-551.664) (-555.064) -- 0:00:36
397500 -- (-551.665) (-551.819) (-551.909) [-550.442] * (-551.116) (-550.204) (-550.028) [-550.703] -- 0:00:36
398000 -- (-551.466) (-550.960) [-552.527] (-557.729) * [-552.109] (-551.025) (-550.723) (-551.988) -- 0:00:36
398500 -- (-551.546) (-551.084) [-552.129] (-552.660) * (-552.317) [-552.611] (-552.421) (-557.623) -- 0:00:36
399000 -- (-553.227) (-551.198) [-552.167] (-551.215) * [-552.640] (-553.402) (-552.622) (-553.164) -- 0:00:36
399500 -- (-559.087) [-550.460] (-552.332) (-551.139) * (-553.713) [-549.928] (-550.695) (-550.032) -- 0:00:36
400000 -- (-554.072) (-553.589) [-550.955] (-550.469) * [-552.982] (-549.591) (-550.100) (-549.935) -- 0:00:36
Average standard deviation of split frequencies: 0.010327
400500 -- (-554.351) (-553.249) [-551.216] (-551.425) * (-558.565) (-549.982) [-551.606] (-552.308) -- 0:00:35
401000 -- [-553.954] (-552.709) (-550.341) (-551.106) * (-551.820) [-551.338] (-555.762) (-554.375) -- 0:00:35
401500 -- (-550.893) [-551.494] (-552.192) (-553.231) * [-550.272] (-551.409) (-549.400) (-558.202) -- 0:00:35
402000 -- [-550.941] (-552.944) (-551.648) (-551.671) * [-551.723] (-551.449) (-551.148) (-549.534) -- 0:00:35
402500 -- (-549.943) [-551.653] (-551.461) (-554.043) * (-551.262) [-552.609] (-551.877) (-549.493) -- 0:00:35
403000 -- (-561.775) (-550.673) (-551.653) [-549.791] * (-550.371) (-549.620) (-555.475) [-550.166] -- 0:00:35
403500 -- [-550.982] (-550.180) (-550.716) (-549.899) * [-554.371] (-550.737) (-555.844) (-552.738) -- 0:00:36
404000 -- (-555.878) [-552.177] (-549.906) (-555.199) * (-553.013) (-549.856) (-554.504) [-551.821] -- 0:00:36
404500 -- (-551.824) [-550.784] (-551.310) (-550.373) * (-550.758) [-549.339] (-552.681) (-553.886) -- 0:00:36
405000 -- (-551.366) (-549.605) (-550.419) [-551.098] * (-552.436) (-551.528) (-550.860) [-549.862] -- 0:00:36
Average standard deviation of split frequencies: 0.010256
405500 -- (-550.444) [-551.767] (-553.404) (-555.316) * (-551.412) (-552.807) [-556.025] (-549.994) -- 0:00:36
406000 -- (-550.240) (-554.535) (-551.119) [-555.962] * (-549.140) (-551.846) (-555.793) [-551.198] -- 0:00:36
406500 -- (-550.391) [-554.111] (-550.064) (-549.618) * (-550.175) [-553.218] (-551.031) (-554.915) -- 0:00:36
407000 -- (-550.276) [-555.036] (-550.751) (-550.064) * (-554.221) [-552.604] (-551.020) (-553.042) -- 0:00:36
407500 -- (-551.478) (-552.022) [-552.572] (-550.643) * (-552.481) (-550.385) [-550.707] (-552.138) -- 0:00:36
408000 -- (-549.380) (-550.436) [-550.122] (-550.399) * [-552.112] (-556.690) (-552.190) (-553.848) -- 0:00:36
408500 -- (-550.010) (-551.585) [-550.134] (-554.345) * (-551.663) [-555.461] (-552.602) (-553.216) -- 0:00:36
409000 -- (-551.618) [-550.601] (-552.531) (-554.906) * [-550.660] (-555.497) (-550.115) (-552.445) -- 0:00:36
409500 -- (-549.702) (-550.921) (-550.720) [-549.378] * (-552.090) [-549.811] (-551.253) (-549.989) -- 0:00:36
410000 -- (-552.341) (-550.206) [-553.074] (-550.601) * [-554.770] (-555.091) (-549.294) (-549.674) -- 0:00:35
Average standard deviation of split frequencies: 0.010196
410500 -- (-552.884) (-551.073) [-549.097] (-550.653) * (-557.756) (-552.711) [-550.425] (-551.913) -- 0:00:35
411000 -- (-550.843) [-552.715] (-550.266) (-552.133) * (-551.138) (-551.387) [-550.634] (-549.992) -- 0:00:35
411500 -- (-550.545) [-551.397] (-550.431) (-554.217) * (-555.501) (-549.984) (-553.613) [-549.956] -- 0:00:35
412000 -- [-552.569] (-552.122) (-550.179) (-550.229) * (-556.203) (-550.153) [-550.934] (-551.315) -- 0:00:35
412500 -- (-553.676) (-552.060) [-552.406] (-551.770) * (-554.001) (-552.486) (-553.037) [-551.400] -- 0:00:35
413000 -- (-554.397) [-552.738] (-552.031) (-552.901) * (-550.443) [-549.806] (-551.743) (-549.723) -- 0:00:35
413500 -- (-552.215) [-552.310] (-553.423) (-550.990) * (-553.049) (-549.773) (-552.341) [-549.998] -- 0:00:35
414000 -- [-551.172] (-549.264) (-550.982) (-551.382) * (-550.671) [-549.680] (-551.158) (-555.531) -- 0:00:35
414500 -- (-551.252) (-552.343) [-551.004] (-552.734) * (-553.065) [-550.683] (-550.541) (-551.465) -- 0:00:35
415000 -- (-551.865) (-551.270) (-554.498) [-553.371] * (-549.964) [-549.797] (-553.241) (-550.510) -- 0:00:35
Average standard deviation of split frequencies: 0.010891
415500 -- (-556.252) (-549.677) (-551.914) [-552.590] * [-550.378] (-551.137) (-551.077) (-550.031) -- 0:00:35
416000 -- (-552.038) (-551.512) (-550.416) [-555.375] * (-553.401) [-553.984] (-552.326) (-552.617) -- 0:00:35
416500 -- [-551.276] (-550.225) (-551.483) (-552.560) * (-550.297) (-556.548) [-550.688] (-550.011) -- 0:00:35
417000 -- (-552.620) (-556.382) (-552.024) [-551.560] * (-551.060) [-551.131] (-553.370) (-549.428) -- 0:00:34
417500 -- (-556.245) (-550.038) [-550.890] (-552.957) * (-550.756) [-556.038] (-550.915) (-551.150) -- 0:00:34
418000 -- [-552.897] (-550.460) (-551.818) (-551.184) * (-552.108) (-551.254) [-552.816] (-552.515) -- 0:00:34
418500 -- [-555.206] (-552.192) (-549.865) (-551.957) * (-551.656) (-552.229) [-552.476] (-556.914) -- 0:00:34
419000 -- (-552.286) [-551.119] (-552.988) (-550.755) * (-550.272) [-550.472] (-552.900) (-551.685) -- 0:00:34
419500 -- (-551.561) (-552.505) [-552.580] (-549.530) * (-552.696) (-550.572) [-552.823] (-552.996) -- 0:00:34
420000 -- (-550.320) [-552.410] (-549.719) (-549.569) * [-551.673] (-550.248) (-557.378) (-555.252) -- 0:00:35
Average standard deviation of split frequencies: 0.010283
420500 -- (-551.497) (-550.288) [-552.360] (-552.489) * [-552.645] (-553.612) (-551.188) (-551.391) -- 0:00:35
421000 -- (-551.365) (-553.077) (-551.295) [-552.473] * (-550.739) (-553.719) [-550.687] (-552.350) -- 0:00:35
421500 -- (-552.624) [-551.279] (-551.285) (-554.091) * (-552.721) [-550.215] (-550.440) (-556.529) -- 0:00:35
422000 -- (-552.749) (-551.533) (-552.092) [-550.525] * (-552.447) (-552.437) (-553.572) [-555.806] -- 0:00:35
422500 -- [-553.089] (-551.341) (-549.736) (-552.957) * (-550.701) (-554.930) (-553.126) [-551.191] -- 0:00:35
423000 -- [-550.724] (-551.399) (-551.186) (-550.061) * (-551.735) [-551.278] (-552.974) (-553.437) -- 0:00:35
423500 -- (-551.874) (-550.438) [-549.245] (-550.884) * (-553.036) (-550.263) (-553.738) [-550.345] -- 0:00:35
424000 -- [-551.021] (-550.769) (-558.533) (-552.289) * (-553.285) (-550.693) [-550.274] (-553.530) -- 0:00:35
424500 -- [-550.283] (-555.122) (-552.616) (-553.751) * (-552.240) [-550.464] (-554.716) (-551.403) -- 0:00:35
425000 -- (-555.896) [-550.172] (-549.297) (-551.078) * (-553.508) (-553.255) [-549.838] (-557.318) -- 0:00:35
Average standard deviation of split frequencies: 0.010740
425500 -- (-556.906) (-550.301) [-549.725] (-551.096) * (-555.527) (-551.181) [-557.030] (-554.197) -- 0:00:35
426000 -- [-551.872] (-552.845) (-550.531) (-552.920) * (-553.437) (-550.783) (-550.984) [-550.785] -- 0:00:35
426500 -- (-553.456) [-551.410] (-549.827) (-550.704) * (-555.214) [-550.015] (-551.124) (-553.461) -- 0:00:34
427000 -- (-551.835) (-552.958) [-551.695] (-551.463) * (-552.132) (-554.433) [-549.802] (-550.954) -- 0:00:34
427500 -- [-549.512] (-552.914) (-550.370) (-549.863) * (-551.703) (-550.281) [-552.601] (-550.332) -- 0:00:34
428000 -- [-552.266] (-552.579) (-550.467) (-552.518) * (-550.831) (-551.441) (-558.521) [-551.652] -- 0:00:34
428500 -- (-551.337) (-551.527) [-554.174] (-557.791) * [-550.527] (-553.347) (-553.400) (-553.283) -- 0:00:34
429000 -- (-550.593) (-551.382) [-552.068] (-552.972) * (-550.000) [-551.904] (-552.831) (-553.163) -- 0:00:34
429500 -- (-549.974) (-555.221) (-552.262) [-551.901] * [-550.728] (-553.770) (-551.241) (-549.661) -- 0:00:34
430000 -- (-551.310) (-555.031) (-554.098) [-551.598] * (-554.349) (-555.518) (-552.470) [-550.446] -- 0:00:34
Average standard deviation of split frequencies: 0.009973
430500 -- (-551.210) (-551.965) (-552.275) [-549.798] * (-554.017) (-552.942) (-549.815) [-550.814] -- 0:00:34
431000 -- (-552.388) (-550.721) (-550.880) [-551.618] * (-550.146) [-549.935] (-549.857) (-555.158) -- 0:00:34
431500 -- [-551.338] (-551.234) (-550.860) (-549.496) * [-552.283] (-549.921) (-549.443) (-551.415) -- 0:00:34
432000 -- (-551.687) (-554.178) (-551.333) [-552.069] * (-554.745) (-550.772) (-550.024) [-553.451] -- 0:00:34
432500 -- (-551.788) [-554.135] (-552.932) (-551.259) * (-551.086) [-552.512] (-551.413) (-552.804) -- 0:00:34
433000 -- [-550.408] (-553.916) (-551.533) (-551.197) * (-550.151) (-553.634) (-553.126) [-552.076] -- 0:00:34
433500 -- [-551.156] (-552.086) (-551.024) (-553.313) * [-551.198] (-550.142) (-551.891) (-551.153) -- 0:00:33
434000 -- (-551.313) (-549.410) [-549.728] (-554.013) * [-551.193] (-551.190) (-550.075) (-555.458) -- 0:00:33
434500 -- (-550.168) [-549.916] (-551.729) (-554.304) * [-550.349] (-554.734) (-549.960) (-551.118) -- 0:00:33
435000 -- (-552.072) (-554.272) (-557.120) [-552.557] * [-549.714] (-553.515) (-550.641) (-552.956) -- 0:00:33
Average standard deviation of split frequencies: 0.009794
435500 -- (-553.792) [-553.473] (-549.752) (-552.710) * [-554.045] (-549.834) (-550.367) (-549.869) -- 0:00:33
436000 -- (-552.209) [-553.227] (-551.131) (-558.647) * (-549.507) (-549.318) (-550.896) [-551.432] -- 0:00:33
436500 -- (-556.927) (-549.548) [-553.424] (-552.837) * (-549.622) (-553.165) [-549.785] (-552.059) -- 0:00:33
437000 -- (-552.407) [-549.550] (-551.679) (-549.677) * (-551.191) (-549.603) (-550.303) [-552.390] -- 0:00:34
437500 -- (-552.776) [-550.713] (-553.091) (-552.865) * [-550.645] (-550.642) (-552.385) (-551.849) -- 0:00:34
438000 -- [-549.779] (-551.921) (-550.168) (-554.357) * (-555.789) (-550.914) [-555.913] (-550.716) -- 0:00:34
438500 -- [-549.558] (-553.758) (-550.841) (-550.009) * (-550.586) (-549.865) (-550.702) [-552.148] -- 0:00:34
439000 -- [-551.701] (-549.520) (-551.055) (-551.438) * (-550.854) (-549.516) [-551.283] (-549.274) -- 0:00:34
439500 -- (-552.870) (-550.369) (-554.867) [-555.963] * (-553.233) (-550.906) (-554.243) [-550.685] -- 0:00:34
440000 -- (-549.378) (-552.183) [-550.521] (-552.978) * (-551.541) (-550.651) [-552.982] (-550.067) -- 0:00:34
Average standard deviation of split frequencies: 0.010131
440500 -- (-551.189) (-550.704) [-551.491] (-553.177) * (-551.205) (-553.461) [-551.558] (-550.351) -- 0:00:34
441000 -- [-551.202] (-556.618) (-549.991) (-552.462) * (-550.301) (-552.465) (-551.510) [-553.251] -- 0:00:34
441500 -- (-550.869) (-552.412) [-553.131] (-551.321) * (-551.598) [-552.445] (-550.200) (-549.578) -- 0:00:34
442000 -- (-550.754) (-552.512) (-552.090) [-549.564] * (-550.613) [-551.287] (-551.332) (-552.479) -- 0:00:34
442500 -- [-550.677] (-554.717) (-551.545) (-551.487) * (-550.079) (-549.644) [-550.713] (-550.834) -- 0:00:34
443000 -- (-552.579) (-554.918) (-554.454) [-551.496] * [-550.298] (-551.443) (-550.324) (-550.123) -- 0:00:33
443500 -- [-551.290] (-551.987) (-554.474) (-554.791) * (-550.334) (-549.631) [-550.064] (-550.826) -- 0:00:33
444000 -- (-552.481) [-552.984] (-552.836) (-551.124) * (-552.946) (-550.845) [-551.611] (-550.410) -- 0:00:33
444500 -- (-552.079) (-551.607) [-551.148] (-553.876) * (-551.413) [-549.677] (-550.852) (-552.449) -- 0:00:33
445000 -- (-551.058) (-552.459) [-550.010] (-552.091) * (-550.249) (-551.112) [-552.424] (-550.938) -- 0:00:33
Average standard deviation of split frequencies: 0.010134
445500 -- (-555.678) (-550.893) (-551.867) [-551.692] * [-553.465] (-550.812) (-549.806) (-549.789) -- 0:00:33
446000 -- (-554.032) (-550.878) (-550.694) [-550.811] * (-549.401) (-551.324) (-551.988) [-553.651] -- 0:00:33
446500 -- (-550.705) [-552.011] (-551.710) (-552.176) * (-551.430) [-553.084] (-557.566) (-551.853) -- 0:00:33
447000 -- [-549.277] (-549.948) (-550.812) (-551.508) * (-553.245) (-552.110) (-557.225) [-550.098] -- 0:00:33
447500 -- (-552.198) [-551.289] (-557.760) (-552.446) * (-555.888) (-549.836) [-553.339] (-550.561) -- 0:00:33
448000 -- [-553.276] (-550.854) (-556.536) (-549.223) * (-554.597) [-550.150] (-550.928) (-552.421) -- 0:00:33
448500 -- (-554.633) (-554.432) (-557.137) [-552.256] * (-553.700) (-549.704) (-554.076) [-555.212] -- 0:00:33
449000 -- [-550.657] (-552.284) (-553.160) (-552.171) * (-558.171) (-555.233) [-551.813] (-551.394) -- 0:00:33
449500 -- (-553.350) (-550.051) [-554.028] (-550.927) * (-556.125) (-554.351) [-549.898] (-549.804) -- 0:00:33
450000 -- [-550.707] (-550.974) (-552.688) (-552.208) * (-552.570) (-554.449) (-553.514) [-552.952] -- 0:00:33
Average standard deviation of split frequencies: 0.010091
450500 -- (-556.156) (-549.996) [-549.875] (-554.561) * [-553.232] (-549.620) (-554.510) (-550.359) -- 0:00:32
451000 -- (-550.350) [-552.496] (-553.067) (-550.697) * (-551.488) (-553.114) (-552.045) [-552.186] -- 0:00:32
451500 -- (-552.299) [-551.595] (-550.356) (-551.964) * (-553.552) (-551.943) [-550.732] (-551.255) -- 0:00:32
452000 -- (-549.621) [-551.393] (-555.015) (-551.722) * (-553.276) [-555.607] (-549.227) (-551.415) -- 0:00:32
452500 -- [-551.908] (-550.035) (-550.046) (-551.093) * (-550.866) (-552.269) [-549.845] (-550.296) -- 0:00:32
453000 -- (-551.088) (-553.086) (-553.062) [-551.133] * (-553.740) (-553.301) [-549.949] (-550.744) -- 0:00:32
453500 -- [-550.753] (-553.820) (-550.285) (-551.892) * [-552.673] (-549.801) (-553.010) (-553.620) -- 0:00:32
454000 -- [-551.452] (-550.780) (-551.824) (-552.366) * (-553.808) (-551.444) [-551.503] (-554.873) -- 0:00:33
454500 -- (-549.757) (-557.845) [-551.407] (-553.489) * [-550.449] (-560.798) (-555.825) (-554.136) -- 0:00:33
455000 -- (-558.621) (-553.099) (-550.348) [-553.440] * (-550.122) [-552.656] (-552.733) (-552.161) -- 0:00:33
Average standard deviation of split frequencies: 0.009886
455500 -- (-552.451) (-549.735) [-551.305] (-550.859) * (-553.591) (-551.381) (-551.507) [-550.910] -- 0:00:33
456000 -- (-559.798) (-551.168) (-549.344) [-549.330] * (-550.945) [-549.335] (-550.764) (-551.541) -- 0:00:33
456500 -- (-552.141) (-555.459) (-555.081) [-550.663] * [-550.101] (-553.540) (-551.192) (-555.196) -- 0:00:33
457000 -- (-552.947) (-551.328) [-551.702] (-551.061) * (-550.612) (-553.372) [-551.824] (-551.008) -- 0:00:33
457500 -- (-553.088) (-552.738) (-550.880) [-550.168] * (-550.981) (-551.542) (-549.715) [-550.249] -- 0:00:33
458000 -- (-557.623) [-551.285] (-552.274) (-552.249) * (-558.014) [-551.061] (-552.427) (-549.376) -- 0:00:33
458500 -- (-550.914) (-550.297) (-553.686) [-551.793] * (-554.210) (-551.271) [-550.017] (-551.847) -- 0:00:33
459000 -- (-552.575) [-551.124] (-552.180) (-551.446) * (-551.881) [-551.951] (-551.803) (-550.403) -- 0:00:33
459500 -- (-556.451) (-554.213) [-551.029] (-552.736) * [-552.851] (-549.195) (-550.131) (-560.658) -- 0:00:32
460000 -- (-554.612) (-550.566) (-551.129) [-552.281] * [-551.530] (-551.256) (-551.363) (-552.224) -- 0:00:32
Average standard deviation of split frequencies: 0.009466
460500 -- (-552.574) [-552.437] (-549.699) (-553.842) * (-552.970) (-550.308) [-551.556] (-551.297) -- 0:00:32
461000 -- (-552.796) (-550.524) (-551.330) [-549.582] * (-550.706) [-549.538] (-554.541) (-549.484) -- 0:00:32
461500 -- (-553.251) (-551.799) (-551.571) [-549.693] * (-549.984) (-551.524) (-556.172) [-551.902] -- 0:00:32
462000 -- [-551.123] (-552.061) (-551.808) (-550.634) * [-551.472] (-550.684) (-550.797) (-549.799) -- 0:00:32
462500 -- [-550.573] (-558.491) (-552.751) (-549.487) * (-552.296) (-551.326) [-551.721] (-551.692) -- 0:00:32
463000 -- (-552.696) (-551.604) (-552.431) [-552.514] * (-551.817) (-553.260) [-554.710] (-549.594) -- 0:00:32
463500 -- (-550.733) (-552.159) [-553.874] (-552.202) * [-550.539] (-551.767) (-550.699) (-552.068) -- 0:00:32
464000 -- (-549.974) [-549.837] (-552.613) (-550.239) * (-550.326) (-555.682) (-550.436) [-551.365] -- 0:00:32
464500 -- (-550.579) [-551.598] (-550.739) (-549.606) * (-551.782) [-551.732] (-550.469) (-550.602) -- 0:00:32
465000 -- (-552.576) (-551.848) (-552.405) [-550.022] * (-551.293) (-551.905) (-551.312) [-552.534] -- 0:00:32
Average standard deviation of split frequencies: 0.009231
465500 -- (-555.149) (-552.047) [-549.953] (-553.286) * [-551.477] (-554.953) (-553.248) (-551.660) -- 0:00:32
466000 -- [-550.173] (-553.958) (-550.332) (-551.316) * (-552.499) [-551.835] (-551.721) (-551.609) -- 0:00:32
466500 -- (-550.115) [-550.908] (-550.440) (-551.007) * (-549.494) (-555.703) (-551.359) [-552.039] -- 0:00:32
467000 -- [-550.634] (-549.789) (-551.356) (-550.801) * [-552.877] (-551.493) (-551.428) (-551.990) -- 0:00:31
467500 -- [-551.177] (-553.070) (-550.671) (-549.406) * (-553.770) [-551.657] (-552.786) (-553.375) -- 0:00:31
468000 -- (-553.141) (-552.959) (-550.904) [-551.938] * (-549.466) (-556.320) (-550.138) [-553.674] -- 0:00:31
468500 -- (-551.328) (-552.261) (-551.228) [-554.642] * [-554.583] (-551.306) (-550.418) (-552.678) -- 0:00:31
469000 -- (-550.608) (-553.640) [-551.314] (-552.990) * (-550.295) (-552.651) (-554.102) [-549.755] -- 0:00:31
469500 -- (-551.008) (-550.780) [-550.746] (-554.674) * (-551.895) (-551.654) [-550.517] (-551.991) -- 0:00:31
470000 -- (-553.326) (-552.384) [-552.621] (-553.967) * (-554.648) (-554.497) [-550.413] (-555.398) -- 0:00:31
Average standard deviation of split frequencies: 0.008764
470500 -- (-555.720) (-556.375) (-551.364) [-552.579] * [-549.525] (-552.051) (-551.198) (-552.939) -- 0:00:32
471000 -- (-554.336) [-551.232] (-551.162) (-552.295) * (-551.754) (-552.821) [-555.357] (-551.676) -- 0:00:32
471500 -- (-550.766) (-550.640) [-551.307] (-551.249) * [-549.444] (-551.928) (-551.349) (-551.392) -- 0:00:32
472000 -- (-550.170) (-550.370) [-551.842] (-549.316) * [-553.127] (-550.504) (-555.744) (-549.764) -- 0:00:32
472500 -- [-549.346] (-554.218) (-550.126) (-549.482) * (-550.734) (-550.802) (-551.751) [-550.173] -- 0:00:32
473000 -- (-551.697) [-550.968] (-550.180) (-550.051) * [-551.076] (-550.733) (-552.441) (-550.705) -- 0:00:32
473500 -- [-551.336] (-549.747) (-551.574) (-549.843) * (-553.414) (-554.129) (-552.022) [-550.583] -- 0:00:32
474000 -- (-551.107) (-550.653) [-552.430] (-550.102) * (-551.826) [-554.056] (-552.388) (-550.487) -- 0:00:32
474500 -- (-553.538) (-555.794) [-551.048] (-549.498) * (-554.069) (-549.702) (-554.368) [-549.956] -- 0:00:32
475000 -- [-551.529] (-556.208) (-551.861) (-550.132) * [-554.513] (-551.313) (-551.288) (-551.410) -- 0:00:32
Average standard deviation of split frequencies: 0.007861
475500 -- (-551.246) (-550.649) (-550.442) [-550.378] * (-550.649) (-555.111) [-553.772] (-549.886) -- 0:00:31
476000 -- (-550.417) [-554.106] (-552.333) (-551.730) * [-549.850] (-555.285) (-550.039) (-552.740) -- 0:00:31
476500 -- (-550.042) (-560.258) (-552.157) [-550.411] * (-549.783) (-550.879) (-550.258) [-551.788] -- 0:00:31
477000 -- [-549.437] (-550.023) (-551.916) (-549.864) * (-550.129) [-552.425] (-553.240) (-550.179) -- 0:00:31
477500 -- (-551.730) (-553.907) [-553.069] (-550.440) * (-553.187) (-550.929) (-550.677) [-552.912] -- 0:00:31
478000 -- (-553.589) (-552.842) (-554.675) [-550.206] * (-553.246) [-550.628] (-551.196) (-557.991) -- 0:00:31
478500 -- (-552.132) (-557.420) (-553.095) [-551.971] * (-551.996) [-551.445] (-553.406) (-553.822) -- 0:00:31
479000 -- [-550.886] (-556.303) (-556.300) (-549.971) * (-553.209) (-551.950) (-550.450) [-552.994] -- 0:00:31
479500 -- (-552.687) (-552.387) (-551.238) [-549.979] * (-550.665) [-552.067] (-551.023) (-551.568) -- 0:00:31
480000 -- (-552.217) (-550.748) (-551.620) [-550.262] * (-552.745) (-553.170) [-552.253] (-553.194) -- 0:00:31
Average standard deviation of split frequencies: 0.008275
480500 -- (-552.078) (-554.527) [-550.341] (-555.774) * (-549.916) [-550.181] (-551.759) (-555.452) -- 0:00:31
481000 -- (-550.094) (-555.028) (-551.952) [-553.637] * [-550.245] (-552.573) (-553.520) (-551.205) -- 0:00:31
481500 -- [-550.060] (-555.917) (-552.857) (-552.228) * (-550.196) (-550.590) [-550.758] (-550.801) -- 0:00:31
482000 -- (-550.071) (-557.189) (-550.187) [-555.454] * (-551.327) (-551.754) [-552.502] (-552.299) -- 0:00:31
482500 -- (-553.375) (-550.387) (-549.337) [-550.584] * (-550.633) (-550.335) (-552.346) [-551.468] -- 0:00:31
483000 -- (-552.733) (-550.752) (-549.790) [-550.997] * (-550.230) (-550.394) (-550.457) [-552.030] -- 0:00:31
483500 -- (-549.729) (-550.528) [-550.955] (-549.686) * [-550.337] (-550.323) (-550.781) (-550.412) -- 0:00:30
484000 -- [-549.673] (-554.358) (-550.354) (-551.753) * (-549.831) (-552.104) [-554.547] (-554.818) -- 0:00:30
484500 -- [-550.624] (-551.163) (-549.477) (-550.522) * (-552.235) [-551.104] (-554.144) (-552.930) -- 0:00:30
485000 -- [-552.267] (-552.605) (-551.950) (-552.374) * (-554.873) (-549.832) [-550.902] (-550.019) -- 0:00:30
Average standard deviation of split frequencies: 0.008487
485500 -- (-552.163) (-557.564) [-551.365] (-553.200) * [-553.430] (-552.232) (-553.096) (-558.857) -- 0:00:30
486000 -- (-553.485) (-554.088) [-550.216] (-553.169) * (-550.884) (-552.792) (-550.998) [-550.245] -- 0:00:30
486500 -- (-551.503) (-552.961) [-551.208] (-550.817) * (-550.778) (-552.119) (-551.695) [-552.413] -- 0:00:30
487000 -- (-550.460) (-551.667) [-553.387] (-549.676) * (-550.537) (-554.386) (-557.356) [-552.592] -- 0:00:30
487500 -- [-554.021] (-551.040) (-550.310) (-551.207) * (-550.803) (-551.782) (-555.287) [-552.466] -- 0:00:31
488000 -- (-554.563) [-550.224] (-554.837) (-553.640) * (-550.275) (-551.089) [-552.793] (-554.537) -- 0:00:31
488500 -- (-554.470) [-550.652] (-551.708) (-555.945) * [-551.603] (-551.927) (-555.607) (-550.416) -- 0:00:31
489000 -- [-551.405] (-551.599) (-550.579) (-550.269) * (-550.773) (-551.824) [-556.623] (-552.432) -- 0:00:31
489500 -- (-549.740) (-551.378) [-549.896] (-552.352) * (-550.469) [-551.151] (-552.538) (-553.241) -- 0:00:31
490000 -- (-549.540) [-550.346] (-550.976) (-553.036) * [-550.981] (-549.832) (-556.773) (-550.520) -- 0:00:31
Average standard deviation of split frequencies: 0.008707
490500 -- (-550.698) (-552.032) [-551.503] (-551.346) * (-549.857) (-551.331) (-554.670) [-550.523] -- 0:00:31
491000 -- (-551.269) (-550.410) [-552.405] (-550.234) * (-549.904) (-551.426) [-550.316] (-551.301) -- 0:00:31
491500 -- [-550.701] (-551.182) (-549.990) (-551.455) * (-552.205) [-549.758] (-551.658) (-551.189) -- 0:00:31
492000 -- [-552.323] (-550.282) (-553.115) (-552.309) * (-552.623) [-560.259] (-551.053) (-553.714) -- 0:00:30
492500 -- [-553.338] (-549.366) (-555.504) (-550.886) * (-551.303) (-552.339) [-549.162] (-552.173) -- 0:00:30
493000 -- (-551.190) (-549.934) (-553.521) [-554.725] * [-551.591] (-551.791) (-554.147) (-552.480) -- 0:00:30
493500 -- [-550.459] (-553.073) (-553.809) (-549.815) * (-554.855) [-554.008] (-553.042) (-552.757) -- 0:00:30
494000 -- (-554.135) (-555.252) (-552.414) [-550.504] * (-554.872) (-552.437) [-551.194] (-554.159) -- 0:00:30
494500 -- (-552.014) (-551.888) (-551.916) [-550.846] * (-555.193) (-551.178) (-551.489) [-552.036] -- 0:00:30
495000 -- (-550.753) [-551.632] (-550.124) (-552.308) * [-555.103] (-552.100) (-552.311) (-552.331) -- 0:00:30
Average standard deviation of split frequencies: 0.009314
495500 -- (-550.934) (-550.793) (-551.183) [-552.039] * [-555.413] (-550.241) (-555.577) (-551.539) -- 0:00:30
496000 -- [-550.285] (-549.503) (-550.641) (-558.217) * (-552.937) (-550.591) [-551.969] (-552.061) -- 0:00:30
496500 -- (-550.767) (-552.300) (-551.066) [-552.265] * (-550.710) (-549.652) (-550.887) [-550.268] -- 0:00:30
497000 -- (-549.926) (-552.571) (-550.310) [-552.458] * [-551.645] (-551.425) (-550.693) (-550.312) -- 0:00:30
497500 -- (-550.050) (-551.564) [-550.058] (-551.849) * (-553.567) (-551.611) [-550.638] (-551.744) -- 0:00:30
498000 -- (-550.963) (-554.572) (-550.825) [-553.243] * (-549.892) [-553.917] (-549.769) (-553.733) -- 0:00:30
498500 -- (-554.573) [-551.632] (-553.357) (-551.208) * (-551.078) (-555.316) (-554.431) [-551.847] -- 0:00:30
499000 -- [-554.843] (-551.853) (-549.715) (-553.396) * [-550.284] (-550.408) (-552.967) (-551.757) -- 0:00:30
499500 -- (-556.045) (-551.058) [-552.644] (-552.136) * (-551.771) (-553.124) (-549.411) [-552.863] -- 0:00:30
500000 -- (-551.255) (-550.383) (-550.879) [-552.181] * (-551.115) (-551.157) (-551.694) [-549.586] -- 0:00:30
Average standard deviation of split frequencies: 0.010169
500500 -- (-551.894) (-550.161) (-550.309) [-549.515] * (-550.729) [-549.341] (-551.867) (-549.924) -- 0:00:29
501000 -- (-550.595) [-550.749] (-550.360) (-549.798) * (-550.930) [-551.542] (-550.326) (-551.254) -- 0:00:29
501500 -- (-549.565) (-549.974) (-551.149) [-551.152] * (-550.236) (-550.880) (-550.796) [-550.060] -- 0:00:29
502000 -- (-558.243) (-551.119) [-550.875] (-554.616) * (-553.945) (-551.215) (-551.738) [-549.742] -- 0:00:29
502500 -- [-551.367] (-551.439) (-553.409) (-553.771) * (-553.008) (-551.242) (-552.546) [-550.614] -- 0:00:29
503000 -- (-550.850) (-554.326) (-552.017) [-552.260] * (-552.740) [-552.769] (-551.012) (-550.509) -- 0:00:29
503500 -- (-552.448) (-558.692) (-550.771) [-551.187] * (-556.464) [-549.869] (-555.940) (-555.790) -- 0:00:30
504000 -- [-551.716] (-554.036) (-552.694) (-550.055) * [-555.836] (-553.490) (-552.332) (-553.830) -- 0:00:30
504500 -- (-553.944) [-550.824] (-551.372) (-550.355) * (-550.284) [-551.019] (-552.188) (-553.846) -- 0:00:30
505000 -- [-552.616] (-554.969) (-551.141) (-552.918) * [-554.517] (-554.011) (-553.925) (-555.507) -- 0:00:30
Average standard deviation of split frequencies: 0.010190
505500 -- (-552.675) (-555.463) [-549.839] (-554.055) * (-551.497) (-550.204) [-549.698] (-553.912) -- 0:00:30
506000 -- (-549.448) (-555.961) (-550.155) [-551.433] * [-553.607] (-549.579) (-551.332) (-554.253) -- 0:00:30
506500 -- [-550.905] (-551.916) (-550.477) (-552.522) * (-549.759) (-553.510) (-552.124) [-551.930] -- 0:00:30
507000 -- (-556.279) [-554.709] (-550.805) (-551.550) * (-550.208) [-551.889] (-550.915) (-551.025) -- 0:00:30
507500 -- (-551.613) [-554.378] (-551.828) (-554.476) * (-552.862) [-552.315] (-557.138) (-556.742) -- 0:00:30
508000 -- [-550.418] (-551.492) (-551.189) (-550.463) * (-550.713) (-551.879) [-551.960] (-560.542) -- 0:00:30
508500 -- (-553.359) (-550.179) (-554.027) [-554.442] * (-553.759) [-549.788] (-550.846) (-554.023) -- 0:00:29
509000 -- (-549.512) [-550.191] (-551.268) (-554.849) * (-550.143) (-550.183) [-550.518] (-550.085) -- 0:00:29
509500 -- (-550.868) (-550.533) (-550.406) [-553.784] * [-552.192] (-550.706) (-551.804) (-552.253) -- 0:00:29
510000 -- (-553.219) (-551.877) [-550.093] (-551.051) * (-551.039) [-550.703] (-550.597) (-550.939) -- 0:00:29
Average standard deviation of split frequencies: 0.010847
510500 -- (-553.261) [-554.526] (-554.720) (-550.188) * (-550.549) (-552.929) (-549.915) [-552.039] -- 0:00:29
511000 -- (-551.002) (-558.996) [-549.823] (-553.906) * (-550.350) [-550.316] (-551.645) (-551.857) -- 0:00:29
511500 -- (-551.709) (-551.019) [-550.668] (-553.199) * (-553.879) (-552.074) (-549.766) [-549.611] -- 0:00:29
512000 -- (-550.975) (-552.931) (-549.801) [-552.060] * (-555.373) (-551.462) (-549.578) [-555.338] -- 0:00:29
512500 -- [-552.069] (-553.637) (-555.303) (-552.078) * [-550.815] (-551.294) (-550.203) (-551.376) -- 0:00:29
513000 -- [-554.018] (-553.057) (-559.773) (-557.111) * (-552.864) (-551.502) (-550.526) [-550.530] -- 0:00:29
513500 -- (-551.667) [-550.464] (-556.413) (-549.647) * (-551.476) (-550.815) [-549.697] (-551.173) -- 0:00:29
514000 -- (-552.654) [-549.661] (-552.771) (-552.559) * (-551.459) [-551.772] (-551.206) (-553.077) -- 0:00:29
514500 -- [-552.305] (-551.037) (-550.565) (-551.739) * (-554.387) (-553.137) [-551.508] (-551.809) -- 0:00:29
515000 -- (-550.873) [-550.181] (-550.398) (-550.736) * (-556.229) (-555.487) [-550.295] (-551.993) -- 0:00:29
Average standard deviation of split frequencies: 0.010909
515500 -- (-550.286) [-550.954] (-552.114) (-556.425) * (-552.205) (-554.626) (-552.652) [-551.661] -- 0:00:29
516000 -- [-550.397] (-549.538) (-549.598) (-553.974) * (-551.163) (-549.971) (-554.462) [-551.932] -- 0:00:29
516500 -- (-552.000) (-551.617) (-551.074) [-549.967] * (-551.472) (-551.163) (-553.049) [-553.431] -- 0:00:29
517000 -- [-550.174] (-550.603) (-551.730) (-550.316) * (-551.862) (-552.188) [-551.253] (-550.057) -- 0:00:28
517500 -- (-552.426) [-549.439] (-551.585) (-552.543) * (-553.869) (-550.742) (-549.438) [-552.755] -- 0:00:28
518000 -- (-550.937) [-550.323] (-550.169) (-554.618) * (-551.868) [-550.739] (-549.475) (-550.669) -- 0:00:28
518500 -- (-550.366) [-551.784] (-551.004) (-552.673) * (-554.133) (-553.553) (-553.677) [-552.190] -- 0:00:28
519000 -- (-553.355) [-552.162] (-551.455) (-550.244) * (-551.921) (-551.785) [-552.072] (-551.880) -- 0:00:28
519500 -- [-553.663] (-550.421) (-555.092) (-553.096) * (-551.549) (-555.173) (-549.500) [-553.761] -- 0:00:28
520000 -- (-549.905) (-554.862) [-551.874] (-551.850) * (-554.142) [-553.027] (-549.971) (-551.488) -- 0:00:29
Average standard deviation of split frequencies: 0.011431
520500 -- [-554.070] (-551.961) (-554.434) (-549.642) * (-550.498) [-552.155] (-551.360) (-549.694) -- 0:00:29
521000 -- (-553.741) (-549.439) (-550.919) [-550.699] * (-551.892) [-550.461] (-554.559) (-549.940) -- 0:00:29
521500 -- (-549.584) (-551.607) [-550.436] (-549.948) * (-552.650) (-549.475) [-554.848] (-560.046) -- 0:00:29
522000 -- (-553.691) (-550.361) [-551.402] (-551.798) * (-552.923) (-550.384) (-552.537) [-550.363] -- 0:00:29
522500 -- [-552.937] (-551.369) (-550.728) (-550.353) * (-550.753) (-550.228) (-552.372) [-550.119] -- 0:00:29
523000 -- (-552.598) (-551.764) (-554.067) [-550.261] * [-553.044] (-553.082) (-550.795) (-549.585) -- 0:00:29
523500 -- (-551.101) [-551.278] (-552.833) (-552.914) * [-550.689] (-551.758) (-553.690) (-552.129) -- 0:00:29
524000 -- [-550.603] (-553.407) (-557.780) (-552.384) * (-555.178) (-554.429) (-552.262) [-552.977] -- 0:00:29
524500 -- (-552.442) [-552.824] (-552.883) (-553.128) * (-554.940) (-550.794) (-551.574) [-552.348] -- 0:00:29
525000 -- (-554.055) (-550.271) (-553.589) [-551.457] * (-550.441) (-552.511) (-553.756) [-550.115] -- 0:00:28
Average standard deviation of split frequencies: 0.010491
525500 -- (-556.509) (-550.275) [-550.835] (-552.231) * (-553.414) (-552.208) [-551.020] (-550.283) -- 0:00:28
526000 -- (-553.834) (-550.782) [-551.957] (-552.284) * (-555.178) (-551.758) [-551.584] (-551.570) -- 0:00:28
526500 -- (-549.997) (-551.375) [-550.120] (-552.033) * (-550.696) (-549.444) [-550.301] (-553.438) -- 0:00:28
527000 -- (-550.237) (-552.608) (-551.602) [-551.164] * (-549.261) (-551.496) (-553.476) [-550.968] -- 0:00:28
527500 -- (-551.787) (-558.327) [-551.887] (-550.219) * (-549.910) (-551.431) (-554.964) [-551.791] -- 0:00:28
528000 -- (-550.145) (-560.476) [-550.371] (-549.923) * (-552.194) (-554.958) (-552.698) [-552.971] -- 0:00:28
528500 -- (-552.934) [-551.852] (-552.461) (-551.005) * (-551.946) (-556.063) (-551.641) [-551.433] -- 0:00:28
529000 -- [-551.868] (-562.045) (-551.515) (-549.297) * (-550.655) (-553.493) [-550.545] (-551.155) -- 0:00:28
529500 -- [-552.595] (-558.298) (-550.031) (-553.115) * (-551.911) [-551.677] (-552.204) (-549.894) -- 0:00:28
530000 -- (-550.902) (-552.075) (-551.523) [-551.400] * [-550.939] (-555.049) (-552.378) (-554.613) -- 0:00:28
Average standard deviation of split frequencies: 0.011160
530500 -- [-549.164] (-552.314) (-551.704) (-552.998) * [-550.939] (-553.512) (-551.113) (-550.026) -- 0:00:28
531000 -- [-552.973] (-553.701) (-551.228) (-552.320) * [-551.683] (-556.650) (-550.435) (-549.361) -- 0:00:28
531500 -- (-554.775) (-553.694) [-551.378] (-549.898) * (-549.932) (-557.465) [-552.336] (-552.260) -- 0:00:28
532000 -- (-552.654) (-550.450) (-551.792) [-549.688] * (-550.435) (-550.706) [-550.583] (-551.243) -- 0:00:28
532500 -- (-552.720) (-550.999) [-550.303] (-553.550) * [-550.801] (-551.409) (-553.441) (-551.677) -- 0:00:28
533000 -- (-550.269) (-550.787) [-550.620] (-552.594) * (-553.391) [-550.563] (-552.155) (-553.853) -- 0:00:28
533500 -- (-554.116) (-549.692) [-554.103] (-549.383) * (-556.117) [-549.504] (-553.228) (-551.868) -- 0:00:27
534000 -- (-551.488) (-550.986) (-554.340) [-549.876] * [-550.149] (-552.201) (-555.431) (-554.864) -- 0:00:27
534500 -- [-552.429] (-550.493) (-550.358) (-551.124) * [-552.153] (-557.281) (-552.417) (-551.517) -- 0:00:27
535000 -- (-554.665) [-552.382] (-552.216) (-551.092) * [-549.959] (-558.671) (-554.727) (-551.460) -- 0:00:27
Average standard deviation of split frequencies: 0.011123
535500 -- (-551.607) (-550.659) [-553.266] (-550.534) * [-551.714] (-557.167) (-551.279) (-552.266) -- 0:00:27
536000 -- (-552.659) (-552.996) [-555.361] (-550.276) * (-549.748) (-560.778) (-552.743) [-551.339] -- 0:00:28
536500 -- (-551.566) [-550.932] (-552.331) (-549.889) * (-550.119) [-550.192] (-552.297) (-554.466) -- 0:00:28
537000 -- (-552.898) [-550.812] (-552.726) (-549.561) * (-552.561) [-551.438] (-554.761) (-550.138) -- 0:00:28
537500 -- [-550.190] (-552.004) (-550.497) (-550.439) * [-552.292] (-552.174) (-551.404) (-549.901) -- 0:00:28
538000 -- (-554.019) (-551.596) (-552.334) [-552.391] * [-555.034] (-552.293) (-557.378) (-552.378) -- 0:00:28
538500 -- (-551.661) (-550.835) (-552.011) [-551.319] * [-552.384] (-552.465) (-550.378) (-549.358) -- 0:00:28
539000 -- (-551.090) [-550.290] (-551.833) (-550.257) * (-549.685) [-551.739] (-554.036) (-555.331) -- 0:00:28
539500 -- [-550.966] (-551.615) (-550.391) (-551.450) * [-554.597] (-551.057) (-552.066) (-552.805) -- 0:00:28
540000 -- [-550.557] (-551.608) (-549.558) (-552.341) * (-550.649) (-551.806) (-550.359) [-550.360] -- 0:00:28
Average standard deviation of split frequencies: 0.010517
540500 -- (-551.540) (-552.046) [-550.284] (-559.821) * (-553.413) [-553.168] (-552.896) (-553.952) -- 0:00:28
541000 -- (-552.362) (-549.366) (-551.672) [-560.197] * [-554.868] (-552.906) (-551.129) (-553.660) -- 0:00:27
541500 -- (-552.416) (-551.068) [-550.197] (-556.080) * (-550.208) (-555.901) [-550.542] (-551.362) -- 0:00:27
542000 -- (-550.667) (-549.809) [-550.729] (-553.404) * [-550.127] (-552.676) (-551.082) (-555.041) -- 0:00:27
542500 -- (-553.996) [-550.049] (-550.912) (-549.953) * (-551.632) (-552.843) (-552.489) [-549.557] -- 0:00:27
543000 -- (-550.691) (-552.247) (-553.125) [-549.646] * [-553.352] (-551.100) (-550.744) (-552.315) -- 0:00:27
543500 -- [-550.749] (-550.676) (-552.001) (-553.262) * (-552.335) (-554.525) [-553.060] (-551.576) -- 0:00:27
544000 -- [-549.932] (-551.015) (-554.283) (-551.294) * (-557.435) (-550.531) [-552.606] (-554.269) -- 0:00:27
544500 -- (-551.961) [-549.862] (-557.089) (-554.549) * (-551.526) [-550.588] (-553.221) (-552.539) -- 0:00:27
545000 -- (-553.084) (-554.579) [-552.640] (-555.936) * (-549.457) (-549.506) [-550.826] (-556.354) -- 0:00:27
Average standard deviation of split frequencies: 0.011122
545500 -- (-553.051) (-552.350) (-551.017) [-558.287] * (-551.973) (-551.302) (-550.368) [-551.929] -- 0:00:27
546000 -- [-549.895] (-550.834) (-550.713) (-550.895) * (-550.226) (-550.412) [-554.148] (-550.339) -- 0:00:27
546500 -- (-555.941) (-553.495) (-550.665) [-551.832] * (-549.858) (-553.071) [-553.037] (-554.089) -- 0:00:27
547000 -- (-553.419) (-551.743) (-550.081) [-554.717] * (-549.524) [-550.901] (-551.835) (-554.337) -- 0:00:27
547500 -- (-553.438) [-553.067] (-550.474) (-554.924) * (-551.439) [-550.789] (-551.313) (-554.356) -- 0:00:27
548000 -- (-552.775) (-553.093) [-550.343] (-550.653) * [-550.838] (-552.078) (-552.815) (-550.492) -- 0:00:27
548500 -- [-552.894] (-550.576) (-550.133) (-552.331) * (-550.928) [-551.620] (-551.807) (-551.616) -- 0:00:27
549000 -- (-552.806) (-549.967) (-551.356) [-551.692] * (-552.017) [-553.337] (-554.982) (-553.686) -- 0:00:27
549500 -- [-550.806] (-550.406) (-550.041) (-550.298) * (-552.135) (-553.349) (-551.411) [-549.892] -- 0:00:27
550000 -- [-551.992] (-551.016) (-553.764) (-549.382) * [-551.562] (-551.914) (-551.571) (-549.665) -- 0:00:27
Average standard deviation of split frequencies: 0.010166
550500 -- [-550.311] (-550.478) (-549.281) (-553.142) * (-553.791) [-550.670] (-551.626) (-551.122) -- 0:00:26
551000 -- (-556.244) (-552.130) (-552.458) [-554.108] * (-550.562) [-551.627] (-552.844) (-551.229) -- 0:00:26
551500 -- (-553.250) (-556.128) (-552.116) [-553.348] * (-552.215) (-553.107) (-553.530) [-550.983] -- 0:00:26
552000 -- (-550.827) [-551.285] (-550.675) (-553.125) * (-549.563) [-553.697] (-552.561) (-551.647) -- 0:00:26
552500 -- (-552.821) (-552.170) (-551.115) [-549.903] * [-550.500] (-551.406) (-553.295) (-550.666) -- 0:00:27
553000 -- (-551.106) (-552.333) (-552.834) [-551.966] * [-549.954] (-550.832) (-551.691) (-550.428) -- 0:00:27
553500 -- (-549.429) (-550.501) [-551.956] (-553.633) * (-551.492) (-550.055) (-553.399) [-550.500] -- 0:00:27
554000 -- (-553.455) (-553.936) (-557.425) [-554.700] * (-550.667) (-549.297) [-551.204] (-552.997) -- 0:00:27
554500 -- [-553.832] (-550.732) (-552.945) (-552.185) * (-551.702) (-552.994) (-551.064) [-551.141] -- 0:00:27
555000 -- (-552.846) [-550.921] (-551.444) (-551.404) * (-555.473) [-550.469] (-553.773) (-552.270) -- 0:00:27
Average standard deviation of split frequencies: 0.010231
555500 -- (-553.257) (-549.910) (-552.348) [-552.856] * (-551.544) [-549.603] (-555.748) (-555.851) -- 0:00:27
556000 -- (-555.105) (-553.233) [-550.395] (-550.810) * [-550.286] (-550.229) (-553.047) (-552.319) -- 0:00:27
556500 -- (-551.727) [-554.904] (-550.929) (-551.154) * (-551.700) [-549.537] (-551.779) (-552.933) -- 0:00:27
557000 -- (-554.734) (-550.434) (-552.281) [-551.053] * (-552.475) (-550.359) [-551.754] (-552.119) -- 0:00:27
557500 -- (-554.294) (-554.470) [-552.129] (-552.650) * [-552.277] (-550.578) (-552.451) (-552.094) -- 0:00:26
558000 -- (-551.870) (-552.120) (-554.210) [-549.399] * (-551.508) (-550.479) [-550.544] (-552.278) -- 0:00:26
558500 -- (-551.654) (-549.552) [-553.832] (-551.163) * [-554.943] (-550.179) (-550.295) (-551.236) -- 0:00:26
559000 -- [-551.094] (-553.775) (-549.965) (-551.630) * [-550.123] (-551.984) (-550.021) (-549.771) -- 0:00:26
559500 -- [-549.186] (-554.159) (-551.257) (-550.240) * (-552.401) (-550.565) (-554.074) [-550.919] -- 0:00:26
560000 -- (-549.389) (-551.548) (-550.801) [-550.078] * (-553.826) [-550.458] (-550.807) (-550.131) -- 0:00:26
Average standard deviation of split frequencies: 0.010146
560500 -- (-554.993) (-550.817) (-552.671) [-550.906] * [-552.350] (-553.753) (-550.085) (-550.815) -- 0:00:26
561000 -- (-556.482) [-551.666] (-554.173) (-549.555) * (-558.197) [-552.002] (-550.270) (-550.232) -- 0:00:26
561500 -- (-555.903) [-550.673] (-550.765) (-549.487) * (-554.001) (-552.800) [-551.022] (-555.120) -- 0:00:26
562000 -- (-553.757) (-551.134) (-551.072) [-550.669] * (-555.598) [-551.878] (-551.022) (-551.308) -- 0:00:26
562500 -- (-551.678) (-552.255) (-550.759) [-550.670] * (-552.088) [-552.346] (-549.863) (-552.008) -- 0:00:26
563000 -- (-552.185) (-549.783) (-555.206) [-550.459] * (-551.636) (-554.265) (-549.558) [-551.012] -- 0:00:26
563500 -- (-551.579) (-549.561) (-551.111) [-549.676] * [-552.165] (-550.081) (-551.551) (-551.008) -- 0:00:26
564000 -- (-550.579) (-549.913) [-549.311] (-549.741) * (-554.278) (-552.719) (-549.807) [-551.130] -- 0:00:26
564500 -- (-558.223) [-552.516] (-549.818) (-550.152) * (-551.559) (-554.020) (-552.016) [-552.223] -- 0:00:26
565000 -- (-553.381) [-549.808] (-549.738) (-549.760) * (-551.739) [-555.053] (-550.613) (-553.961) -- 0:00:26
Average standard deviation of split frequencies: 0.010307
565500 -- [-551.097] (-549.221) (-550.984) (-551.359) * (-553.014) (-550.100) [-551.589] (-552.729) -- 0:00:26
566000 -- (-550.326) [-550.307] (-551.694) (-552.413) * (-551.841) (-550.633) (-551.838) [-554.901] -- 0:00:26
566500 -- (-550.364) [-550.059] (-550.602) (-551.312) * (-549.165) (-554.162) (-553.507) [-551.696] -- 0:00:26
567000 -- (-549.740) [-549.840] (-550.737) (-552.951) * [-552.950] (-555.633) (-551.725) (-549.605) -- 0:00:25
567500 -- (-550.150) (-551.986) (-553.428) [-556.071] * (-552.906) [-553.612] (-550.071) (-552.249) -- 0:00:25
568000 -- (-551.017) (-552.029) [-552.317] (-554.184) * [-550.333] (-551.931) (-551.883) (-550.838) -- 0:00:25
568500 -- (-556.435) (-554.329) (-553.341) [-551.719] * (-551.660) [-550.851] (-552.801) (-555.012) -- 0:00:25
569000 -- [-554.011] (-556.857) (-553.925) (-551.832) * (-550.600) [-549.922] (-551.246) (-550.829) -- 0:00:25
569500 -- (-550.487) [-553.666] (-553.582) (-550.942) * (-553.839) [-550.535] (-549.516) (-553.816) -- 0:00:26
570000 -- (-557.629) (-551.458) [-552.618] (-553.132) * [-550.639] (-553.094) (-549.936) (-549.246) -- 0:00:26
Average standard deviation of split frequencies: 0.010188
570500 -- (-551.800) (-551.302) [-554.001] (-550.777) * (-552.385) [-550.560] (-554.377) (-550.262) -- 0:00:26
571000 -- (-551.312) (-553.954) [-551.948] (-551.714) * [-551.067] (-549.715) (-551.260) (-551.398) -- 0:00:26
571500 -- [-552.363] (-552.522) (-549.793) (-554.032) * [-552.582] (-551.873) (-552.269) (-550.386) -- 0:00:26
572000 -- (-553.232) [-550.634] (-552.461) (-553.851) * (-553.505) [-552.565] (-551.850) (-550.914) -- 0:00:26
572500 -- [-555.691] (-551.549) (-552.749) (-555.430) * (-554.507) [-553.112] (-549.976) (-551.839) -- 0:00:26
573000 -- (-549.727) (-553.225) (-550.471) [-551.691] * (-552.224) [-550.268] (-549.506) (-549.646) -- 0:00:26
573500 -- (-549.835) (-549.442) [-550.211] (-550.903) * (-554.679) (-550.065) [-551.429] (-550.504) -- 0:00:26
574000 -- [-552.743] (-552.737) (-549.472) (-549.879) * (-556.062) (-549.708) [-550.625] (-549.501) -- 0:00:25
574500 -- [-552.810] (-552.452) (-551.648) (-549.924) * (-550.057) (-551.001) [-551.238] (-551.709) -- 0:00:25
575000 -- (-553.751) (-554.492) [-550.095] (-550.790) * (-551.672) (-550.336) (-551.710) [-553.052] -- 0:00:25
Average standard deviation of split frequencies: 0.010128
575500 -- (-556.480) [-551.341] (-552.825) (-554.560) * (-552.203) [-549.488] (-551.609) (-552.139) -- 0:00:25
576000 -- (-553.536) [-551.427] (-550.776) (-552.062) * (-551.558) [-553.286] (-551.747) (-552.412) -- 0:00:25
576500 -- (-550.507) (-551.986) (-551.166) [-551.836] * (-550.540) [-551.340] (-550.956) (-551.626) -- 0:00:25
577000 -- [-552.829] (-549.809) (-551.077) (-555.677) * [-549.867] (-552.523) (-553.791) (-550.865) -- 0:00:25
577500 -- (-553.471) (-550.633) (-550.617) [-552.986] * (-553.857) (-552.547) [-551.375] (-552.852) -- 0:00:25
578000 -- (-550.677) [-551.452] (-551.380) (-550.310) * (-554.405) [-551.774] (-552.129) (-554.584) -- 0:00:25
578500 -- [-558.669] (-554.863) (-552.558) (-551.206) * [-550.033] (-552.138) (-550.447) (-555.403) -- 0:00:25
579000 -- [-554.277] (-553.605) (-552.601) (-554.640) * [-552.822] (-552.734) (-550.893) (-552.205) -- 0:00:25
579500 -- [-551.262] (-550.915) (-553.900) (-555.633) * (-556.598) [-550.524] (-556.029) (-553.119) -- 0:00:25
580000 -- (-552.236) (-549.802) (-552.499) [-550.004] * [-550.989] (-550.832) (-550.223) (-553.608) -- 0:00:25
Average standard deviation of split frequencies: 0.009526
580500 -- (-552.621) (-552.139) [-549.655] (-553.480) * (-549.621) (-552.838) [-551.077] (-553.054) -- 0:00:25
581000 -- (-551.541) (-551.078) (-550.115) [-549.983] * (-551.573) [-549.997] (-553.938) (-550.862) -- 0:00:25
581500 -- (-551.338) (-555.360) (-549.994) [-549.410] * (-552.670) (-549.638) [-551.751] (-550.356) -- 0:00:25
582000 -- (-555.246) [-552.768] (-549.585) (-552.804) * (-552.186) (-549.446) [-550.195] (-550.520) -- 0:00:25
582500 -- (-552.128) (-554.929) [-549.650] (-551.479) * (-550.608) (-550.803) (-551.551) [-550.473] -- 0:00:25
583000 -- (-549.726) (-556.015) (-551.156) [-551.765] * (-553.630) (-551.286) [-549.684] (-554.388) -- 0:00:25
583500 -- (-550.549) (-554.153) (-553.675) [-551.805] * (-552.746) [-549.883] (-556.575) (-552.173) -- 0:00:24
584000 -- (-554.832) (-550.785) [-552.661] (-550.458) * [-552.717] (-552.367) (-551.224) (-552.342) -- 0:00:24
584500 -- (-549.431) (-552.387) [-550.617] (-550.542) * (-552.641) (-558.058) (-551.404) [-552.034] -- 0:00:24
585000 -- (-549.507) [-550.546] (-551.530) (-553.551) * (-556.484) (-552.616) (-552.998) [-549.716] -- 0:00:24
Average standard deviation of split frequencies: 0.009492
585500 -- (-553.827) [-553.569] (-551.232) (-551.936) * (-556.309) (-550.348) [-550.882] (-551.229) -- 0:00:24
586000 -- (-552.479) (-550.882) (-553.113) [-551.918] * [-552.307] (-550.477) (-549.924) (-549.785) -- 0:00:24
586500 -- (-552.718) [-550.352] (-553.862) (-551.213) * (-558.146) [-551.052] (-550.291) (-549.773) -- 0:00:25
587000 -- (-554.757) (-552.986) (-554.360) [-550.884] * (-549.253) (-550.558) (-552.555) [-549.918] -- 0:00:25
587500 -- (-551.363) [-549.841] (-552.538) (-556.385) * (-551.323) (-550.062) (-559.256) [-552.962] -- 0:00:25
588000 -- (-550.128) (-551.825) (-549.844) [-552.779] * [-549.899] (-551.291) (-550.121) (-553.605) -- 0:00:25
588500 -- [-550.794] (-557.241) (-554.348) (-554.679) * (-554.086) (-553.135) [-552.168] (-552.197) -- 0:00:25
589000 -- (-554.572) (-556.290) [-552.636] (-554.438) * (-549.681) (-553.069) (-550.963) [-550.120] -- 0:00:25
589500 -- (-556.453) [-555.853] (-551.009) (-552.877) * (-556.581) (-551.070) (-549.632) [-549.704] -- 0:00:25
590000 -- [-551.428] (-551.388) (-549.283) (-551.121) * [-555.782] (-551.221) (-549.510) (-552.604) -- 0:00:25
Average standard deviation of split frequencies: 0.009950
590500 -- (-551.957) (-554.512) [-550.398] (-550.438) * (-551.871) (-554.671) (-550.615) [-550.801] -- 0:00:24
591000 -- [-551.351] (-549.910) (-551.364) (-553.696) * (-549.895) (-549.733) (-552.103) [-553.597] -- 0:00:24
591500 -- (-551.864) [-553.753] (-553.737) (-551.809) * (-550.304) [-550.659] (-552.859) (-552.831) -- 0:00:24
592000 -- [-550.064] (-554.109) (-550.245) (-549.739) * (-556.965) [-553.773] (-553.871) (-550.362) -- 0:00:24
592500 -- (-551.742) (-552.681) (-555.164) [-551.431] * (-552.123) (-550.524) [-550.510] (-549.752) -- 0:00:24
593000 -- (-549.333) (-551.282) [-551.500] (-551.601) * (-551.193) (-551.355) [-550.490] (-555.396) -- 0:00:24
593500 -- (-551.230) (-552.556) (-550.275) [-549.619] * (-554.496) [-553.041] (-550.647) (-555.463) -- 0:00:24
594000 -- (-556.361) [-554.162] (-549.503) (-552.207) * (-551.232) (-552.090) [-551.927] (-551.705) -- 0:00:24
594500 -- (-555.542) (-549.588) (-549.282) [-549.493] * (-553.431) (-550.292) (-553.712) [-553.135] -- 0:00:24
595000 -- [-556.225] (-551.456) (-549.615) (-549.873) * (-551.766) (-551.024) (-551.427) [-551.590] -- 0:00:24
Average standard deviation of split frequencies: 0.009333
595500 -- [-553.009] (-552.280) (-550.346) (-551.946) * [-554.054] (-551.093) (-549.835) (-553.553) -- 0:00:24
596000 -- (-551.515) [-551.977] (-549.445) (-550.665) * (-552.324) [-554.585] (-549.765) (-552.989) -- 0:00:24
596500 -- (-551.292) [-551.574] (-551.799) (-551.591) * (-552.078) [-549.307] (-550.625) (-553.540) -- 0:00:24
597000 -- [-549.603] (-550.558) (-550.844) (-554.793) * (-558.244) (-551.786) (-550.283) [-550.942] -- 0:00:24
597500 -- [-552.225] (-550.860) (-549.349) (-551.425) * (-553.393) (-551.559) [-550.651] (-549.978) -- 0:00:24
598000 -- (-551.515) (-550.357) (-549.477) [-551.810] * [-549.658] (-553.478) (-553.347) (-551.485) -- 0:00:24
598500 -- (-551.982) [-552.970] (-550.403) (-553.133) * (-549.697) (-553.471) [-550.997] (-550.163) -- 0:00:24
599000 -- (-551.438) (-550.953) [-552.760] (-549.753) * [-549.458] (-550.404) (-554.148) (-550.908) -- 0:00:24
599500 -- [-550.034] (-551.580) (-551.621) (-550.529) * (-550.673) (-550.068) (-550.541) [-550.720] -- 0:00:24
600000 -- [-549.310] (-552.886) (-549.404) (-551.192) * (-549.886) (-552.240) (-553.033) [-549.527] -- 0:00:24
Average standard deviation of split frequencies: 0.008947
600500 -- (-550.959) (-555.327) (-553.464) [-549.543] * [-552.225] (-551.506) (-551.334) (-553.996) -- 0:00:23
601000 -- (-551.688) [-552.528] (-551.526) (-549.940) * (-549.959) [-552.121] (-552.925) (-549.751) -- 0:00:23
601500 -- (-551.803) (-551.427) (-553.437) [-550.755] * [-551.017] (-550.417) (-552.639) (-549.485) -- 0:00:23
602000 -- (-552.364) (-552.537) [-551.275] (-551.155) * (-549.359) [-551.214] (-551.773) (-553.451) -- 0:00:23
602500 -- [-552.554] (-550.390) (-549.429) (-550.145) * (-549.701) [-549.113] (-550.401) (-552.821) -- 0:00:23
603000 -- [-552.673] (-551.415) (-551.174) (-554.776) * (-550.284) (-549.659) [-550.023] (-552.922) -- 0:00:24
603500 -- (-553.982) [-550.801] (-550.581) (-550.664) * (-553.023) (-551.217) (-549.692) [-551.467] -- 0:00:24
604000 -- (-554.977) (-551.920) [-550.728] (-549.414) * (-552.023) [-549.475] (-551.710) (-551.346) -- 0:00:24
604500 -- [-553.715] (-551.926) (-550.576) (-550.409) * (-549.095) (-550.455) [-549.750] (-549.917) -- 0:00:24
605000 -- (-554.055) (-551.799) (-549.898) [-549.202] * (-551.465) [-551.816] (-552.365) (-551.801) -- 0:00:24
Average standard deviation of split frequencies: 0.008712
605500 -- (-551.849) [-551.603] (-551.322) (-551.269) * [-553.803] (-551.462) (-553.026) (-551.243) -- 0:00:24
606000 -- (-556.869) (-551.203) (-550.739) [-550.270] * (-550.885) (-552.002) [-551.236] (-552.623) -- 0:00:24
606500 -- (-550.307) (-552.059) (-550.794) [-549.353] * (-550.495) [-550.708] (-555.408) (-553.525) -- 0:00:24
607000 -- (-551.250) [-549.711] (-553.787) (-550.595) * (-550.699) (-551.048) (-552.423) [-550.142] -- 0:00:23
607500 -- (-553.201) [-551.985] (-550.633) (-552.841) * [-551.409] (-549.237) (-551.425) (-550.673) -- 0:00:23
608000 -- (-552.255) [-552.822] (-552.903) (-557.954) * (-553.605) (-549.252) (-550.196) [-550.195] -- 0:00:23
608500 -- [-549.301] (-549.757) (-551.531) (-553.500) * (-557.126) [-549.790] (-552.252) (-551.342) -- 0:00:23
609000 -- [-551.181] (-549.528) (-553.203) (-552.194) * (-551.124) (-552.818) [-550.934] (-551.356) -- 0:00:23
609500 -- [-551.103] (-550.833) (-551.107) (-552.829) * (-554.327) [-551.924] (-551.606) (-550.648) -- 0:00:23
610000 -- (-554.444) (-553.318) (-552.794) [-551.880] * (-549.799) (-550.279) [-552.294] (-552.942) -- 0:00:23
Average standard deviation of split frequencies: 0.009006
610500 -- (-553.206) (-550.672) (-551.705) [-552.352] * (-552.152) (-549.263) (-552.464) [-550.961] -- 0:00:23
611000 -- [-550.993] (-549.927) (-551.358) (-551.362) * (-555.138) (-551.147) [-550.896] (-550.164) -- 0:00:23
611500 -- (-550.535) (-551.094) (-552.092) [-550.582] * (-550.404) (-550.354) (-549.683) [-553.664] -- 0:00:23
612000 -- (-550.517) [-554.132] (-550.519) (-552.166) * (-552.757) (-553.796) (-551.378) [-553.233] -- 0:00:23
612500 -- (-554.321) (-550.483) [-550.948] (-550.214) * [-556.232] (-554.205) (-552.107) (-551.332) -- 0:00:23
613000 -- (-552.672) (-553.270) (-552.437) [-549.733] * (-553.855) (-554.995) (-551.345) [-551.735] -- 0:00:23
613500 -- (-555.148) (-554.088) (-553.924) [-551.868] * (-553.146) (-552.626) [-550.637] (-550.522) -- 0:00:23
614000 -- (-553.310) (-551.840) [-550.993] (-549.921) * [-551.113] (-551.811) (-550.610) (-549.695) -- 0:00:23
614500 -- (-551.570) (-551.564) [-550.717] (-550.680) * (-551.315) (-555.221) (-554.510) [-551.761] -- 0:00:23
615000 -- [-554.568] (-553.767) (-551.393) (-551.328) * [-551.376] (-556.359) (-555.137) (-551.425) -- 0:00:23
Average standard deviation of split frequencies: 0.009438
615500 -- (-556.216) [-552.499] (-550.803) (-554.824) * [-550.572] (-551.473) (-554.367) (-551.456) -- 0:00:23
616000 -- [-550.209] (-550.249) (-553.797) (-553.138) * (-553.165) (-550.701) [-554.024] (-551.674) -- 0:00:23
616500 -- (-549.607) (-551.076) (-557.025) [-553.863] * (-552.981) (-550.969) (-551.698) [-553.967] -- 0:00:23
617000 -- (-557.343) [-550.172] (-551.837) (-550.348) * (-555.274) [-554.970] (-551.797) (-553.547) -- 0:00:22
617500 -- (-554.291) (-555.136) (-560.907) [-550.783] * (-551.877) (-553.890) (-550.940) [-550.564] -- 0:00:22
618000 -- [-551.081] (-555.472) (-556.378) (-555.549) * (-549.582) [-550.494] (-553.835) (-552.086) -- 0:00:22
618500 -- (-549.685) (-551.482) [-552.562] (-555.090) * (-549.371) (-550.555) [-551.000] (-554.240) -- 0:00:22
619000 -- (-551.924) (-554.876) [-556.810] (-553.229) * [-551.865] (-552.801) (-552.887) (-550.827) -- 0:00:22
619500 -- (-552.647) (-552.501) (-556.780) [-549.775] * (-553.031) (-550.215) (-549.494) [-550.391] -- 0:00:22
620000 -- (-553.282) (-550.367) (-556.089) [-550.763] * (-552.243) (-550.197) [-550.235] (-550.509) -- 0:00:23
Average standard deviation of split frequencies: 0.008861
620500 -- (-552.853) (-551.327) [-551.333] (-551.773) * (-554.407) [-551.991] (-552.445) (-554.042) -- 0:00:23
621000 -- [-552.796] (-550.057) (-550.232) (-550.909) * (-550.707) [-555.094] (-552.009) (-552.188) -- 0:00:23
621500 -- (-552.481) (-553.878) (-551.118) [-550.583] * [-551.544] (-552.312) (-556.188) (-550.620) -- 0:00:23
622000 -- (-553.955) (-551.325) [-549.226] (-550.165) * (-555.610) (-551.772) (-550.172) [-550.898] -- 0:00:23
622500 -- (-552.452) [-550.979] (-551.238) (-552.890) * [-551.140] (-551.367) (-551.670) (-551.582) -- 0:00:23
623000 -- (-553.908) [-556.061] (-551.291) (-550.317) * [-550.343] (-556.263) (-552.369) (-551.570) -- 0:00:22
623500 -- (-553.053) (-550.933) (-549.703) [-550.088] * (-552.036) [-552.433] (-556.097) (-549.859) -- 0:00:22
624000 -- [-553.639] (-550.289) (-549.317) (-550.203) * [-552.472] (-552.408) (-551.794) (-556.464) -- 0:00:22
624500 -- (-553.555) [-552.858] (-553.175) (-554.302) * (-551.822) (-555.420) [-551.064] (-554.913) -- 0:00:22
625000 -- (-553.121) (-558.799) (-551.848) [-550.385] * [-555.863] (-553.654) (-553.171) (-554.059) -- 0:00:22
Average standard deviation of split frequencies: 0.008233
625500 -- (-551.792) (-555.661) [-550.310] (-550.350) * (-552.131) [-553.338] (-557.968) (-553.356) -- 0:00:22
626000 -- (-550.940) [-552.232] (-552.238) (-550.084) * [-550.894] (-552.242) (-550.187) (-549.519) -- 0:00:22
626500 -- (-557.101) [-552.644] (-553.519) (-551.718) * (-551.258) (-550.152) (-551.687) [-550.975] -- 0:00:22
627000 -- [-551.818] (-550.937) (-549.641) (-550.306) * [-554.722] (-552.087) (-553.390) (-550.703) -- 0:00:22
627500 -- (-555.219) (-555.640) (-551.102) [-552.005] * (-553.354) (-552.399) (-552.852) [-551.379] -- 0:00:22
628000 -- (-550.083) (-553.924) (-553.858) [-550.844] * (-553.628) (-551.038) [-550.011] (-550.350) -- 0:00:22
628500 -- (-551.124) [-550.508] (-550.559) (-550.331) * (-554.425) (-551.555) (-549.818) [-551.865] -- 0:00:22
629000 -- (-549.535) [-550.461] (-550.507) (-551.123) * [-549.767] (-552.180) (-550.696) (-551.732) -- 0:00:22
629500 -- (-550.132) (-551.504) (-550.360) [-551.655] * [-550.543] (-552.381) (-550.642) (-555.213) -- 0:00:22
630000 -- (-549.455) (-552.796) [-551.395] (-554.450) * (-549.671) (-550.854) [-550.500] (-550.679) -- 0:00:22
Average standard deviation of split frequencies: 0.008571
630500 -- (-552.826) [-553.080] (-550.410) (-552.851) * (-549.392) (-550.294) [-550.580] (-550.907) -- 0:00:22
631000 -- [-551.162] (-553.388) (-554.070) (-553.321) * [-549.992] (-549.673) (-552.602) (-550.529) -- 0:00:22
631500 -- (-557.864) (-550.431) [-550.755] (-550.056) * (-549.530) (-551.474) (-551.430) [-552.659] -- 0:00:22
632000 -- (-556.162) (-551.460) (-552.873) [-552.746] * (-549.613) (-555.321) [-551.799] (-551.370) -- 0:00:22
632500 -- [-554.780] (-550.860) (-553.359) (-553.553) * (-551.483) (-553.611) (-552.101) [-550.395] -- 0:00:22
633000 -- (-551.346) [-551.202] (-551.678) (-553.041) * [-550.963] (-550.275) (-551.441) (-552.359) -- 0:00:22
633500 -- (-552.400) (-550.060) [-551.743] (-553.386) * (-549.532) (-550.864) [-551.069] (-549.715) -- 0:00:21
634000 -- (-552.324) [-551.420] (-551.129) (-553.295) * (-550.014) (-553.964) [-554.825] (-556.992) -- 0:00:21
634500 -- [-550.387] (-551.114) (-551.972) (-550.304) * (-551.417) (-553.164) [-551.798] (-552.206) -- 0:00:21
635000 -- [-549.501] (-552.221) (-554.473) (-550.181) * (-553.518) (-553.792) (-552.159) [-553.673] -- 0:00:21
Average standard deviation of split frequencies: 0.008549
635500 -- (-551.630) (-552.819) (-550.475) [-550.394] * [-552.678] (-552.345) (-551.310) (-554.352) -- 0:00:21
636000 -- (-550.884) (-551.852) [-550.685] (-551.299) * [-549.932] (-550.208) (-553.536) (-551.868) -- 0:00:21
636500 -- (-551.050) (-551.586) [-551.895] (-551.838) * [-549.867] (-550.551) (-553.343) (-551.051) -- 0:00:21
637000 -- (-553.560) [-552.977] (-550.198) (-553.709) * (-551.501) [-551.291] (-559.152) (-551.758) -- 0:00:22
637500 -- (-550.459) [-553.286] (-549.848) (-551.001) * [-550.758] (-550.892) (-553.660) (-552.335) -- 0:00:22
638000 -- (-553.353) [-551.006] (-550.168) (-553.953) * [-552.934] (-550.479) (-552.750) (-551.008) -- 0:00:22
638500 -- (-553.884) [-552.013] (-549.495) (-553.146) * (-551.931) (-549.716) [-553.995] (-550.913) -- 0:00:22
639000 -- (-551.871) [-551.276] (-549.935) (-551.629) * (-552.404) (-549.936) (-552.575) [-550.765] -- 0:00:22
639500 -- (-550.258) (-553.625) (-552.973) [-551.607] * (-550.559) [-549.887] (-554.869) (-551.731) -- 0:00:21
640000 -- [-550.162] (-551.500) (-552.769) (-550.518) * (-551.854) (-550.356) [-552.063] (-551.749) -- 0:00:21
Average standard deviation of split frequencies: 0.008682
640500 -- [-552.779] (-550.236) (-550.878) (-552.437) * (-550.938) [-554.767] (-550.666) (-551.536) -- 0:00:21
641000 -- (-550.080) [-551.204] (-551.732) (-552.512) * (-553.736) (-552.746) [-550.155] (-552.231) -- 0:00:21
641500 -- (-553.109) (-551.689) (-550.211) [-550.237] * [-554.264] (-550.793) (-550.203) (-552.675) -- 0:00:21
642000 -- (-550.375) [-553.293] (-553.747) (-552.642) * [-551.628] (-552.376) (-549.908) (-557.205) -- 0:00:21
642500 -- (-550.164) [-551.163] (-552.136) (-556.989) * (-550.511) [-552.560] (-550.091) (-555.213) -- 0:00:21
643000 -- (-556.297) (-549.774) [-550.417] (-551.387) * [-557.659] (-557.659) (-550.762) (-552.491) -- 0:00:21
643500 -- [-550.846] (-549.606) (-550.977) (-553.672) * (-551.319) (-551.869) [-551.234] (-550.791) -- 0:00:21
644000 -- (-550.700) [-549.987] (-549.574) (-550.743) * (-550.012) (-553.762) (-550.475) [-550.380] -- 0:00:21
644500 -- (-551.468) (-553.514) [-550.185] (-551.435) * (-554.910) [-551.471] (-551.888) (-551.021) -- 0:00:21
645000 -- (-552.598) [-550.543] (-549.801) (-551.871) * (-553.940) (-560.215) (-551.974) [-550.979] -- 0:00:21
Average standard deviation of split frequencies: 0.008076
645500 -- (-552.802) (-551.365) (-551.160) [-550.326] * (-554.052) [-552.827] (-554.194) (-553.436) -- 0:00:21
646000 -- [-552.488] (-552.655) (-550.292) (-552.694) * (-550.396) (-551.668) (-554.542) [-553.406] -- 0:00:21
646500 -- (-553.369) (-551.122) (-552.439) [-553.579] * (-550.710) (-551.785) (-552.178) [-550.549] -- 0:00:21
647000 -- (-551.690) [-550.262] (-554.013) (-551.370) * [-550.459] (-550.806) (-553.515) (-551.869) -- 0:00:21
647500 -- [-549.765] (-550.643) (-550.342) (-552.272) * (-549.912) (-553.513) (-549.939) [-549.789] -- 0:00:21
648000 -- (-551.137) (-551.028) (-550.496) [-552.916] * (-559.105) [-559.056] (-550.227) (-553.753) -- 0:00:21
648500 -- (-550.571) (-551.972) [-550.538] (-558.402) * (-557.622) (-552.332) (-553.878) [-550.716] -- 0:00:21
649000 -- (-551.361) [-553.014] (-550.429) (-551.383) * (-556.576) (-553.736) (-549.871) [-550.372] -- 0:00:21
649500 -- [-550.512] (-552.984) (-551.731) (-554.954) * (-549.869) (-552.078) (-552.033) [-551.603] -- 0:00:21
650000 -- (-550.224) (-550.213) [-551.592] (-550.201) * (-552.034) (-552.221) (-551.276) [-550.030] -- 0:00:21
Average standard deviation of split frequencies: 0.008308
650500 -- (-551.008) (-552.400) [-550.469] (-553.784) * (-550.583) [-550.886] (-551.766) (-553.779) -- 0:00:20
651000 -- (-551.046) [-552.370] (-550.399) (-553.093) * [-552.081] (-555.328) (-552.855) (-554.501) -- 0:00:20
651500 -- (-549.932) [-551.407] (-550.877) (-553.115) * (-552.217) (-551.564) [-552.363] (-551.533) -- 0:00:20
652000 -- (-555.213) (-551.247) [-553.247] (-551.946) * [-551.551] (-552.124) (-552.188) (-550.390) -- 0:00:20
652500 -- (-551.941) [-551.252] (-555.453) (-550.121) * (-554.225) (-553.790) (-555.294) [-549.764] -- 0:00:20
653000 -- [-551.300] (-550.019) (-556.350) (-549.462) * (-555.521) [-552.641] (-553.436) (-550.629) -- 0:00:20
653500 -- (-551.111) (-549.518) (-552.876) [-549.633] * (-552.565) (-555.137) [-551.656] (-550.112) -- 0:00:21
654000 -- (-549.472) (-551.382) [-555.114] (-550.550) * (-550.746) (-554.517) (-551.023) [-552.067] -- 0:00:21
654500 -- [-551.196] (-552.435) (-551.874) (-550.995) * (-551.692) [-552.749] (-554.504) (-552.134) -- 0:00:21
655000 -- [-549.971] (-552.408) (-552.959) (-549.876) * (-551.293) (-550.706) [-554.016] (-553.255) -- 0:00:21
Average standard deviation of split frequencies: 0.008384
655500 -- (-556.046) (-552.933) [-550.989] (-551.686) * (-552.077) [-549.774] (-551.814) (-554.376) -- 0:00:21
656000 -- (-551.445) [-550.882] (-552.945) (-549.405) * (-550.999) (-553.736) (-550.242) [-550.811] -- 0:00:20
656500 -- [-550.946] (-549.861) (-550.318) (-550.522) * (-553.960) (-550.638) [-555.060] (-551.786) -- 0:00:20
657000 -- (-552.943) [-552.833] (-549.510) (-551.812) * (-550.538) (-549.914) (-551.984) [-551.867] -- 0:00:20
657500 -- (-553.043) (-552.085) [-550.021] (-551.716) * (-552.467) [-549.208] (-551.848) (-552.546) -- 0:00:20
658000 -- (-555.890) (-551.992) [-549.778] (-551.254) * (-550.895) (-552.155) (-550.458) [-554.345] -- 0:00:20
658500 -- [-551.307] (-552.784) (-551.047) (-551.002) * (-550.746) (-550.127) [-552.630] (-555.393) -- 0:00:20
659000 -- (-549.602) (-554.301) (-551.510) [-550.829] * (-551.446) (-550.742) [-550.233] (-549.377) -- 0:00:20
659500 -- (-551.673) (-550.240) (-550.253) [-550.986] * (-554.623) (-549.699) [-550.779] (-553.433) -- 0:00:20
660000 -- [-554.198] (-551.864) (-551.622) (-550.284) * (-552.294) (-550.530) [-553.151] (-555.689) -- 0:00:20
Average standard deviation of split frequencies: 0.008324
660500 -- (-556.837) (-553.472) [-551.780] (-551.186) * (-549.847) [-551.489] (-550.972) (-554.946) -- 0:00:20
661000 -- (-559.384) (-551.834) [-550.374] (-549.936) * (-550.606) (-550.993) (-551.586) [-550.940] -- 0:00:20
661500 -- (-552.932) (-551.548) (-549.929) [-551.195] * [-551.439] (-550.330) (-550.959) (-551.237) -- 0:00:20
662000 -- (-552.193) [-549.809] (-550.346) (-558.601) * (-552.322) [-552.842] (-550.647) (-550.899) -- 0:00:20
662500 -- [-550.800] (-549.769) (-550.905) (-555.478) * [-551.060] (-550.693) (-555.137) (-552.007) -- 0:00:20
663000 -- (-553.714) [-550.493] (-550.424) (-551.047) * (-550.983) (-549.679) (-554.635) [-549.145] -- 0:00:20
663500 -- (-554.981) [-552.998] (-550.259) (-556.412) * [-551.794] (-552.741) (-550.762) (-549.121) -- 0:00:20
664000 -- (-552.151) [-554.946] (-551.889) (-551.683) * (-554.970) (-550.633) (-551.344) [-549.864] -- 0:00:20
664500 -- [-555.304] (-552.196) (-552.050) (-550.936) * (-558.869) [-550.047] (-551.471) (-550.670) -- 0:00:20
665000 -- [-550.358] (-556.941) (-552.020) (-552.032) * (-550.921) [-551.141] (-551.444) (-552.879) -- 0:00:20
Average standard deviation of split frequencies: 0.007928
665500 -- [-551.989] (-551.196) (-551.031) (-560.155) * [-549.924] (-551.321) (-552.181) (-549.747) -- 0:00:20
666000 -- [-549.561] (-551.692) (-549.952) (-556.762) * [-550.550] (-551.116) (-557.183) (-554.378) -- 0:00:20
666500 -- (-550.453) [-550.815] (-554.846) (-553.485) * (-549.108) (-558.508) [-553.591] (-557.268) -- 0:00:20
667000 -- [-549.639] (-554.779) (-550.850) (-553.080) * [-551.660] (-554.953) (-550.576) (-551.481) -- 0:00:19
667500 -- (-550.973) [-552.869] (-551.007) (-552.310) * [-551.348] (-552.642) (-557.533) (-550.117) -- 0:00:19
668000 -- [-552.473] (-550.443) (-551.589) (-551.621) * (-549.885) (-552.542) [-550.329] (-551.695) -- 0:00:19
668500 -- (-551.495) [-551.434] (-550.200) (-552.668) * (-552.777) (-552.294) (-553.398) [-552.239] -- 0:00:19
669000 -- [-553.510] (-550.542) (-552.924) (-551.004) * [-551.230] (-549.832) (-550.248) (-550.320) -- 0:00:19
669500 -- [-551.030] (-550.766) (-550.503) (-552.759) * (-551.384) (-550.107) [-551.202] (-551.175) -- 0:00:19
670000 -- [-553.490] (-555.331) (-552.475) (-552.753) * (-553.750) (-550.163) (-551.055) [-551.425] -- 0:00:19
Average standard deviation of split frequencies: 0.008013
670500 -- (-552.918) [-550.766] (-551.353) (-551.563) * (-550.784) [-550.161] (-552.768) (-551.036) -- 0:00:20
671000 -- (-552.219) [-550.742] (-551.207) (-551.184) * (-551.747) (-551.419) [-550.390] (-550.773) -- 0:00:20
671500 -- (-554.000) (-552.504) (-549.444) [-550.202] * (-551.299) (-550.442) (-551.165) [-550.265] -- 0:00:20
672000 -- [-549.822] (-549.698) (-552.073) (-551.068) * (-550.201) (-553.663) [-552.926] (-557.752) -- 0:00:20
672500 -- (-551.486) (-551.122) [-551.767] (-552.358) * [-550.618] (-552.178) (-553.463) (-552.531) -- 0:00:19
673000 -- (-551.348) [-550.195] (-549.463) (-551.317) * (-552.850) (-549.624) [-556.881] (-552.601) -- 0:00:19
673500 -- [-551.099] (-551.564) (-550.950) (-556.352) * (-551.583) [-551.247] (-555.065) (-554.108) -- 0:00:19
674000 -- (-553.827) (-549.812) (-550.477) [-550.181] * (-552.874) [-552.635] (-554.890) (-553.831) -- 0:00:19
674500 -- [-554.099] (-552.170) (-550.511) (-551.235) * (-552.653) [-551.583] (-554.517) (-554.816) -- 0:00:19
675000 -- (-550.072) (-552.181) (-550.872) [-551.479] * (-556.705) [-553.724] (-549.714) (-551.887) -- 0:00:19
Average standard deviation of split frequencies: 0.008630
675500 -- (-553.680) (-551.516) (-550.908) [-552.102] * (-551.552) (-550.028) [-549.630] (-550.713) -- 0:00:19
676000 -- [-552.908] (-551.816) (-549.979) (-553.505) * (-549.474) (-550.423) [-550.793] (-552.293) -- 0:00:19
676500 -- (-552.521) (-551.529) [-549.941] (-560.260) * (-553.241) [-549.831] (-551.381) (-553.435) -- 0:00:19
677000 -- (-550.649) (-550.464) (-550.940) [-554.202] * (-556.271) (-555.569) [-549.966] (-550.544) -- 0:00:19
677500 -- [-549.762] (-550.578) (-549.912) (-551.613) * (-553.809) [-554.354] (-550.764) (-549.695) -- 0:00:19
678000 -- (-552.548) (-550.641) [-551.285] (-550.768) * (-552.522) (-555.942) [-553.355] (-550.870) -- 0:00:19
678500 -- (-550.748) (-551.360) [-551.397] (-550.858) * (-550.529) (-549.732) [-551.132] (-550.095) -- 0:00:19
679000 -- (-549.788) (-550.247) (-553.277) [-551.347] * (-555.085) (-552.642) [-551.205] (-550.281) -- 0:00:19
679500 -- (-553.284) (-551.325) (-549.593) [-551.361] * (-553.065) (-552.729) [-550.833] (-552.254) -- 0:00:19
680000 -- (-550.798) (-549.896) [-549.625] (-550.210) * [-554.215] (-550.680) (-552.278) (-556.555) -- 0:00:19
Average standard deviation of split frequencies: 0.008830
680500 -- (-552.804) (-550.770) (-551.344) [-554.238] * (-553.978) [-551.286] (-552.245) (-550.713) -- 0:00:19
681000 -- (-550.758) [-549.359] (-555.082) (-553.126) * (-549.606) (-553.139) [-550.937] (-550.843) -- 0:00:19
681500 -- (-551.312) (-549.460) (-551.358) [-551.035] * (-549.720) (-555.574) (-549.443) [-550.530] -- 0:00:19
682000 -- (-553.560) [-549.723] (-554.553) (-549.995) * [-550.554] (-555.308) (-553.234) (-551.460) -- 0:00:19
682500 -- (-550.249) [-550.461] (-552.223) (-550.535) * (-553.226) (-550.350) (-551.470) [-550.745] -- 0:00:19
683000 -- (-550.264) (-550.282) (-550.087) [-550.936] * (-552.314) (-552.728) [-550.837] (-552.636) -- 0:00:19
683500 -- (-553.602) (-551.260) [-549.382] (-553.757) * (-549.954) (-554.581) (-550.726) [-552.368] -- 0:00:18
684000 -- (-551.248) (-550.540) (-551.329) [-551.060] * [-552.535] (-551.288) (-552.660) (-551.900) -- 0:00:18
684500 -- (-555.875) (-554.281) (-551.294) [-552.296] * [-549.629] (-551.019) (-551.152) (-553.194) -- 0:00:18
685000 -- (-553.923) [-550.542] (-554.854) (-552.672) * (-550.134) [-553.694] (-549.632) (-550.284) -- 0:00:18
Average standard deviation of split frequencies: 0.009062
685500 -- [-550.971] (-550.910) (-554.783) (-549.883) * [-550.818] (-552.201) (-550.146) (-550.244) -- 0:00:18
686000 -- (-550.582) [-551.236] (-552.862) (-552.148) * [-551.051] (-554.053) (-549.608) (-550.632) -- 0:00:18
686500 -- (-550.948) [-550.392] (-550.846) (-551.009) * [-553.359] (-556.226) (-549.836) (-550.332) -- 0:00:18
687000 -- (-553.244) [-555.976] (-549.811) (-552.338) * [-551.208] (-551.802) (-551.831) (-549.554) -- 0:00:19
687500 -- [-554.836] (-550.822) (-549.747) (-554.014) * (-550.473) [-551.958] (-550.288) (-549.747) -- 0:00:19
688000 -- (-552.066) (-558.259) [-551.170] (-554.638) * (-551.625) (-552.667) [-551.141] (-550.878) -- 0:00:19
688500 -- [-551.184] (-550.756) (-551.447) (-554.202) * (-551.351) (-554.818) (-555.419) [-551.126] -- 0:00:19
689000 -- [-549.755] (-549.664) (-551.606) (-553.246) * (-551.708) [-553.826] (-551.025) (-549.252) -- 0:00:18
689500 -- (-552.392) [-550.571] (-551.569) (-552.717) * (-549.464) (-550.129) (-552.564) [-549.700] -- 0:00:18
690000 -- (-555.047) [-553.979] (-550.680) (-552.350) * (-553.851) [-549.688] (-552.817) (-549.137) -- 0:00:18
Average standard deviation of split frequencies: 0.009129
690500 -- (-551.712) (-552.368) (-551.583) [-553.494] * [-551.161] (-550.580) (-553.072) (-552.946) -- 0:00:18
691000 -- (-555.532) (-554.502) (-552.077) [-551.383] * (-551.449) (-551.759) [-550.321] (-551.631) -- 0:00:18
691500 -- [-552.753] (-552.620) (-554.344) (-552.773) * (-552.031) [-550.364] (-550.510) (-551.356) -- 0:00:18
692000 -- (-557.249) (-552.075) [-551.985] (-553.800) * (-550.730) [-551.480] (-551.308) (-552.836) -- 0:00:18
692500 -- (-550.463) [-550.217] (-553.971) (-553.587) * (-551.975) (-551.158) [-549.179] (-556.916) -- 0:00:18
693000 -- (-552.171) (-550.645) [-553.017] (-553.519) * [-550.530] (-549.630) (-553.563) (-553.903) -- 0:00:18
693500 -- (-554.091) (-551.493) [-551.813] (-551.611) * (-551.218) (-550.004) (-553.067) [-550.623] -- 0:00:18
694000 -- (-553.966) (-550.436) (-552.497) [-551.366] * (-551.517) (-550.874) (-553.437) [-556.082] -- 0:00:18
694500 -- (-552.441) [-549.794] (-551.612) (-551.109) * [-551.038] (-551.181) (-551.076) (-550.895) -- 0:00:18
695000 -- (-550.093) (-552.175) (-552.021) [-551.130] * (-551.224) [-550.076] (-553.024) (-551.897) -- 0:00:18
Average standard deviation of split frequencies: 0.008974
695500 -- (-550.249) (-550.845) (-551.182) [-551.688] * (-550.496) [-549.670] (-550.989) (-551.675) -- 0:00:18
696000 -- [-549.595] (-551.868) (-551.607) (-550.136) * (-549.508) [-551.107] (-549.821) (-552.105) -- 0:00:18
696500 -- (-550.652) [-550.899] (-551.993) (-551.258) * (-551.037) (-551.121) [-550.606] (-553.656) -- 0:00:18
697000 -- [-551.174] (-553.964) (-551.113) (-549.970) * (-550.768) (-553.189) (-550.745) [-550.376] -- 0:00:18
697500 -- (-550.458) (-552.511) [-550.642] (-552.230) * [-550.551] (-551.149) (-552.331) (-549.502) -- 0:00:18
698000 -- (-553.107) (-550.182) (-557.189) [-550.597] * (-550.763) (-551.139) (-550.241) [-551.433] -- 0:00:18
698500 -- [-550.442] (-551.563) (-553.433) (-550.420) * (-552.209) (-550.941) [-551.986] (-553.676) -- 0:00:18
699000 -- [-551.373] (-551.984) (-551.436) (-552.515) * (-550.488) (-552.869) (-553.959) [-550.105] -- 0:00:18
699500 -- (-552.529) [-549.610] (-550.868) (-550.328) * (-551.656) (-550.885) [-552.232] (-552.499) -- 0:00:18
700000 -- (-556.488) [-550.382] (-555.371) (-551.067) * (-553.139) (-550.032) (-551.663) [-549.502] -- 0:00:18
Average standard deviation of split frequencies: 0.009419
700500 -- [-550.575] (-550.205) (-554.510) (-550.858) * (-552.917) [-551.025] (-551.268) (-550.532) -- 0:00:17
701000 -- (-551.171) (-553.145) (-552.421) [-552.112] * (-551.946) (-550.602) (-551.818) [-550.761] -- 0:00:17
701500 -- (-551.957) (-561.519) [-553.516] (-551.417) * [-550.542] (-550.540) (-551.699) (-554.631) -- 0:00:17
702000 -- (-554.213) (-549.902) (-551.476) [-552.292] * (-552.348) (-556.164) [-550.786] (-552.934) -- 0:00:17
702500 -- (-550.473) (-551.859) [-551.624] (-556.678) * (-552.393) (-552.000) [-551.197] (-550.843) -- 0:00:17
703000 -- (-553.122) [-552.699] (-551.132) (-550.517) * (-550.524) (-552.370) [-550.813] (-551.510) -- 0:00:17
703500 -- (-554.142) (-550.795) (-555.947) [-549.379] * [-549.753] (-549.991) (-552.065) (-550.384) -- 0:00:17
704000 -- [-549.274] (-551.066) (-552.100) (-550.673) * (-553.022) (-552.632) [-550.656] (-552.814) -- 0:00:18
704500 -- [-549.579] (-550.942) (-550.408) (-552.045) * (-552.403) (-549.810) [-549.778] (-557.085) -- 0:00:18
705000 -- (-550.274) [-550.470] (-551.680) (-550.208) * (-551.432) (-549.729) [-550.102] (-557.337) -- 0:00:17
Average standard deviation of split frequencies: 0.009515
705500 -- (-549.988) (-551.143) (-550.369) [-549.613] * [-549.650] (-550.626) (-551.781) (-556.537) -- 0:00:17
706000 -- [-550.995] (-551.602) (-555.051) (-550.449) * (-549.770) (-550.236) (-550.294) [-552.061] -- 0:00:17
706500 -- (-550.475) (-551.179) [-550.503] (-551.024) * (-550.588) (-552.291) [-551.355] (-551.259) -- 0:00:17
707000 -- (-555.015) (-550.568) (-549.511) [-553.918] * (-549.720) (-551.219) (-550.267) [-551.718] -- 0:00:17
707500 -- (-550.324) (-550.109) (-549.860) [-555.301] * (-552.111) (-551.337) [-552.047] (-553.401) -- 0:00:17
708000 -- (-550.384) (-550.797) (-556.204) [-549.361] * (-553.330) [-550.748] (-553.432) (-553.269) -- 0:00:17
708500 -- (-553.716) [-551.913] (-551.590) (-552.899) * (-552.141) (-552.162) (-549.740) [-551.976] -- 0:00:17
709000 -- (-555.174) [-550.104] (-549.974) (-551.963) * (-551.926) (-550.510) (-549.857) [-552.109] -- 0:00:17
709500 -- (-551.838) [-553.483] (-553.129) (-550.079) * [-551.379] (-552.135) (-551.982) (-550.952) -- 0:00:17
710000 -- [-551.103] (-551.446) (-552.135) (-550.831) * (-550.681) [-550.371] (-552.865) (-551.956) -- 0:00:17
Average standard deviation of split frequencies: 0.009577
710500 -- (-551.658) [-551.192] (-552.325) (-551.400) * [-551.244] (-550.105) (-551.313) (-555.223) -- 0:00:17
711000 -- (-552.312) [-555.023] (-551.950) (-553.998) * (-553.734) (-555.456) [-551.280] (-555.465) -- 0:00:17
711500 -- (-556.448) (-550.828) [-550.351] (-551.617) * (-550.817) [-551.270] (-554.295) (-552.802) -- 0:00:17
712000 -- (-556.197) (-549.725) (-551.824) [-552.341] * (-552.869) (-551.214) [-557.104] (-553.913) -- 0:00:17
712500 -- (-552.172) (-551.719) (-554.673) [-551.262] * (-551.508) (-552.026) (-550.517) [-551.554] -- 0:00:17
713000 -- (-550.901) (-552.868) (-551.031) [-550.429] * (-549.953) (-552.689) [-550.279] (-553.526) -- 0:00:17
713500 -- (-551.911) (-551.620) (-551.422) [-549.895] * (-552.037) (-552.980) (-552.361) [-551.717] -- 0:00:17
714000 -- (-552.907) (-553.291) (-552.399) [-550.973] * (-551.229) (-553.712) [-551.549] (-552.683) -- 0:00:17
714500 -- (-553.169) (-549.765) [-554.175] (-549.670) * [-551.397] (-552.438) (-553.131) (-551.999) -- 0:00:17
715000 -- (-553.552) (-550.822) (-554.928) [-549.971] * (-551.974) (-554.856) [-551.783] (-551.788) -- 0:00:17
Average standard deviation of split frequencies: 0.009464
715500 -- (-550.967) (-551.378) (-556.179) [-552.517] * (-554.834) (-553.494) [-550.197] (-551.906) -- 0:00:17
716000 -- (-551.491) (-556.547) (-552.084) [-553.056] * [-554.680] (-550.983) (-556.455) (-553.767) -- 0:00:17
716500 -- [-551.586] (-551.196) (-551.813) (-549.994) * (-550.433) [-551.961] (-551.512) (-549.836) -- 0:00:17
717000 -- [-549.989] (-550.723) (-556.408) (-554.019) * [-551.275] (-550.366) (-550.168) (-551.571) -- 0:00:16
717500 -- (-550.228) [-553.140] (-553.728) (-551.998) * (-553.432) (-550.999) [-549.894] (-551.013) -- 0:00:16
718000 -- (-552.102) [-555.054] (-550.123) (-549.847) * (-553.322) (-555.029) (-552.400) [-551.304] -- 0:00:16
718500 -- [-550.968] (-553.870) (-553.715) (-550.314) * (-553.759) [-551.186] (-551.850) (-553.290) -- 0:00:16
719000 -- (-550.432) [-550.630] (-555.682) (-553.236) * (-553.775) (-551.403) [-554.140] (-553.158) -- 0:00:16
719500 -- (-553.096) (-549.278) [-551.014] (-552.211) * (-550.921) (-550.975) [-550.244] (-552.102) -- 0:00:16
720000 -- (-555.219) (-550.085) [-549.559] (-550.812) * (-552.528) (-553.758) [-550.279] (-553.750) -- 0:00:16
Average standard deviation of split frequencies: 0.009689
720500 -- (-555.034) (-557.522) (-551.851) [-551.016] * [-552.558] (-550.505) (-550.090) (-553.543) -- 0:00:17
721000 -- (-551.887) (-556.318) [-551.359] (-550.771) * (-552.067) (-552.773) [-550.016] (-553.696) -- 0:00:17
721500 -- [-550.881] (-557.465) (-552.384) (-551.117) * [-553.232] (-552.519) (-551.000) (-550.569) -- 0:00:16
722000 -- [-552.804] (-553.678) (-550.740) (-557.231) * (-552.929) (-551.585) [-549.832] (-551.371) -- 0:00:16
722500 -- (-554.695) (-556.987) (-549.962) [-551.181] * (-552.526) [-550.163] (-550.767) (-555.238) -- 0:00:16
723000 -- (-555.368) (-549.437) (-555.375) [-551.173] * (-555.940) [-550.512] (-549.791) (-556.336) -- 0:00:16
723500 -- (-552.043) (-549.987) (-552.572) [-556.617] * (-554.689) [-551.939] (-549.903) (-550.054) -- 0:00:16
724000 -- (-553.411) (-553.894) (-551.483) [-555.865] * (-552.224) (-552.538) (-549.522) [-549.613] -- 0:00:16
724500 -- (-558.384) [-550.405] (-551.218) (-550.728) * [-550.035] (-552.058) (-550.485) (-554.247) -- 0:00:16
725000 -- (-552.782) (-553.658) [-551.405] (-549.963) * [-549.742] (-550.080) (-554.390) (-552.880) -- 0:00:16
Average standard deviation of split frequencies: 0.009009
725500 -- (-550.480) (-555.199) [-550.181] (-555.415) * (-551.359) [-554.097] (-552.988) (-555.950) -- 0:00:16
726000 -- [-552.889] (-551.570) (-550.926) (-551.143) * (-551.534) (-553.384) [-550.467] (-557.305) -- 0:00:16
726500 -- (-551.623) (-551.825) (-551.862) [-551.378] * (-552.891) [-553.759] (-552.997) (-553.999) -- 0:00:16
727000 -- [-550.104] (-554.042) (-551.799) (-552.147) * (-556.115) (-553.995) (-555.113) [-555.490] -- 0:00:16
727500 -- (-550.192) (-551.261) (-554.840) [-550.951] * (-556.366) [-559.876] (-550.598) (-551.113) -- 0:00:16
728000 -- (-553.392) (-552.084) (-550.205) [-553.714] * (-552.087) (-550.105) [-552.149] (-554.135) -- 0:00:16
728500 -- [-553.228] (-552.417) (-551.748) (-551.834) * (-550.956) [-549.667] (-554.330) (-552.602) -- 0:00:16
729000 -- (-551.246) [-551.934] (-552.172) (-550.700) * (-550.107) [-551.239] (-561.003) (-550.212) -- 0:00:16
729500 -- [-550.715] (-554.202) (-550.812) (-551.873) * [-554.462] (-550.844) (-550.707) (-549.610) -- 0:00:16
730000 -- (-549.359) (-552.962) (-551.868) [-553.044] * (-551.083) (-552.628) (-550.803) [-550.242] -- 0:00:16
Average standard deviation of split frequencies: 0.008911
730500 -- (-555.011) (-552.386) (-552.074) [-550.252] * (-552.086) (-553.062) [-550.898] (-550.158) -- 0:00:16
731000 -- [-550.183] (-551.536) (-552.221) (-550.603) * (-550.098) (-552.190) (-551.239) [-552.215] -- 0:00:16
731500 -- (-552.361) [-553.511] (-550.718) (-551.228) * (-557.603) (-551.465) [-549.969] (-549.725) -- 0:00:16
732000 -- [-550.455] (-551.612) (-550.164) (-551.441) * (-561.195) [-551.437] (-551.878) (-554.570) -- 0:00:16
732500 -- (-551.207) (-553.984) [-551.838] (-551.457) * [-551.842] (-550.407) (-550.085) (-552.693) -- 0:00:16
733000 -- [-552.702] (-556.661) (-550.530) (-552.844) * (-551.425) (-552.931) [-550.788] (-551.962) -- 0:00:16
733500 -- (-554.350) (-550.312) (-554.678) [-550.707] * (-553.037) [-554.573] (-553.820) (-561.450) -- 0:00:15
734000 -- (-553.115) (-549.905) (-553.310) [-550.919] * [-551.675] (-554.142) (-553.902) (-550.598) -- 0:00:15
734500 -- [-549.438] (-550.836) (-552.342) (-551.923) * (-549.260) (-551.591) (-560.176) [-551.058] -- 0:00:15
735000 -- [-549.837] (-552.084) (-552.790) (-552.063) * (-550.134) (-552.908) (-550.406) [-551.212] -- 0:00:15
Average standard deviation of split frequencies: 0.008687
735500 -- (-550.103) (-551.505) [-550.943] (-551.271) * (-552.323) (-553.471) [-552.499] (-551.663) -- 0:00:15
736000 -- (-552.269) [-552.163] (-550.639) (-551.532) * (-550.474) [-551.703] (-549.686) (-549.883) -- 0:00:15
736500 -- (-552.805) [-549.826] (-553.399) (-554.543) * (-553.081) (-550.777) [-550.326] (-549.455) -- 0:00:15
737000 -- (-552.948) [-550.357] (-554.440) (-553.512) * [-551.289] (-555.094) (-550.971) (-553.766) -- 0:00:15
737500 -- (-556.850) [-552.356] (-551.998) (-549.471) * (-552.133) [-551.849] (-550.201) (-550.328) -- 0:00:16
738000 -- (-553.882) (-550.641) [-550.499] (-549.494) * (-551.843) [-553.263] (-551.706) (-550.883) -- 0:00:15
738500 -- [-550.510] (-553.351) (-551.559) (-552.536) * [-554.682] (-550.945) (-549.288) (-551.931) -- 0:00:15
739000 -- (-551.027) (-555.946) [-550.293] (-550.998) * (-552.721) (-553.964) (-553.739) [-552.888] -- 0:00:15
739500 -- (-550.118) [-552.631] (-556.603) (-551.123) * (-551.844) (-552.583) [-553.518] (-549.674) -- 0:00:15
740000 -- [-550.947] (-553.286) (-550.815) (-552.473) * [-550.396] (-550.025) (-551.876) (-551.902) -- 0:00:15
Average standard deviation of split frequencies: 0.008019
740500 -- [-549.646] (-550.784) (-554.475) (-551.755) * (-562.381) (-551.207) [-552.263] (-551.952) -- 0:00:15
741000 -- (-552.848) (-552.523) [-550.294] (-552.760) * [-549.886] (-555.606) (-550.365) (-552.531) -- 0:00:15
741500 -- (-550.837) (-553.094) [-550.263] (-552.364) * (-553.437) [-552.018] (-551.268) (-549.913) -- 0:00:15
742000 -- (-551.448) [-553.017] (-550.293) (-555.454) * (-550.255) [-552.352] (-551.295) (-549.495) -- 0:00:15
742500 -- [-553.475] (-554.879) (-550.025) (-554.538) * [-552.124] (-554.842) (-552.544) (-550.100) -- 0:00:15
743000 -- (-554.085) (-550.347) [-553.863] (-553.496) * [-550.449] (-555.750) (-549.544) (-550.315) -- 0:00:15
743500 -- [-551.755] (-551.967) (-553.008) (-550.687) * (-549.909) (-554.301) (-552.673) [-549.674] -- 0:00:15
744000 -- (-551.934) (-552.711) [-550.301] (-551.859) * (-550.540) (-551.363) (-551.306) [-549.722] -- 0:00:15
744500 -- (-556.662) (-550.331) (-552.265) [-550.577] * (-553.024) (-551.916) (-551.232) [-549.704] -- 0:00:15
745000 -- (-551.275) (-551.271) (-550.105) [-550.343] * [-551.356] (-550.808) (-550.173) (-550.644) -- 0:00:15
Average standard deviation of split frequencies: 0.007794
745500 -- [-552.890] (-553.662) (-549.524) (-551.439) * [-552.353] (-551.074) (-549.776) (-549.720) -- 0:00:15
746000 -- (-553.883) [-551.541] (-553.576) (-554.086) * (-552.690) (-550.496) [-552.429] (-551.502) -- 0:00:15
746500 -- (-556.835) (-552.299) (-552.803) [-551.746] * [-556.703] (-553.359) (-552.097) (-551.584) -- 0:00:15
747000 -- (-552.794) [-550.838] (-551.603) (-549.786) * [-550.695] (-550.638) (-550.707) (-550.179) -- 0:00:15
747500 -- [-550.743] (-555.656) (-550.659) (-551.223) * (-550.246) [-552.526] (-549.305) (-552.134) -- 0:00:15
748000 -- (-552.675) (-555.170) (-553.353) [-553.021] * [-549.931] (-551.062) (-551.932) (-552.256) -- 0:00:15
748500 -- (-551.348) (-552.467) (-554.446) [-549.705] * [-551.392] (-549.872) (-551.283) (-553.998) -- 0:00:15
749000 -- (-550.290) (-556.058) (-549.211) [-550.050] * (-549.092) [-551.156] (-553.655) (-551.329) -- 0:00:15
749500 -- (-550.474) (-550.324) (-550.532) [-551.740] * [-550.468] (-551.154) (-553.061) (-550.553) -- 0:00:15
750000 -- [-549.506] (-551.748) (-549.499) (-553.738) * (-551.348) [-550.304] (-550.872) (-551.230) -- 0:00:15
Average standard deviation of split frequencies: 0.007954
750500 -- (-549.506) (-554.059) [-551.952] (-556.723) * (-550.743) (-551.924) [-552.766] (-550.723) -- 0:00:14
751000 -- (-551.386) (-551.388) [-551.883] (-554.314) * (-550.592) [-550.230] (-555.645) (-551.048) -- 0:00:14
751500 -- (-550.870) [-550.234] (-551.886) (-551.781) * (-549.808) (-553.542) [-555.574] (-552.073) -- 0:00:14
752000 -- (-554.013) [-550.821] (-551.054) (-551.734) * (-549.703) (-553.520) (-552.475) [-551.432] -- 0:00:14
752500 -- (-550.927) (-549.677) [-551.271] (-550.557) * (-551.460) (-550.139) [-552.335] (-550.778) -- 0:00:14
753000 -- (-551.070) (-551.416) [-552.616] (-550.992) * (-549.946) [-551.515] (-553.210) (-550.601) -- 0:00:14
753500 -- [-550.842] (-553.273) (-553.734) (-552.279) * (-551.281) (-550.245) [-553.436] (-555.807) -- 0:00:14
754000 -- (-552.946) (-551.126) (-553.454) [-549.643] * (-551.775) [-549.781] (-551.140) (-552.864) -- 0:00:14
754500 -- [-552.774] (-549.879) (-552.373) (-550.876) * (-550.317) (-550.064) [-552.112] (-553.559) -- 0:00:14
755000 -- [-552.417] (-550.720) (-552.314) (-549.416) * (-553.574) (-553.465) [-550.831] (-553.620) -- 0:00:14
Average standard deviation of split frequencies: 0.008231
755500 -- (-554.748) (-551.589) [-552.521] (-552.806) * (-550.585) (-549.345) [-549.239] (-550.833) -- 0:00:14
756000 -- (-551.316) (-553.190) (-551.817) [-552.174] * (-550.610) (-550.498) [-550.996] (-551.473) -- 0:00:14
756500 -- [-552.006] (-551.785) (-550.424) (-551.774) * (-554.287) [-549.729] (-550.708) (-554.227) -- 0:00:14
757000 -- (-553.265) [-549.876] (-552.306) (-549.309) * [-553.006] (-553.358) (-551.800) (-549.866) -- 0:00:14
757500 -- (-554.318) [-550.028] (-552.331) (-552.305) * (-557.594) (-550.992) [-550.793] (-549.689) -- 0:00:14
758000 -- (-554.010) (-549.663) (-551.074) [-549.422] * (-552.103) (-550.274) [-549.947] (-550.640) -- 0:00:14
758500 -- [-549.833] (-549.080) (-550.157) (-550.538) * (-552.521) (-551.061) (-553.971) [-550.654] -- 0:00:14
759000 -- [-551.774] (-551.879) (-555.293) (-551.693) * (-552.036) (-555.395) (-552.972) [-552.975] -- 0:00:14
759500 -- (-550.581) [-554.799] (-553.987) (-552.118) * [-553.327] (-550.688) (-551.843) (-561.795) -- 0:00:14
760000 -- (-549.960) (-551.715) [-554.709] (-551.175) * (-552.120) (-550.440) (-551.530) [-551.284] -- 0:00:14
Average standard deviation of split frequencies: 0.008511
760500 -- (-550.162) [-551.936] (-550.485) (-553.547) * (-552.455) (-551.475) (-552.341) [-550.326] -- 0:00:14
761000 -- [-552.937] (-555.414) (-550.746) (-554.297) * (-552.026) (-551.761) (-554.248) [-550.784] -- 0:00:14
761500 -- (-550.767) (-552.115) (-552.374) [-552.171] * (-553.245) (-553.436) [-552.491] (-554.844) -- 0:00:14
762000 -- (-552.610) (-551.613) [-551.997] (-549.929) * [-552.192] (-553.093) (-551.006) (-549.898) -- 0:00:14
762500 -- (-551.896) (-555.129) (-551.136) [-550.008] * (-556.655) [-551.112] (-550.234) (-551.243) -- 0:00:14
763000 -- (-552.551) (-553.306) [-550.185] (-549.980) * (-551.793) (-550.629) [-552.045] (-550.455) -- 0:00:14
763500 -- (-552.596) (-556.435) [-550.216] (-558.025) * (-552.684) [-551.363] (-552.886) (-551.196) -- 0:00:14
764000 -- [-550.895] (-553.759) (-549.678) (-555.544) * (-551.666) (-549.418) (-551.819) [-551.733] -- 0:00:14
764500 -- (-551.086) [-552.809] (-549.936) (-549.759) * (-558.236) (-549.831) [-551.241] (-552.865) -- 0:00:14
765000 -- [-552.755] (-551.044) (-549.663) (-550.375) * (-552.230) (-555.339) [-550.390] (-551.021) -- 0:00:14
Average standard deviation of split frequencies: 0.009039
765500 -- (-549.398) (-550.776) [-550.176] (-554.611) * (-551.958) (-551.122) (-553.336) [-549.807] -- 0:00:14
766000 -- (-554.471) (-550.443) (-551.795) [-553.840] * [-550.635] (-551.458) (-555.467) (-552.463) -- 0:00:14
766500 -- [-551.557] (-551.808) (-551.228) (-550.536) * (-550.393) (-549.916) [-549.625] (-549.959) -- 0:00:14
767000 -- (-549.307) (-551.323) [-552.009] (-550.653) * (-554.756) (-551.254) [-551.280] (-550.260) -- 0:00:13
767500 -- (-552.205) (-556.299) [-551.782] (-552.891) * (-551.338) (-550.389) [-552.919] (-553.799) -- 0:00:13
768000 -- [-549.507] (-554.827) (-550.921) (-553.023) * (-551.221) (-550.880) (-554.555) [-552.338] -- 0:00:13
768500 -- (-551.787) (-555.905) [-552.330] (-553.249) * [-550.100] (-553.463) (-553.484) (-551.665) -- 0:00:13
769000 -- (-553.001) (-552.597) [-552.386] (-551.648) * (-550.769) [-552.859] (-552.718) (-550.326) -- 0:00:13
769500 -- (-550.205) (-553.742) [-554.486] (-555.918) * (-550.562) (-557.867) [-551.494] (-550.273) -- 0:00:13
770000 -- (-551.693) (-551.584) (-556.451) [-551.532] * [-551.982] (-551.809) (-551.006) (-550.268) -- 0:00:13
Average standard deviation of split frequencies: 0.009061
770500 -- (-552.822) (-553.211) (-552.043) [-551.246] * (-551.439) (-550.726) (-552.257) [-549.895] -- 0:00:13
771000 -- (-554.856) [-553.376] (-551.271) (-549.881) * (-552.025) (-553.666) [-551.507] (-549.841) -- 0:00:13
771500 -- [-552.533] (-553.195) (-550.238) (-551.240) * (-550.627) (-553.721) (-552.850) [-549.929] -- 0:00:13
772000 -- [-552.687] (-554.907) (-549.628) (-550.965) * [-552.025] (-557.859) (-552.802) (-549.999) -- 0:00:13
772500 -- (-550.848) (-553.027) (-554.436) [-552.067] * [-552.178] (-552.301) (-553.331) (-555.735) -- 0:00:13
773000 -- [-550.541] (-556.237) (-550.937) (-550.666) * [-550.877] (-550.169) (-552.465) (-556.987) -- 0:00:13
773500 -- [-551.521] (-551.986) (-551.167) (-549.718) * (-551.593) [-554.438] (-552.352) (-552.768) -- 0:00:13
774000 -- [-551.907] (-550.624) (-552.253) (-551.421) * [-552.030] (-553.829) (-550.335) (-551.477) -- 0:00:13
774500 -- (-551.623) [-552.950] (-557.064) (-552.670) * (-550.310) (-552.239) (-549.620) [-551.296] -- 0:00:13
775000 -- (-550.954) (-550.507) [-555.218] (-551.079) * (-552.268) [-553.532] (-553.533) (-551.656) -- 0:00:13
Average standard deviation of split frequencies: 0.008846
775500 -- (-551.961) (-551.001) [-553.070] (-549.757) * (-555.829) (-551.504) (-553.744) [-551.086] -- 0:00:13
776000 -- (-551.234) [-551.437] (-552.103) (-549.595) * (-552.293) (-559.114) [-550.102] (-549.739) -- 0:00:13
776500 -- (-551.986) (-552.129) [-551.195] (-550.567) * [-549.925] (-553.726) (-550.471) (-549.837) -- 0:00:13
777000 -- (-552.438) (-551.336) [-551.503] (-550.229) * (-551.618) (-550.562) [-550.015] (-554.720) -- 0:00:13
777500 -- [-550.051] (-550.913) (-552.644) (-551.040) * (-550.524) (-551.818) (-550.413) [-549.806] -- 0:00:13
778000 -- [-550.467] (-550.895) (-552.359) (-551.839) * (-551.836) [-554.927] (-551.770) (-551.985) -- 0:00:13
778500 -- [-552.038] (-552.409) (-552.775) (-550.729) * [-550.480] (-553.376) (-554.382) (-550.461) -- 0:00:13
779000 -- [-549.766] (-554.728) (-553.019) (-550.493) * (-549.869) (-555.928) (-552.220) [-550.162] -- 0:00:13
779500 -- (-550.666) (-551.051) (-552.196) [-551.187] * (-551.930) (-549.638) [-549.949] (-552.714) -- 0:00:13
780000 -- (-553.187) (-551.596) [-550.836] (-552.792) * [-551.292] (-551.030) (-550.066) (-553.300) -- 0:00:13
Average standard deviation of split frequencies: 0.008615
780500 -- [-550.374] (-550.561) (-551.559) (-550.196) * (-550.516) (-551.136) [-551.919] (-553.869) -- 0:00:13
781000 -- (-551.224) (-550.400) [-549.463] (-550.308) * (-550.104) (-555.495) [-552.445] (-551.548) -- 0:00:13
781500 -- (-550.546) [-550.675] (-551.418) (-550.707) * (-553.424) (-554.104) [-550.615] (-553.634) -- 0:00:13
782000 -- (-551.308) (-550.050) (-549.838) [-553.555] * (-551.299) (-550.443) [-557.502] (-554.711) -- 0:00:13
782500 -- [-550.940] (-549.816) (-555.079) (-551.224) * (-549.954) (-551.611) [-551.226] (-549.827) -- 0:00:13
783000 -- (-550.201) (-550.166) (-553.566) [-551.451] * (-551.245) [-551.253] (-554.606) (-552.711) -- 0:00:13
783500 -- (-550.000) (-551.565) (-550.069) [-550.404] * [-549.410] (-552.247) (-555.320) (-551.486) -- 0:00:12
784000 -- (-553.375) (-551.172) (-551.652) [-551.062] * [-551.329] (-554.288) (-550.358) (-550.511) -- 0:00:12
784500 -- [-550.198] (-561.250) (-551.852) (-552.041) * (-550.680) (-554.900) [-551.765] (-553.824) -- 0:00:12
785000 -- [-550.176] (-555.947) (-552.007) (-550.927) * (-552.304) (-551.034) (-550.329) [-553.440] -- 0:00:12
Average standard deviation of split frequencies: 0.008357
785500 -- (-553.519) (-559.226) [-553.199] (-550.604) * [-556.600] (-554.067) (-551.033) (-552.342) -- 0:00:12
786000 -- [-552.952] (-551.466) (-550.523) (-550.354) * [-551.200] (-551.816) (-552.052) (-552.857) -- 0:00:12
786500 -- [-551.472] (-551.136) (-553.269) (-550.553) * [-552.000] (-554.065) (-550.195) (-554.012) -- 0:00:12
787000 -- (-553.803) (-551.249) [-551.548] (-550.562) * (-551.135) [-551.604] (-552.316) (-561.427) -- 0:00:12
787500 -- (-552.131) [-552.722] (-552.782) (-554.891) * (-550.317) [-549.658] (-554.051) (-556.964) -- 0:00:12
788000 -- (-550.952) (-552.103) [-551.934] (-553.379) * (-551.087) (-551.651) (-551.042) [-559.855] -- 0:00:12
788500 -- [-550.540] (-550.634) (-550.221) (-552.464) * (-551.304) (-551.076) [-550.274] (-554.063) -- 0:00:12
789000 -- (-550.954) (-551.202) [-549.829] (-551.148) * (-551.585) (-553.073) [-552.580] (-551.059) -- 0:00:12
789500 -- (-551.712) (-557.687) (-551.665) [-551.625] * (-557.305) [-553.606] (-551.433) (-553.443) -- 0:00:12
790000 -- (-553.290) (-553.101) [-551.122] (-552.080) * (-551.027) (-552.121) (-552.679) [-553.254] -- 0:00:12
Average standard deviation of split frequencies: 0.007711
790500 -- (-553.350) (-552.084) [-551.450] (-552.494) * (-549.942) [-550.734] (-552.933) (-549.645) -- 0:00:12
791000 -- (-551.464) (-557.144) (-550.190) [-550.036] * (-550.095) [-549.587] (-550.867) (-553.623) -- 0:00:12
791500 -- (-549.513) (-552.725) (-550.528) [-549.451] * (-552.959) (-552.863) [-550.066] (-550.697) -- 0:00:12
792000 -- (-549.977) [-552.922] (-551.260) (-550.569) * [-549.613] (-551.605) (-551.683) (-550.714) -- 0:00:12
792500 -- (-551.000) (-552.247) (-553.602) [-551.067] * [-549.365] (-550.223) (-552.695) (-549.993) -- 0:00:12
793000 -- (-552.811) [-550.075] (-550.033) (-549.947) * (-550.953) [-552.904] (-551.841) (-552.571) -- 0:00:12
793500 -- (-551.908) (-551.792) [-552.750] (-551.974) * [-550.648] (-550.739) (-550.488) (-551.112) -- 0:00:12
794000 -- (-551.801) [-549.185] (-552.672) (-551.595) * [-552.530] (-552.676) (-556.028) (-551.226) -- 0:00:12
794500 -- (-552.111) (-552.740) [-552.286] (-549.779) * (-551.218) (-555.638) (-552.379) [-549.491] -- 0:00:12
795000 -- (-549.818) (-553.911) [-551.283] (-551.417) * (-553.191) (-553.060) (-550.257) [-549.492] -- 0:00:12
Average standard deviation of split frequencies: 0.007817
795500 -- (-553.221) (-553.236) [-552.441] (-550.687) * (-550.920) (-550.602) [-550.407] (-550.405) -- 0:00:12
796000 -- [-558.190] (-551.301) (-550.348) (-549.993) * (-552.151) (-553.568) [-551.258] (-550.074) -- 0:00:12
796500 -- (-552.036) (-552.549) (-550.300) [-549.183] * [-551.484] (-551.852) (-549.639) (-553.487) -- 0:00:12
797000 -- [-551.546] (-551.954) (-555.920) (-549.529) * [-549.925] (-562.494) (-549.263) (-552.379) -- 0:00:12
797500 -- (-551.453) [-556.001] (-551.901) (-550.114) * (-550.871) (-549.811) [-553.073] (-551.477) -- 0:00:12
798000 -- (-550.040) (-550.049) [-549.708] (-552.705) * (-552.725) (-553.905) (-551.894) [-554.669] -- 0:00:12
798500 -- (-551.386) (-552.774) (-553.409) [-552.162] * (-549.183) (-551.855) (-555.129) [-552.481] -- 0:00:12
799000 -- (-552.248) (-551.491) [-550.582] (-554.642) * (-552.423) (-551.476) [-553.985] (-549.984) -- 0:00:12
799500 -- [-550.014] (-550.546) (-549.966) (-553.562) * (-552.154) (-552.732) [-549.601] (-552.253) -- 0:00:12
800000 -- [-553.350] (-551.338) (-550.614) (-555.849) * [-552.625] (-557.202) (-549.924) (-552.510) -- 0:00:12
Average standard deviation of split frequencies: 0.007340
800500 -- [-550.996] (-552.231) (-550.303) (-551.143) * [-550.548] (-549.867) (-550.860) (-549.429) -- 0:00:11
801000 -- [-549.645] (-549.709) (-556.001) (-550.450) * (-551.985) [-549.965] (-555.048) (-551.762) -- 0:00:11
801500 -- (-551.396) (-555.172) (-550.761) [-551.804] * (-551.235) [-550.880] (-554.190) (-553.027) -- 0:00:11
802000 -- (-553.156) (-555.655) (-550.296) [-550.399] * [-553.249] (-552.245) (-552.543) (-552.431) -- 0:00:11
802500 -- (-552.702) (-549.768) (-550.238) [-554.620] * (-553.890) [-550.516] (-552.540) (-550.825) -- 0:00:11
803000 -- (-552.518) (-551.156) (-551.177) [-554.973] * (-550.308) (-551.529) [-551.503] (-553.351) -- 0:00:11
803500 -- (-552.873) (-553.486) (-552.950) [-552.824] * (-555.428) (-550.287) (-551.159) [-551.722] -- 0:00:11
804000 -- (-549.944) (-550.278) [-549.875] (-550.395) * (-554.127) [-552.176] (-553.396) (-554.760) -- 0:00:11
804500 -- (-551.288) (-550.411) (-556.555) [-550.211] * (-553.604) (-551.190) [-556.405] (-550.687) -- 0:00:11
805000 -- (-553.896) [-549.948] (-555.213) (-550.385) * (-555.229) [-553.373] (-552.282) (-553.569) -- 0:00:11
Average standard deviation of split frequencies: 0.007408
805500 -- (-551.885) [-549.383] (-551.544) (-550.885) * (-551.329) (-552.188) (-550.865) [-551.282] -- 0:00:11
806000 -- (-552.329) (-550.833) [-550.876] (-551.763) * (-552.899) (-549.967) [-552.262] (-556.007) -- 0:00:11
806500 -- (-549.409) (-550.271) (-553.873) [-552.800] * (-549.945) (-550.829) (-550.406) [-551.065] -- 0:00:11
807000 -- (-550.621) (-551.570) (-559.526) [-551.476] * (-550.285) (-551.988) (-556.120) [-549.494] -- 0:00:11
807500 -- (-550.132) [-549.622] (-557.267) (-549.979) * [-555.224] (-555.094) (-550.118) (-549.936) -- 0:00:11
808000 -- (-549.597) [-551.276] (-551.653) (-553.699) * (-550.780) [-550.333] (-550.771) (-550.667) -- 0:00:11
808500 -- [-552.109] (-550.762) (-549.823) (-552.389) * (-550.603) [-550.103] (-553.728) (-551.664) -- 0:00:11
809000 -- (-552.261) [-550.976] (-551.203) (-550.779) * [-550.909] (-552.462) (-551.785) (-550.969) -- 0:00:11
809500 -- (-554.607) (-549.859) (-550.724) [-550.601] * (-551.622) (-553.651) [-549.479] (-550.694) -- 0:00:11
810000 -- (-553.017) (-550.204) (-552.109) [-552.538] * (-551.299) [-551.262] (-550.341) (-551.589) -- 0:00:11
Average standard deviation of split frequencies: 0.007366
810500 -- (-554.113) (-550.830) (-555.775) [-550.008] * [-552.068] (-551.269) (-550.678) (-551.119) -- 0:00:11
811000 -- (-551.111) (-560.332) [-550.992] (-552.333) * [-551.699] (-550.831) (-553.574) (-552.655) -- 0:00:11
811500 -- (-552.166) [-552.536] (-553.282) (-550.838) * (-552.061) [-551.789] (-552.385) (-552.221) -- 0:00:11
812000 -- (-550.443) (-551.984) [-554.406] (-550.114) * (-555.692) [-549.779] (-550.202) (-552.333) -- 0:00:11
812500 -- (-550.713) [-551.729] (-555.287) (-550.031) * [-552.362] (-553.353) (-552.743) (-550.462) -- 0:00:11
813000 -- (-551.504) (-552.823) [-551.130] (-551.961) * (-550.091) (-550.701) (-551.218) [-556.767] -- 0:00:11
813500 -- (-550.354) (-550.919) [-553.734] (-550.496) * [-549.744] (-552.351) (-550.525) (-555.022) -- 0:00:11
814000 -- (-551.096) (-552.352) (-554.297) [-550.247] * (-551.812) [-553.057] (-553.835) (-550.756) -- 0:00:11
814500 -- [-551.660] (-550.328) (-558.328) (-551.115) * (-551.818) (-550.840) (-552.858) [-549.577] -- 0:00:11
815000 -- (-552.842) [-551.890] (-552.770) (-549.750) * (-552.697) (-549.865) (-551.440) [-551.552] -- 0:00:11
Average standard deviation of split frequencies: 0.007727
815500 -- [-553.377] (-552.970) (-551.867) (-550.287) * (-551.753) [-549.816] (-553.155) (-550.031) -- 0:00:11
816000 -- [-551.898] (-553.314) (-550.798) (-550.368) * (-553.277) (-553.444) (-551.054) [-551.329] -- 0:00:11
816500 -- (-553.350) (-553.981) (-550.219) [-550.058] * (-552.737) (-552.571) (-550.389) [-550.546] -- 0:00:11
817000 -- [-553.329] (-551.951) (-550.251) (-551.305) * (-553.594) [-553.762] (-550.242) (-550.422) -- 0:00:10
817500 -- [-550.818] (-549.898) (-551.328) (-549.974) * (-550.610) [-550.644] (-550.622) (-552.435) -- 0:00:10
818000 -- (-549.843) (-550.177) (-552.011) [-552.425] * (-550.435) (-551.715) [-552.369] (-550.162) -- 0:00:10
818500 -- (-550.083) (-550.939) (-554.811) [-550.745] * (-550.156) (-549.480) (-551.946) [-552.780] -- 0:00:10
819000 -- (-550.109) (-552.013) (-549.917) [-552.529] * (-551.279) (-551.990) [-550.122] (-551.310) -- 0:00:10
819500 -- (-553.449) (-555.346) [-550.997] (-551.477) * (-552.700) [-549.409] (-551.720) (-549.322) -- 0:00:10
820000 -- (-554.089) (-553.422) (-549.394) [-551.527] * (-551.642) (-549.620) (-550.475) [-552.414] -- 0:00:10
Average standard deviation of split frequencies: 0.008042
820500 -- (-550.403) (-551.958) (-551.420) [-550.927] * (-550.683) (-552.966) [-550.900] (-552.017) -- 0:00:10
821000 -- (-556.691) (-552.051) (-552.091) [-554.837] * (-552.203) [-549.723] (-553.770) (-552.594) -- 0:00:10
821500 -- (-549.790) [-550.909] (-552.161) (-553.460) * (-551.005) (-550.915) [-550.648] (-553.261) -- 0:00:10
822000 -- (-551.500) (-550.146) [-550.756] (-552.769) * (-551.143) [-550.376] (-550.990) (-551.810) -- 0:00:10
822500 -- (-550.310) (-552.643) [-550.212] (-551.409) * (-554.152) [-554.733] (-550.676) (-550.631) -- 0:00:10
823000 -- (-549.441) (-550.795) [-550.061] (-551.549) * (-549.853) (-551.346) [-551.341] (-553.457) -- 0:00:10
823500 -- (-552.005) (-549.401) [-549.597] (-555.087) * (-552.830) [-554.900] (-550.054) (-552.390) -- 0:00:10
824000 -- (-557.820) (-555.503) [-550.128] (-552.483) * (-551.943) (-551.377) (-552.472) [-549.425] -- 0:00:10
824500 -- (-551.815) (-549.677) (-549.884) [-550.545] * (-551.428) (-552.265) (-553.005) [-550.535] -- 0:00:10
825000 -- [-550.721] (-552.463) (-550.009) (-552.903) * (-550.071) (-552.159) [-551.645] (-552.308) -- 0:00:10
Average standard deviation of split frequencies: 0.007669
825500 -- (-550.395) [-553.857] (-552.209) (-551.788) * (-551.866) (-557.853) [-549.977] (-552.046) -- 0:00:10
826000 -- (-551.437) [-549.835] (-553.431) (-550.852) * [-550.656] (-552.690) (-549.546) (-550.081) -- 0:00:10
826500 -- (-555.086) (-551.148) [-556.776] (-551.296) * [-550.611] (-553.248) (-550.828) (-554.317) -- 0:00:10
827000 -- (-551.672) [-550.482] (-551.096) (-556.411) * [-552.614] (-553.101) (-558.295) (-552.976) -- 0:00:10
827500 -- (-550.385) (-549.964) (-549.913) [-552.831] * (-551.774) (-552.625) [-549.585] (-550.731) -- 0:00:10
828000 -- (-550.590) (-551.597) [-551.762] (-556.116) * (-551.768) (-552.635) (-551.001) [-551.177] -- 0:00:10
828500 -- (-551.657) (-555.354) (-552.343) [-555.170] * (-553.536) (-553.462) (-552.312) [-550.280] -- 0:00:10
829000 -- (-552.330) [-550.537] (-551.598) (-552.737) * (-551.914) [-550.828] (-557.989) (-552.104) -- 0:00:10
829500 -- (-550.561) (-551.429) (-551.093) [-552.701] * [-549.824] (-549.840) (-553.752) (-550.674) -- 0:00:10
830000 -- [-554.935] (-553.875) (-552.063) (-551.554) * (-554.840) (-549.219) [-554.995] (-551.046) -- 0:00:10
Average standard deviation of split frequencies: 0.007590
830500 -- (-553.518) [-554.064] (-549.723) (-550.599) * [-552.575] (-550.239) (-550.389) (-550.800) -- 0:00:10
831000 -- (-551.699) (-553.602) (-551.032) [-549.715] * (-553.727) [-550.971] (-552.034) (-552.511) -- 0:00:10
831500 -- (-550.065) (-550.277) [-550.122] (-552.226) * (-552.653) (-552.743) (-550.829) [-555.049] -- 0:00:10
832000 -- (-550.764) [-549.948] (-550.429) (-551.185) * (-550.539) [-549.441] (-554.384) (-551.712) -- 0:00:10
832500 -- [-552.386] (-549.761) (-550.932) (-551.846) * (-551.568) (-549.751) [-551.524] (-553.677) -- 0:00:10
833000 -- (-550.214) (-551.577) (-551.084) [-551.183] * [-553.231] (-550.118) (-557.631) (-552.574) -- 0:00:10
833500 -- (-550.307) (-550.761) [-552.726] (-552.145) * (-554.336) (-554.962) (-552.981) [-555.423] -- 0:00:09
834000 -- (-551.046) [-552.716] (-551.887) (-551.046) * (-550.222) (-550.011) (-549.710) [-551.471] -- 0:00:09
834500 -- (-549.596) [-549.962] (-556.768) (-554.201) * (-550.706) (-552.400) [-551.444] (-551.845) -- 0:00:09
835000 -- (-550.925) [-551.526] (-554.630) (-555.749) * [-552.055] (-550.548) (-551.801) (-553.084) -- 0:00:09
Average standard deviation of split frequencies: 0.007507
835500 -- [-550.989] (-549.368) (-551.842) (-551.535) * [-553.782] (-550.793) (-556.224) (-551.240) -- 0:00:09
836000 -- [-550.186] (-550.574) (-551.647) (-552.290) * (-551.320) [-555.123] (-552.145) (-552.141) -- 0:00:09
836500 -- [-550.179] (-549.469) (-553.021) (-555.153) * (-549.989) (-554.155) (-554.959) [-551.283] -- 0:00:09
837000 -- (-549.775) (-550.765) (-550.042) [-551.819] * (-550.856) (-551.940) [-556.499] (-552.149) -- 0:00:09
837500 -- (-549.812) [-550.441] (-549.900) (-550.689) * (-551.463) [-550.970] (-552.147) (-553.977) -- 0:00:09
838000 -- (-550.318) (-551.129) (-552.053) [-550.494] * [-552.059] (-552.353) (-551.472) (-551.913) -- 0:00:09
838500 -- (-549.429) (-551.070) (-550.802) [-549.975] * (-555.351) (-555.140) [-550.129] (-550.066) -- 0:00:09
839000 -- (-555.894) (-554.450) [-550.277] (-550.099) * (-549.685) (-550.736) [-551.710] (-551.598) -- 0:00:09
839500 -- (-556.521) [-551.461] (-551.092) (-551.155) * (-554.701) [-549.529] (-552.029) (-552.990) -- 0:00:09
840000 -- (-551.549) (-553.993) (-551.855) [-550.822] * (-550.744) (-552.062) (-553.719) [-550.815] -- 0:00:09
Average standard deviation of split frequencies: 0.007640
840500 -- (-552.971) (-554.084) [-552.944] (-550.460) * [-551.458] (-552.316) (-555.460) (-550.789) -- 0:00:09
841000 -- (-550.986) (-552.572) [-551.739] (-550.922) * (-550.846) (-553.018) (-550.166) [-549.864] -- 0:00:09
841500 -- (-551.954) (-552.798) (-552.219) [-550.587] * (-552.559) (-550.156) [-550.055] (-550.251) -- 0:00:09
842000 -- (-550.663) (-554.185) [-549.658] (-551.177) * (-551.260) [-552.720] (-550.451) (-550.592) -- 0:00:09
842500 -- (-552.782) (-554.263) [-551.041] (-552.058) * [-553.145] (-552.958) (-549.347) (-549.552) -- 0:00:09
843000 -- (-551.029) (-554.359) (-552.051) [-553.204] * (-553.903) (-558.557) (-550.467) [-549.524] -- 0:00:09
843500 -- [-550.557] (-553.886) (-550.135) (-553.931) * [-550.254] (-551.663) (-550.174) (-556.196) -- 0:00:09
844000 -- [-550.851] (-552.647) (-549.808) (-553.121) * [-551.488] (-550.848) (-554.117) (-555.112) -- 0:00:09
844500 -- (-552.255) (-550.760) [-551.033] (-553.212) * (-553.874) [-549.218] (-554.589) (-551.539) -- 0:00:09
845000 -- (-552.353) (-555.173) (-554.255) [-552.395] * (-551.647) [-549.885] (-551.196) (-552.986) -- 0:00:09
Average standard deviation of split frequencies: 0.007697
845500 -- (-550.573) [-551.599] (-549.709) (-556.197) * [-551.232] (-551.691) (-549.348) (-549.889) -- 0:00:09
846000 -- (-550.321) (-551.203) [-552.632] (-552.989) * [-552.401] (-550.900) (-551.190) (-551.670) -- 0:00:09
846500 -- [-550.169] (-550.378) (-553.823) (-554.427) * (-550.717) (-552.431) (-549.938) [-553.874] -- 0:00:09
847000 -- (-549.880) [-551.904] (-554.389) (-553.743) * (-551.383) (-550.457) [-549.680] (-551.541) -- 0:00:09
847500 -- (-551.466) (-555.816) (-555.222) [-551.253] * [-551.349] (-551.660) (-555.752) (-552.326) -- 0:00:09
848000 -- (-549.270) (-555.776) [-552.280] (-549.501) * [-552.502] (-549.754) (-553.179) (-554.140) -- 0:00:09
848500 -- (-556.776) (-550.430) (-554.911) [-550.140] * (-551.890) (-552.417) [-552.164] (-553.198) -- 0:00:09
849000 -- (-553.828) (-551.573) (-549.956) [-550.708] * (-551.971) (-553.469) [-550.443] (-555.700) -- 0:00:09
849500 -- (-553.395) (-550.574) (-550.664) [-551.583] * (-553.463) (-556.678) [-550.238] (-550.383) -- 0:00:09
850000 -- (-552.950) [-550.799] (-551.944) (-552.036) * [-553.287] (-549.427) (-552.184) (-552.260) -- 0:00:09
Average standard deviation of split frequencies: 0.007100
850500 -- [-553.479] (-550.362) (-560.829) (-551.601) * (-551.750) [-549.764] (-550.694) (-552.359) -- 0:00:08
851000 -- (-552.888) [-550.457] (-556.121) (-549.809) * (-551.711) [-551.859] (-554.941) (-551.603) -- 0:00:08
851500 -- [-549.713] (-554.443) (-551.217) (-549.851) * (-556.740) [-549.929] (-551.569) (-549.940) -- 0:00:08
852000 -- [-550.484] (-549.811) (-553.197) (-549.655) * (-553.393) (-550.260) (-553.920) [-552.474] -- 0:00:08
852500 -- (-551.361) (-551.343) [-554.457] (-552.966) * (-550.810) (-549.333) [-553.395] (-550.476) -- 0:00:08
853000 -- [-551.576] (-551.064) (-550.605) (-550.375) * (-551.203) (-550.765) (-550.639) [-551.583] -- 0:00:08
853500 -- [-550.466] (-550.904) (-551.131) (-550.246) * [-549.724] (-554.645) (-552.789) (-554.817) -- 0:00:08
854000 -- [-550.036] (-550.916) (-552.763) (-551.928) * [-550.070] (-551.088) (-555.374) (-554.530) -- 0:00:08
854500 -- (-550.613) (-553.615) (-550.366) [-552.094] * (-552.361) (-555.711) (-552.799) [-550.582] -- 0:00:08
855000 -- (-551.094) (-551.996) (-550.919) [-554.073] * (-554.234) (-550.644) (-552.646) [-552.899] -- 0:00:08
Average standard deviation of split frequencies: 0.007297
855500 -- (-551.519) (-550.315) (-551.117) [-555.331] * [-554.266] (-550.756) (-551.198) (-551.380) -- 0:00:08
856000 -- (-550.742) [-552.226] (-550.789) (-552.309) * [-550.927] (-552.337) (-557.486) (-550.245) -- 0:00:08
856500 -- (-554.877) (-553.839) [-550.291] (-550.748) * (-551.945) (-556.846) [-550.581] (-552.876) -- 0:00:08
857000 -- (-558.066) [-550.767] (-553.144) (-551.238) * (-550.809) (-551.768) [-551.785] (-551.252) -- 0:00:08
857500 -- (-557.104) (-551.149) (-554.860) [-549.594] * (-551.940) (-551.009) (-550.444) [-550.310] -- 0:00:08
858000 -- [-554.533] (-550.109) (-552.475) (-551.193) * (-552.428) (-553.886) [-549.482] (-550.432) -- 0:00:08
858500 -- (-550.510) [-551.502] (-555.124) (-555.264) * (-550.294) (-550.770) [-551.021] (-551.404) -- 0:00:08
859000 -- [-553.355] (-549.329) (-550.233) (-550.362) * (-555.728) [-553.577] (-551.890) (-550.524) -- 0:00:08
859500 -- (-550.181) (-549.957) [-550.497] (-550.700) * (-551.115) (-552.648) (-549.957) [-551.063] -- 0:00:08
860000 -- (-550.360) [-551.461] (-551.967) (-549.974) * (-553.224) [-549.883] (-552.878) (-550.283) -- 0:00:08
Average standard deviation of split frequencies: 0.007394
860500 -- (-552.035) (-550.600) [-551.671] (-551.594) * (-550.340) [-551.507] (-550.669) (-549.494) -- 0:00:08
861000 -- [-551.119] (-553.293) (-551.175) (-550.338) * (-556.733) [-552.407] (-553.960) (-553.576) -- 0:00:08
861500 -- (-551.839) (-553.053) [-553.036] (-551.664) * (-553.259) (-550.485) [-553.064] (-555.670) -- 0:00:08
862000 -- (-553.438) (-553.580) [-549.758] (-550.395) * (-553.186) (-551.392) [-555.758] (-555.342) -- 0:00:08
862500 -- (-551.770) (-553.329) (-549.350) [-552.394] * (-557.832) (-549.555) (-553.687) [-552.869] -- 0:00:08
863000 -- [-551.024] (-550.924) (-549.958) (-552.659) * [-552.648] (-551.924) (-553.460) (-551.794) -- 0:00:08
863500 -- (-549.779) [-550.010] (-553.101) (-549.981) * [-551.833] (-551.566) (-551.170) (-553.222) -- 0:00:08
864000 -- [-551.067] (-551.830) (-551.078) (-550.323) * (-553.045) (-552.670) (-551.876) [-552.693] -- 0:00:08
864500 -- (-553.104) (-551.403) [-549.426] (-551.008) * (-555.266) (-552.026) (-551.789) [-549.880] -- 0:00:08
865000 -- (-552.390) [-552.704] (-549.426) (-553.160) * (-553.783) [-551.636] (-550.988) (-551.957) -- 0:00:08
Average standard deviation of split frequencies: 0.007417
865500 -- (-551.585) [-551.092] (-549.425) (-551.714) * (-550.369) (-550.245) [-550.931] (-551.582) -- 0:00:08
866000 -- [-556.013] (-553.493) (-550.138) (-551.571) * [-552.052] (-550.795) (-550.283) (-552.942) -- 0:00:08
866500 -- (-555.267) [-551.271] (-552.136) (-553.135) * (-550.337) [-551.895] (-549.863) (-551.228) -- 0:00:08
867000 -- [-552.864] (-549.497) (-551.594) (-551.376) * (-550.149) (-554.504) [-551.878] (-549.877) -- 0:00:07
867500 -- (-554.879) (-550.587) [-550.509] (-555.472) * (-555.887) [-550.494] (-550.997) (-549.679) -- 0:00:07
868000 -- (-553.819) (-549.614) (-551.105) [-549.330] * (-558.235) [-550.754] (-552.188) (-549.903) -- 0:00:07
868500 -- (-550.897) (-551.385) (-550.645) [-550.029] * (-554.288) (-552.416) [-553.237] (-552.259) -- 0:00:07
869000 -- (-552.356) (-550.536) [-550.727] (-550.505) * (-555.079) (-554.598) (-549.455) [-551.801] -- 0:00:07
869500 -- (-552.295) (-554.375) [-551.929] (-553.809) * (-557.680) (-552.851) [-551.630] (-555.706) -- 0:00:07
870000 -- (-551.141) [-551.338] (-555.001) (-552.408) * (-555.755) (-551.754) [-550.228] (-553.419) -- 0:00:07
Average standard deviation of split frequencies: 0.007275
870500 -- (-554.961) (-552.144) (-556.124) [-552.154] * (-552.971) (-550.856) [-549.654] (-550.895) -- 0:00:07
871000 -- (-552.894) (-553.143) [-551.750] (-554.924) * (-553.055) (-549.605) [-551.301] (-559.005) -- 0:00:07
871500 -- [-549.733] (-553.081) (-552.250) (-551.142) * (-551.012) (-553.660) (-550.501) [-553.695] -- 0:00:07
872000 -- (-551.392) (-551.360) [-551.528] (-550.911) * (-550.009) (-554.088) (-551.349) [-549.638] -- 0:00:07
872500 -- [-551.925] (-556.730) (-553.609) (-550.206) * (-552.566) (-550.890) [-550.397] (-550.296) -- 0:00:07
873000 -- (-553.731) (-558.943) [-550.670] (-553.289) * (-550.073) (-552.186) (-551.951) [-550.686] -- 0:00:07
873500 -- (-555.643) (-550.346) [-551.748] (-552.516) * (-552.011) (-551.300) [-551.963] (-551.477) -- 0:00:07
874000 -- (-549.537) (-550.912) (-556.072) [-551.747] * (-552.034) [-552.966] (-552.273) (-550.945) -- 0:00:07
874500 -- (-550.576) (-553.683) [-555.329] (-550.523) * [-553.426] (-551.350) (-550.336) (-550.843) -- 0:00:07
875000 -- [-551.368] (-552.773) (-555.962) (-553.188) * [-554.816] (-551.227) (-557.303) (-558.343) -- 0:00:07
Average standard deviation of split frequencies: 0.007198
875500 -- (-552.192) (-560.015) [-551.126] (-550.308) * (-557.414) (-549.814) [-551.017] (-552.430) -- 0:00:07
876000 -- (-551.559) (-553.538) (-550.002) [-551.247] * [-556.275] (-549.724) (-555.552) (-551.789) -- 0:00:07
876500 -- (-551.647) [-554.389] (-550.632) (-554.927) * (-550.902) (-550.922) [-550.832] (-551.512) -- 0:00:07
877000 -- (-551.908) (-558.783) [-550.923] (-551.896) * (-551.168) [-553.467] (-550.877) (-550.193) -- 0:00:07
877500 -- (-551.633) (-549.526) [-550.113] (-552.348) * [-552.385] (-551.341) (-553.062) (-553.127) -- 0:00:07
878000 -- (-551.924) [-550.592] (-550.553) (-552.373) * [-550.944] (-557.234) (-552.750) (-549.604) -- 0:00:07
878500 -- (-552.428) (-553.011) (-552.182) [-550.895] * (-554.569) (-551.756) (-554.834) [-549.622] -- 0:00:07
879000 -- (-552.658) (-552.505) (-554.765) [-552.643] * (-552.020) (-551.661) (-552.596) [-550.691] -- 0:00:07
879500 -- (-552.138) (-549.194) [-553.129] (-549.407) * [-551.021] (-550.002) (-550.430) (-551.492) -- 0:00:07
880000 -- (-550.714) (-549.677) [-551.541] (-553.093) * (-549.641) (-550.913) (-550.316) [-552.954] -- 0:00:07
Average standard deviation of split frequencies: 0.007173
880500 -- (-551.822) [-549.329] (-550.444) (-555.222) * (-549.623) (-556.166) (-550.345) [-552.280] -- 0:00:07
881000 -- (-551.533) [-554.683] (-552.702) (-552.137) * (-551.959) (-552.534) [-550.896] (-553.261) -- 0:00:07
881500 -- [-553.621] (-555.542) (-551.813) (-553.661) * (-551.457) [-553.446] (-552.241) (-552.728) -- 0:00:07
882000 -- (-551.331) (-551.354) [-549.759] (-553.277) * [-552.316] (-552.404) (-553.172) (-552.088) -- 0:00:07
882500 -- (-553.154) (-551.331) (-549.689) [-553.638] * [-552.493] (-555.072) (-554.490) (-551.134) -- 0:00:07
883000 -- (-552.870) (-550.852) (-549.731) [-555.195] * [-550.065] (-551.166) (-551.202) (-555.450) -- 0:00:07
883500 -- (-556.665) [-549.290] (-549.866) (-551.695) * (-550.528) (-552.931) (-553.301) [-556.101] -- 0:00:06
884000 -- (-550.932) (-556.192) [-549.638] (-550.019) * (-556.594) (-549.865) (-551.663) [-551.546] -- 0:00:06
884500 -- (-550.488) (-555.186) [-551.226] (-555.320) * (-552.210) (-550.730) [-551.986] (-555.498) -- 0:00:06
885000 -- [-553.783] (-552.291) (-551.891) (-550.838) * (-550.330) [-552.504] (-550.597) (-552.936) -- 0:00:06
Average standard deviation of split frequencies: 0.007017
885500 -- (-554.169) (-553.046) [-550.553] (-549.933) * (-554.323) (-550.015) [-555.136] (-550.526) -- 0:00:06
886000 -- [-551.844] (-552.574) (-553.369) (-550.573) * (-553.486) (-550.348) (-554.072) [-550.679] -- 0:00:06
886500 -- (-552.476) (-550.498) [-552.422] (-556.307) * (-550.021) [-550.878] (-551.096) (-550.629) -- 0:00:06
887000 -- (-549.542) (-550.686) [-551.974] (-555.982) * (-554.661) [-551.145] (-550.200) (-552.861) -- 0:00:06
887500 -- [-549.601] (-550.681) (-551.502) (-550.882) * (-552.910) (-552.605) (-551.826) [-550.817] -- 0:00:06
888000 -- (-550.892) (-551.182) [-550.831] (-550.389) * (-551.230) [-556.345] (-552.041) (-554.222) -- 0:00:06
888500 -- (-553.144) [-553.111] (-551.010) (-551.849) * (-550.855) (-553.777) (-551.663) [-550.719] -- 0:00:06
889000 -- (-556.635) (-553.039) [-551.374] (-549.720) * (-551.675) (-552.976) [-550.039] (-552.909) -- 0:00:06
889500 -- [-555.094] (-551.452) (-550.558) (-551.942) * (-550.648) (-552.018) (-552.510) [-553.640] -- 0:00:06
890000 -- (-552.114) [-550.277] (-555.133) (-551.224) * (-549.943) [-553.118] (-550.771) (-553.524) -- 0:00:06
Average standard deviation of split frequencies: 0.006387
890500 -- (-550.960) [-550.456] (-551.157) (-554.978) * (-551.041) (-549.888) [-551.456] (-550.173) -- 0:00:06
891000 -- (-553.153) (-550.016) [-550.903] (-552.513) * (-556.583) [-552.104] (-551.274) (-550.333) -- 0:00:06
891500 -- (-550.800) (-551.683) [-549.483] (-552.041) * [-553.220] (-552.886) (-551.847) (-554.597) -- 0:00:06
892000 -- [-552.320] (-551.271) (-550.687) (-553.524) * (-554.126) [-551.198] (-551.434) (-555.429) -- 0:00:06
892500 -- (-549.871) [-553.778] (-551.260) (-552.689) * (-555.705) (-550.104) (-552.342) [-552.088] -- 0:00:06
893000 -- (-550.777) (-557.631) (-552.398) [-550.514] * [-555.592] (-550.541) (-553.260) (-551.151) -- 0:00:06
893500 -- (-552.155) (-554.959) [-551.773] (-552.590) * [-554.368] (-550.933) (-549.979) (-551.837) -- 0:00:06
894000 -- (-551.415) (-551.247) [-551.015] (-552.382) * [-553.114] (-549.880) (-552.738) (-551.185) -- 0:00:06
894500 -- (-551.987) (-553.080) (-552.302) [-552.867] * (-550.773) (-550.374) [-551.240] (-551.999) -- 0:00:06
895000 -- (-552.384) [-551.440] (-554.101) (-555.534) * (-550.483) (-554.063) (-551.887) [-549.953] -- 0:00:06
Average standard deviation of split frequencies: 0.006489
895500 -- [-550.374] (-549.840) (-551.298) (-550.199) * (-549.976) [-551.755] (-551.644) (-549.926) -- 0:00:06
896000 -- (-549.559) (-553.817) [-556.054] (-557.655) * [-550.000] (-549.850) (-556.702) (-549.649) -- 0:00:06
896500 -- (-554.513) [-550.463] (-552.515) (-550.860) * [-550.220] (-550.863) (-551.962) (-551.358) -- 0:00:06
897000 -- (-550.651) [-555.031] (-551.307) (-550.822) * (-550.774) [-553.184] (-551.992) (-551.159) -- 0:00:06
897500 -- [-550.470] (-549.950) (-552.192) (-549.605) * (-550.627) (-551.796) [-552.293] (-549.447) -- 0:00:06
898000 -- [-549.332] (-551.764) (-551.309) (-549.612) * (-552.158) (-552.858) (-552.172) [-551.064] -- 0:00:06
898500 -- (-549.335) [-551.584] (-552.615) (-552.175) * (-550.076) (-553.466) [-551.129] (-551.377) -- 0:00:06
899000 -- (-550.510) [-550.429] (-552.226) (-555.079) * [-551.058] (-551.874) (-550.268) (-555.083) -- 0:00:06
899500 -- (-553.178) (-550.976) (-551.191) [-551.314] * [-549.532] (-554.818) (-551.289) (-553.317) -- 0:00:06
900000 -- (-551.326) (-553.623) [-551.270] (-553.045) * (-553.091) [-551.298] (-552.387) (-552.961) -- 0:00:06
Average standard deviation of split frequencies: 0.006211
900500 -- (-556.855) (-549.875) [-550.673] (-551.677) * (-551.539) (-549.993) (-552.930) [-553.905] -- 0:00:05
901000 -- [-550.339] (-550.618) (-549.742) (-551.223) * (-556.222) [-549.993] (-552.516) (-551.544) -- 0:00:05
901500 -- [-550.817] (-551.197) (-553.055) (-550.603) * (-550.740) (-552.300) (-553.898) [-550.663] -- 0:00:05
902000 -- (-555.175) [-551.700] (-552.759) (-552.027) * (-551.746) (-552.058) [-551.460] (-550.734) -- 0:00:05
902500 -- (-551.827) (-549.762) (-550.165) [-553.503] * [-549.633] (-551.780) (-550.449) (-550.762) -- 0:00:05
903000 -- [-553.984] (-550.156) (-554.328) (-555.404) * (-550.106) (-550.324) (-552.273) [-551.819] -- 0:00:05
903500 -- (-550.348) [-551.337] (-552.519) (-552.100) * [-551.216] (-553.484) (-551.484) (-553.221) -- 0:00:05
904000 -- (-549.793) (-554.788) [-553.312] (-552.090) * (-551.116) (-550.996) [-550.287] (-549.943) -- 0:00:05
904500 -- (-549.498) (-554.292) [-551.147] (-553.417) * (-550.887) (-553.903) [-551.213] (-550.443) -- 0:00:05
905000 -- (-552.093) (-553.647) [-551.136] (-557.513) * (-552.285) [-554.480] (-551.128) (-552.278) -- 0:00:05
Average standard deviation of split frequencies: 0.005793
905500 -- (-550.920) (-552.807) [-551.777] (-550.910) * (-551.616) [-550.008] (-556.095) (-551.568) -- 0:00:05
906000 -- (-549.634) (-551.490) [-552.557] (-552.200) * [-550.543] (-550.514) (-555.443) (-550.947) -- 0:00:05
906500 -- (-551.368) [-549.619] (-551.250) (-552.144) * (-553.430) (-551.419) (-552.506) [-555.578] -- 0:00:05
907000 -- (-552.047) (-552.093) (-552.033) [-554.375] * (-551.385) (-552.011) [-551.676] (-550.738) -- 0:00:05
907500 -- (-550.413) (-551.606) (-553.627) [-549.876] * (-550.595) (-551.966) (-551.639) [-550.215] -- 0:00:05
908000 -- [-549.774] (-553.162) (-553.175) (-553.185) * (-549.798) (-550.473) [-552.988] (-549.602) -- 0:00:05
908500 -- (-552.461) [-549.621] (-553.808) (-550.849) * (-550.427) [-552.770] (-551.187) (-554.336) -- 0:00:05
909000 -- (-555.525) [-550.887] (-552.152) (-552.467) * [-552.660] (-552.292) (-550.411) (-555.744) -- 0:00:05
909500 -- (-553.669) [-552.143] (-550.483) (-550.412) * (-554.861) (-551.069) (-551.685) [-551.286] -- 0:00:05
910000 -- (-551.015) [-549.966] (-555.180) (-550.301) * (-558.244) (-553.191) (-549.744) [-550.123] -- 0:00:05
Average standard deviation of split frequencies: 0.005867
910500 -- [-551.509] (-550.818) (-551.674) (-551.812) * (-551.173) (-549.661) [-550.465] (-550.102) -- 0:00:05
911000 -- (-551.651) (-550.171) (-552.040) [-550.684] * (-556.836) (-552.889) [-551.124] (-549.951) -- 0:00:05
911500 -- [-549.425] (-553.006) (-549.680) (-550.719) * [-552.199] (-550.023) (-550.703) (-552.214) -- 0:00:05
912000 -- (-549.333) (-550.930) (-550.713) [-552.467] * [-552.982] (-552.378) (-551.446) (-551.259) -- 0:00:05
912500 -- (-557.129) (-550.538) (-551.547) [-550.196] * (-550.377) (-549.866) (-552.797) [-555.769] -- 0:00:05
913000 -- (-553.441) (-551.907) [-551.471] (-550.636) * (-551.897) [-553.274] (-551.078) (-551.919) -- 0:00:05
913500 -- (-552.581) (-550.193) [-549.672] (-556.688) * (-551.135) (-553.698) (-551.488) [-551.440] -- 0:00:05
914000 -- (-552.115) (-552.547) (-550.559) [-550.378] * (-552.631) (-552.849) [-551.129] (-552.511) -- 0:00:05
914500 -- (-552.949) [-550.472] (-550.430) (-551.706) * [-550.432] (-550.087) (-551.365) (-550.825) -- 0:00:05
915000 -- (-550.508) (-551.608) (-554.917) [-550.793] * (-550.722) (-550.745) (-551.835) [-551.938] -- 0:00:05
Average standard deviation of split frequencies: 0.005798
915500 -- (-550.955) (-553.809) [-553.001] (-553.514) * (-551.832) (-552.973) [-551.480] (-553.108) -- 0:00:05
916000 -- (-553.790) (-555.868) (-553.713) [-551.604] * (-550.561) (-551.049) [-551.275] (-551.998) -- 0:00:05
916500 -- (-556.499) (-550.534) [-552.969] (-549.705) * (-552.353) (-550.480) (-551.799) [-549.500] -- 0:00:05
917000 -- (-556.409) (-551.375) [-551.139] (-550.343) * (-555.488) (-551.992) (-553.439) [-550.621] -- 0:00:04
917500 -- (-556.197) (-551.134) (-550.420) [-551.510] * [-550.978] (-549.618) (-553.393) (-550.402) -- 0:00:04
918000 -- (-552.549) (-549.495) (-554.015) [-553.923] * [-555.461] (-549.229) (-551.734) (-550.790) -- 0:00:04
918500 -- (-554.965) [-549.711] (-549.683) (-554.924) * [-549.274] (-549.229) (-551.525) (-553.575) -- 0:00:04
919000 -- (-552.258) (-553.086) (-550.861) [-551.956] * (-551.104) (-554.011) [-551.236] (-550.617) -- 0:00:04
919500 -- (-552.807) [-551.640] (-551.311) (-549.710) * (-550.546) [-550.132] (-551.380) (-550.645) -- 0:00:04
920000 -- (-549.661) (-550.749) (-553.043) [-549.809] * (-551.004) (-552.206) [-551.541] (-551.721) -- 0:00:04
Average standard deviation of split frequencies: 0.005735
920500 -- [-549.313] (-550.917) (-552.156) (-549.617) * (-551.729) [-553.963] (-551.888) (-549.859) -- 0:00:04
921000 -- (-551.330) (-550.430) [-555.272] (-550.841) * [-550.981] (-551.805) (-549.837) (-552.463) -- 0:00:04
921500 -- (-552.563) [-550.539] (-553.265) (-550.253) * (-554.723) (-551.689) [-553.065] (-552.423) -- 0:00:04
922000 -- (-551.184) (-552.422) (-556.727) [-549.339] * (-552.093) (-551.231) [-549.939] (-551.595) -- 0:00:04
922500 -- [-551.108] (-551.980) (-553.756) (-553.992) * (-550.016) (-550.958) [-551.319] (-552.392) -- 0:00:04
923000 -- (-552.063) (-552.267) [-552.735] (-558.181) * (-552.783) (-550.956) (-550.824) [-552.428] -- 0:00:04
923500 -- (-550.489) (-549.454) [-551.971] (-555.454) * (-549.904) [-549.953] (-550.567) (-550.125) -- 0:00:04
924000 -- (-554.722) [-550.718] (-553.303) (-551.378) * [-549.392] (-549.931) (-550.488) (-550.388) -- 0:00:04
924500 -- (-555.922) [-550.478] (-551.366) (-550.338) * [-549.428] (-549.854) (-550.212) (-554.360) -- 0:00:04
925000 -- (-554.672) (-551.348) [-553.894] (-549.428) * [-550.425] (-551.165) (-551.019) (-550.391) -- 0:00:04
Average standard deviation of split frequencies: 0.005668
925500 -- (-551.553) [-552.440] (-550.595) (-551.481) * [-549.925] (-550.255) (-551.206) (-555.800) -- 0:00:04
926000 -- (-555.444) [-553.806] (-551.564) (-551.698) * [-550.228] (-550.762) (-551.243) (-553.983) -- 0:00:04
926500 -- (-550.948) (-551.141) (-551.470) [-554.727] * [-550.440] (-552.397) (-551.692) (-551.662) -- 0:00:04
927000 -- (-553.565) (-551.943) (-554.728) [-551.220] * (-552.970) (-551.037) (-551.282) [-552.389] -- 0:00:04
927500 -- (-550.288) (-554.512) (-550.945) [-552.727] * [-551.589] (-550.578) (-554.229) (-551.424) -- 0:00:04
928000 -- (-551.353) [-551.480] (-553.957) (-550.234) * (-552.063) (-550.929) (-552.989) [-551.833] -- 0:00:04
928500 -- (-552.181) (-550.720) (-550.613) [-550.932] * (-551.997) [-553.278] (-551.491) (-551.743) -- 0:00:04
929000 -- (-551.849) (-550.813) (-552.256) [-552.220] * (-549.871) (-552.106) [-552.400] (-552.833) -- 0:00:04
929500 -- (-552.004) (-550.888) [-551.732] (-553.371) * (-549.527) (-552.675) (-551.019) [-550.150] -- 0:00:04
930000 -- (-550.913) [-551.919] (-550.682) (-552.334) * (-552.394) (-553.592) [-550.894] (-553.185) -- 0:00:04
Average standard deviation of split frequencies: 0.005065
930500 -- (-550.600) (-550.452) (-549.845) [-553.474] * (-550.330) (-550.558) (-552.373) [-550.276] -- 0:00:04
931000 -- (-553.207) [-552.462] (-552.014) (-551.112) * (-551.849) (-549.817) [-554.244] (-551.332) -- 0:00:04
931500 -- (-556.139) (-551.636) [-550.753] (-554.459) * (-551.081) (-551.053) [-549.602] (-550.414) -- 0:00:04
932000 -- [-551.023] (-554.084) (-552.970) (-552.071) * (-556.050) (-550.206) [-551.666] (-551.521) -- 0:00:04
932500 -- [-550.910] (-551.103) (-552.000) (-550.965) * [-554.114] (-550.774) (-549.660) (-552.588) -- 0:00:04
933000 -- (-549.554) [-550.057] (-550.671) (-550.208) * (-553.426) (-550.333) (-550.235) [-552.963] -- 0:00:04
933500 -- (-550.430) (-552.454) (-550.786) [-551.867] * (-554.120) [-549.817] (-550.660) (-550.541) -- 0:00:03
934000 -- (-550.309) [-551.272] (-551.999) (-550.931) * (-552.970) (-552.343) (-551.265) [-550.719] -- 0:00:03
934500 -- (-550.736) (-553.706) [-551.120] (-554.835) * [-553.235] (-551.128) (-552.831) (-550.841) -- 0:00:03
935000 -- (-551.260) (-551.825) (-549.479) [-550.846] * (-553.448) [-549.376] (-551.022) (-549.500) -- 0:00:03
Average standard deviation of split frequencies: 0.005070
935500 -- [-549.888] (-551.045) (-551.305) (-552.981) * (-551.144) [-549.676] (-551.943) (-555.298) -- 0:00:03
936000 -- (-551.437) [-550.469] (-550.722) (-552.648) * [-551.854] (-554.889) (-550.536) (-552.087) -- 0:00:03
936500 -- [-550.432] (-553.440) (-550.348) (-550.843) * (-551.312) (-550.015) [-551.665] (-550.648) -- 0:00:03
937000 -- [-550.502] (-550.383) (-550.457) (-552.248) * (-552.688) (-555.203) [-551.522] (-550.579) -- 0:00:03
937500 -- (-551.483) [-551.131] (-550.757) (-550.119) * (-552.549) [-556.437] (-553.568) (-550.189) -- 0:00:03
938000 -- (-552.700) [-550.791] (-552.454) (-552.026) * [-553.298] (-551.421) (-554.646) (-550.363) -- 0:00:03
938500 -- [-551.648] (-551.290) (-550.905) (-555.227) * (-553.064) (-552.223) [-550.026] (-551.310) -- 0:00:03
939000 -- (-551.702) (-550.662) [-550.135] (-553.128) * (-549.788) (-552.594) [-550.137] (-550.216) -- 0:00:03
939500 -- (-550.295) [-551.260] (-551.027) (-551.468) * (-552.866) (-550.773) [-549.651] (-550.790) -- 0:00:03
940000 -- (-553.545) (-551.325) (-551.020) [-549.808] * (-554.022) (-554.277) [-552.655] (-550.976) -- 0:00:03
Average standard deviation of split frequencies: 0.005145
940500 -- (-550.914) (-551.858) (-552.333) [-549.884] * (-550.673) [-553.927] (-556.845) (-552.961) -- 0:00:03
941000 -- (-550.603) (-550.245) [-550.275] (-550.962) * (-554.907) (-553.191) [-551.035] (-552.776) -- 0:00:03
941500 -- [-552.727] (-551.715) (-553.269) (-550.407) * (-550.683) [-550.564] (-549.127) (-551.912) -- 0:00:03
942000 -- (-551.133) (-551.127) [-550.251] (-549.860) * [-550.090] (-549.937) (-550.955) (-552.521) -- 0:00:03
942500 -- [-549.840] (-553.325) (-553.642) (-552.043) * [-551.632] (-549.987) (-553.100) (-551.618) -- 0:00:03
943000 -- (-551.811) (-553.656) [-553.102] (-550.531) * (-551.331) [-551.372] (-551.837) (-554.100) -- 0:00:03
943500 -- [-553.135] (-554.275) (-551.334) (-550.588) * [-550.220] (-554.175) (-552.501) (-550.962) -- 0:00:03
944000 -- (-555.260) (-555.622) (-553.247) [-552.568] * (-550.514) (-551.292) [-550.123] (-555.751) -- 0:00:03
944500 -- [-550.099] (-550.413) (-550.390) (-552.811) * (-554.146) (-551.719) [-549.787] (-554.590) -- 0:00:03
945000 -- [-550.382] (-550.212) (-550.664) (-552.448) * [-549.892] (-550.332) (-551.264) (-552.371) -- 0:00:03
Average standard deviation of split frequencies: 0.004917
945500 -- (-555.553) [-550.433] (-550.194) (-553.353) * (-554.529) (-549.409) [-551.909] (-550.514) -- 0:00:03
946000 -- (-552.887) [-554.136] (-553.109) (-554.206) * (-550.152) [-550.227] (-551.284) (-550.685) -- 0:00:03
946500 -- [-550.516] (-551.421) (-550.586) (-551.416) * [-550.586] (-550.792) (-551.429) (-549.546) -- 0:00:03
947000 -- (-554.157) (-551.227) (-551.630) [-553.197] * [-552.802] (-551.077) (-553.969) (-551.800) -- 0:00:03
947500 -- (-550.000) [-550.785] (-551.365) (-553.513) * (-553.280) (-554.769) [-550.016] (-554.423) -- 0:00:03
948000 -- (-549.830) (-550.820) [-552.454] (-550.486) * (-551.253) (-554.910) [-552.720] (-552.010) -- 0:00:03
948500 -- (-549.317) (-551.308) (-549.677) [-552.296] * (-551.928) [-552.818] (-550.692) (-551.886) -- 0:00:03
949000 -- (-551.592) (-550.579) [-549.044] (-554.972) * (-555.734) (-551.314) [-550.110] (-555.658) -- 0:00:03
949500 -- [-551.352] (-551.084) (-549.626) (-551.752) * [-550.630] (-551.099) (-552.767) (-552.284) -- 0:00:03
950000 -- (-553.652) (-550.816) (-552.269) [-549.870] * [-550.684] (-555.136) (-555.460) (-550.398) -- 0:00:03
Average standard deviation of split frequencies: 0.005058
950500 -- (-555.623) (-553.769) (-550.446) [-553.151] * (-550.128) (-553.039) (-550.755) [-554.139] -- 0:00:03
951000 -- (-551.894) [-552.101] (-550.661) (-551.569) * (-549.680) [-553.257] (-552.259) (-554.915) -- 0:00:02
951500 -- [-550.021] (-552.148) (-556.974) (-552.778) * (-551.229) [-551.936] (-553.224) (-549.871) -- 0:00:02
952000 -- [-549.045] (-557.679) (-549.893) (-549.798) * [-552.312] (-551.051) (-552.556) (-553.474) -- 0:00:02
952500 -- (-552.806) (-551.427) (-550.261) [-550.546] * [-553.594] (-552.500) (-551.585) (-550.670) -- 0:00:02
953000 -- (-550.199) (-550.357) (-551.788) [-551.945] * (-553.564) (-550.096) [-550.542] (-552.525) -- 0:00:02
953500 -- [-550.679] (-550.006) (-551.449) (-551.527) * (-550.147) (-552.030) (-550.897) [-554.647] -- 0:00:02
954000 -- (-551.864) (-549.786) (-549.580) [-552.076] * (-553.280) [-550.697] (-550.835) (-555.586) -- 0:00:02
954500 -- (-551.396) [-549.588] (-552.133) (-552.361) * (-555.540) (-549.712) [-549.258] (-553.236) -- 0:00:02
955000 -- (-549.849) [-550.060] (-550.901) (-551.143) * (-552.319) (-551.061) (-549.242) [-553.303] -- 0:00:02
Average standard deviation of split frequencies: 0.005063
955500 -- (-557.274) (-553.197) (-551.218) [-550.397] * (-550.824) [-550.716] (-552.807) (-552.124) -- 0:00:02
956000 -- [-551.391] (-551.197) (-554.131) (-550.012) * [-550.250] (-551.962) (-552.614) (-554.057) -- 0:00:02
956500 -- [-551.582] (-551.891) (-555.268) (-549.788) * [-549.976] (-551.667) (-550.571) (-550.596) -- 0:00:02
957000 -- (-550.521) [-551.315] (-551.499) (-550.649) * [-550.493] (-550.418) (-553.224) (-550.662) -- 0:00:02
957500 -- (-552.169) (-558.165) (-553.252) [-552.228] * (-556.433) (-551.009) [-552.851] (-552.355) -- 0:00:02
958000 -- (-552.624) (-552.004) [-551.002] (-551.022) * (-557.191) (-550.922) [-550.767] (-556.311) -- 0:00:02
958500 -- (-554.716) (-555.056) (-549.854) [-550.050] * (-551.946) [-549.660] (-550.080) (-551.524) -- 0:00:02
959000 -- (-556.217) (-551.730) [-550.178] (-550.157) * (-551.297) (-551.158) [-549.562] (-552.310) -- 0:00:02
959500 -- [-552.705] (-549.631) (-551.511) (-549.709) * (-552.087) (-550.306) [-551.841] (-553.710) -- 0:00:02
960000 -- (-552.435) [-549.975] (-551.485) (-550.153) * (-550.913) (-550.096) (-549.881) [-550.877] -- 0:00:02
Average standard deviation of split frequencies: 0.005136
960500 -- (-552.863) (-550.335) [-549.496] (-552.057) * (-550.509) (-550.369) [-550.587] (-551.833) -- 0:00:02
961000 -- (-552.781) [-552.955] (-551.877) (-554.996) * (-552.242) [-551.548] (-551.484) (-551.790) -- 0:00:02
961500 -- [-549.538] (-555.056) (-553.995) (-550.876) * [-550.446] (-550.887) (-550.869) (-553.263) -- 0:00:02
962000 -- (-552.762) (-550.669) (-550.438) [-552.430] * [-551.175] (-551.199) (-552.505) (-552.253) -- 0:00:02
962500 -- (-556.361) (-554.584) (-550.729) [-551.496] * (-552.267) (-550.890) [-549.843] (-550.932) -- 0:00:02
963000 -- [-551.078] (-552.414) (-551.514) (-553.371) * (-552.212) [-550.644] (-551.791) (-551.468) -- 0:00:02
963500 -- (-551.796) [-550.096] (-551.615) (-551.505) * (-551.753) (-554.516) (-551.465) [-550.854] -- 0:00:02
964000 -- [-550.842] (-551.813) (-550.856) (-552.999) * [-550.929] (-549.969) (-554.092) (-550.428) -- 0:00:02
964500 -- (-550.124) (-550.702) [-550.348] (-555.245) * (-550.991) (-549.416) [-555.003] (-549.257) -- 0:00:02
965000 -- (-551.391) (-555.107) (-550.021) [-553.666] * (-550.004) (-552.636) [-551.389] (-556.061) -- 0:00:02
Average standard deviation of split frequencies: 0.006191
965500 -- [-551.884] (-556.148) (-555.267) (-551.737) * (-550.228) (-552.939) (-551.390) [-551.185] -- 0:00:02
966000 -- (-550.871) (-555.341) [-550.363] (-551.437) * (-550.093) (-555.569) [-552.787] (-552.987) -- 0:00:02
966500 -- [-551.072] (-553.347) (-554.777) (-552.842) * (-551.238) (-553.531) (-550.048) [-552.112] -- 0:00:02
967000 -- [-550.233] (-553.548) (-554.342) (-552.409) * (-551.130) (-549.609) [-549.734] (-553.776) -- 0:00:02
967500 -- [-552.541] (-553.634) (-549.734) (-551.079) * (-550.230) (-550.707) (-551.020) [-551.726] -- 0:00:01
968000 -- (-549.801) [-552.626] (-550.191) (-553.717) * [-551.453] (-551.513) (-552.094) (-552.659) -- 0:00:01
968500 -- (-552.539) [-550.706] (-550.585) (-551.097) * (-560.134) [-550.601] (-550.739) (-551.670) -- 0:00:01
969000 -- [-551.567] (-555.634) (-551.341) (-551.117) * (-551.773) (-553.751) (-549.251) [-552.476] -- 0:00:01
969500 -- (-551.125) (-553.589) [-551.700] (-550.355) * (-550.555) (-551.524) [-550.440] (-553.448) -- 0:00:01
970000 -- (-550.852) [-553.494] (-552.379) (-553.420) * (-550.469) (-550.705) [-552.262] (-550.693) -- 0:00:01
Average standard deviation of split frequencies: 0.006283
970500 -- [-550.606] (-551.510) (-553.792) (-551.230) * (-549.830) (-553.144) (-550.771) [-552.465] -- 0:00:01
971000 -- (-549.913) (-555.330) (-552.995) [-552.999] * (-549.808) (-552.364) [-551.482] (-551.417) -- 0:00:01
971500 -- (-554.800) [-549.224] (-550.495) (-550.838) * (-549.433) [-553.692] (-551.313) (-552.721) -- 0:00:01
972000 -- [-551.900] (-550.316) (-550.364) (-551.245) * [-549.639] (-553.264) (-554.812) (-553.625) -- 0:00:01
972500 -- (-550.266) [-550.046] (-550.515) (-553.180) * (-549.477) (-553.729) [-552.155] (-551.915) -- 0:00:01
973000 -- (-553.698) (-551.276) (-551.393) [-554.262] * [-550.066] (-553.949) (-551.551) (-553.022) -- 0:00:01
973500 -- (-553.742) [-551.856] (-554.033) (-551.976) * (-553.376) (-551.461) (-552.077) [-551.258] -- 0:00:01
974000 -- (-551.307) (-552.281) (-555.736) [-550.336] * [-551.348] (-550.470) (-551.668) (-557.302) -- 0:00:01
974500 -- (-552.256) (-550.157) [-549.545] (-552.402) * (-553.164) [-550.250] (-549.578) (-552.173) -- 0:00:01
975000 -- (-551.097) (-550.191) (-550.244) [-551.460] * [-552.096] (-551.314) (-550.240) (-553.499) -- 0:00:01
Average standard deviation of split frequencies: 0.006339
975500 -- [-549.709] (-552.020) (-550.317) (-552.176) * (-554.691) [-551.829] (-553.551) (-553.857) -- 0:00:01
976000 -- (-549.887) [-551.268] (-550.653) (-551.744) * (-552.247) (-550.405) (-553.109) [-549.977] -- 0:00:01
976500 -- (-552.994) (-550.516) (-552.150) [-550.771] * [-552.603] (-550.833) (-550.262) (-550.345) -- 0:00:01
977000 -- (-552.186) [-550.305] (-550.478) (-550.804) * [-554.233] (-552.483) (-552.101) (-552.733) -- 0:00:01
977500 -- (-549.653) (-549.929) [-552.429] (-550.126) * (-553.692) [-554.947] (-550.065) (-551.035) -- 0:00:01
978000 -- (-551.230) [-549.522] (-551.175) (-549.692) * (-555.522) (-553.915) (-552.879) [-549.266] -- 0:00:01
978500 -- (-550.961) (-549.557) (-551.006) [-550.159] * (-553.501) (-550.849) [-551.075] (-550.916) -- 0:00:01
979000 -- (-550.220) (-551.292) [-550.955] (-551.240) * (-552.473) [-551.355] (-554.385) (-552.794) -- 0:00:01
979500 -- [-549.834] (-553.554) (-555.220) (-555.537) * (-555.547) (-550.812) [-550.225] (-553.999) -- 0:00:01
980000 -- (-550.695) [-553.341] (-553.102) (-553.464) * [-551.370] (-554.651) (-552.068) (-551.670) -- 0:00:01
Average standard deviation of split frequencies: 0.005919
980500 -- (-550.822) [-550.785] (-553.056) (-553.170) * (-549.608) (-553.308) [-550.634] (-553.666) -- 0:00:01
981000 -- (-553.719) (-554.663) [-550.895] (-550.924) * (-549.899) [-550.407] (-551.558) (-553.648) -- 0:00:01
981500 -- (-549.283) (-550.598) (-551.593) [-551.479] * (-551.460) [-555.165] (-551.829) (-553.622) -- 0:00:01
982000 -- (-550.893) [-550.024] (-550.842) (-551.359) * (-551.286) (-556.927) (-551.061) [-550.659] -- 0:00:01
982500 -- [-550.914] (-550.806) (-556.229) (-553.505) * (-551.341) (-551.593) [-550.503] (-551.013) -- 0:00:01
983000 -- (-552.271) (-550.262) (-556.160) [-552.010] * (-554.095) [-549.712] (-551.595) (-552.440) -- 0:00:01
983500 -- (-551.035) (-552.879) [-552.733] (-551.049) * (-554.710) [-551.538] (-554.965) (-550.285) -- 0:00:01
984000 -- [-551.898] (-550.401) (-556.953) (-549.905) * (-551.533) [-553.322] (-554.779) (-552.519) -- 0:00:00
984500 -- (-550.298) (-554.015) [-552.748] (-553.369) * [-550.529] (-550.771) (-551.641) (-551.328) -- 0:00:00
985000 -- (-550.335) (-552.308) (-551.206) [-551.842] * (-551.005) [-549.412] (-555.913) (-550.030) -- 0:00:00
Average standard deviation of split frequencies: 0.006305
985500 -- (-551.148) [-550.847] (-550.691) (-550.033) * [-553.338] (-551.773) (-551.030) (-551.671) -- 0:00:00
986000 -- (-552.199) (-551.736) [-550.816] (-551.528) * (-550.696) (-552.143) (-550.308) [-551.177] -- 0:00:00
986500 -- (-550.480) (-550.225) (-552.288) [-550.639] * (-550.623) (-552.096) (-550.871) [-550.944] -- 0:00:00
987000 -- (-549.894) (-550.511) [-551.277] (-550.026) * (-550.504) [-553.759] (-551.868) (-552.503) -- 0:00:00
987500 -- (-550.970) [-551.099] (-550.176) (-551.785) * [-550.278] (-553.241) (-554.447) (-550.471) -- 0:00:00
988000 -- (-549.962) (-552.515) (-549.567) [-553.228] * (-550.863) (-552.166) [-553.134] (-551.697) -- 0:00:00
988500 -- (-550.174) (-551.131) [-552.455] (-553.852) * (-552.444) (-551.293) [-551.692] (-551.053) -- 0:00:00
989000 -- (-551.981) [-551.444] (-551.100) (-552.558) * (-553.979) (-549.723) (-551.315) [-551.160] -- 0:00:00
989500 -- [-551.503] (-550.041) (-552.974) (-554.048) * (-549.733) (-549.750) (-551.808) [-554.496] -- 0:00:00
990000 -- (-555.442) [-549.900] (-550.688) (-554.443) * [-550.568] (-551.169) (-552.457) (-555.927) -- 0:00:00
Average standard deviation of split frequencies: 0.006483
990500 -- (-552.686) [-549.640] (-552.273) (-552.601) * (-552.169) (-552.657) (-551.750) [-551.552] -- 0:00:00
991000 -- (-551.550) (-549.811) (-549.709) [-551.829] * (-551.883) [-549.789] (-551.235) (-554.226) -- 0:00:00
991500 -- (-551.148) (-553.215) [-549.415] (-556.365) * (-549.842) (-550.978) (-557.602) [-551.044] -- 0:00:00
992000 -- (-554.065) (-550.843) (-551.035) [-557.343] * (-550.645) [-551.239] (-550.914) (-550.133) -- 0:00:00
992500 -- [-552.018] (-550.555) (-554.313) (-555.206) * (-552.406) [-550.399] (-554.382) (-549.933) -- 0:00:00
993000 -- (-555.568) (-550.827) [-551.042] (-552.245) * (-551.878) (-550.646) (-553.404) [-550.400] -- 0:00:00
993500 -- (-552.846) (-550.970) [-550.379] (-554.045) * [-550.290] (-554.012) (-550.916) (-549.461) -- 0:00:00
994000 -- (-554.082) (-552.300) [-551.062] (-551.603) * (-550.271) (-549.294) [-553.690] (-553.814) -- 0:00:00
994500 -- (-551.246) (-550.232) [-552.274] (-552.178) * [-550.455] (-550.145) (-551.795) (-552.564) -- 0:00:00
995000 -- (-553.342) (-552.098) [-550.049] (-551.922) * (-555.016) (-552.921) (-553.114) [-550.179] -- 0:00:00
Average standard deviation of split frequencies: 0.006419
995500 -- [-550.864] (-551.531) (-551.086) (-550.516) * [-555.262] (-550.241) (-550.885) (-550.602) -- 0:00:00
996000 -- (-554.275) (-550.278) (-550.210) [-551.207] * (-549.267) [-549.539] (-551.683) (-551.430) -- 0:00:00
996500 -- (-553.645) [-555.875] (-553.610) (-552.842) * (-552.212) (-551.930) [-552.231] (-550.518) -- 0:00:00
997000 -- (-554.718) [-553.767] (-552.137) (-550.869) * (-550.530) [-555.357] (-555.227) (-551.566) -- 0:00:00
997500 -- (-555.763) (-552.553) [-549.824] (-549.524) * (-550.896) [-552.805] (-550.040) (-552.352) -- 0:00:00
998000 -- (-552.970) (-550.420) [-551.308] (-550.242) * (-553.065) [-549.809] (-552.611) (-550.385) -- 0:00:00
998500 -- (-550.539) [-551.416] (-550.929) (-554.099) * (-555.020) (-553.127) (-550.800) [-550.152] -- 0:00:00
999000 -- (-551.176) [-549.690] (-553.327) (-552.387) * (-551.231) (-550.750) (-550.059) [-549.951] -- 0:00:00
999500 -- (-550.860) (-551.137) (-553.307) [-550.533] * [-553.039] (-551.043) (-552.298) (-550.111) -- 0:00:00
1000000 -- (-551.274) (-552.070) (-552.781) [-550.882] * [-553.021] (-554.703) (-551.056) (-551.954) -- 0:00:00
Average standard deviation of split frequencies: 0.005684
Analysis completed in 1 mins 1 seconds
Analysis used 59.07 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -549.04
Likelihood of best state for "cold" chain of run 2 was -549.04
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 68 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
34.5 % ( 25 %) Dirichlet(Pi{all})
34.4 % ( 26 %) Slider(Pi{all})
78.9 % ( 49 %) Multiplier(Alpha{1,2})
77.3 % ( 61 %) Multiplier(Alpha{3})
24.4 % ( 26 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
69.9 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.6 % ( 20 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.0 % ( 63 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
33.5 % ( 23 %) Dirichlet(Pi{all})
34.1 % ( 24 %) Slider(Pi{all})
79.1 % ( 53 %) Multiplier(Alpha{1,2})
78.3 % ( 54 %) Multiplier(Alpha{3})
24.2 % ( 31 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.6 % ( 61 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 87 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
97.4 % ( 94 %) Nodeslider(V{all})
30.4 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167140 0.82 0.67
3 | 167291 166484 0.84
4 | 166281 166530 166274
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 167031 0.82 0.66
3 | 166580 166846 0.84
4 | 166797 166309 166437
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -550.95
| 1 2 1 |
| 2 2 2 2 |
| 1 1 2 * 2 1 1 |
| 1 1 1 211 1 * |
|2 2 2 1 1 112 1 21 1 2 21 |
| 2 2212 2 1 1 1 2 2 |
| 1 1 2 2 1*2 1 1 *|
| 2 221 2 1 1 12 2 1 1 2 22 2 1 2 |
| * 21 1 1 2 112 2 2 2 1 |
| 1 * 2 2 1 1 1 1 1 |
|1 2 2 1 2 1 |
| 1 1 2 |
| 1 2 2 2 |
| 2 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -552.34
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -550.79 -553.92
2 -550.79 -554.38
--------------------------------------
TOTAL -550.79 -554.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900510 0.091042 0.383513 1.503505 0.866592 1297.47 1399.23 1.000
r(A<->C){all} 0.162318 0.019763 0.000420 0.450981 0.124596 162.60 181.94 1.000
r(A<->G){all} 0.166558 0.019812 0.000007 0.449714 0.129190 226.88 256.50 1.000
r(A<->T){all} 0.162782 0.019771 0.000062 0.453373 0.124088 199.40 233.57 1.011
r(C<->G){all} 0.175740 0.021727 0.000059 0.463401 0.141105 178.72 197.63 1.000
r(C<->T){all} 0.162734 0.018953 0.000237 0.442528 0.126766 248.27 248.41 1.002
r(G<->T){all} 0.169867 0.021818 0.000049 0.467964 0.126619 217.21 256.46 1.000
pi(A){all} 0.191926 0.000406 0.153950 0.231017 0.190793 1307.85 1385.91 1.000
pi(C){all} 0.264076 0.000458 0.220846 0.304657 0.263788 1386.21 1424.19 1.000
pi(G){all} 0.361691 0.000572 0.316234 0.408662 0.361790 875.56 1151.56 1.001
pi(T){all} 0.182307 0.000353 0.148210 0.221505 0.181706 1317.30 1386.28 1.002
alpha{1,2} 0.413444 0.244141 0.000188 1.393553 0.240819 1253.77 1272.56 1.000
alpha{3} 0.464488 0.263879 0.000175 1.486292 0.290096 1137.01 1231.08 1.000
pinvar{all} 0.996044 0.000023 0.986885 0.999998 0.997589 1180.27 1336.97 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .*.*..
9 -- ..*.*.
10 -- ..****
11 -- .*...*
12 -- ..**..
13 -- ...**.
14 -- .*.***
15 -- ....**
16 -- .***.*
17 -- ...*.*
18 -- .**...
19 -- .*..*.
20 -- .****.
21 -- .**.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 458 0.152565 0.001884 0.151233 0.153897 2
8 455 0.151566 0.003298 0.149234 0.153897 2
9 441 0.146902 0.007066 0.141905 0.151899 2
10 439 0.146236 0.003298 0.143904 0.148568 2
11 438 0.145903 0.002827 0.143904 0.147901 2
12 435 0.144903 0.014604 0.134577 0.155230 2
13 433 0.144237 0.008951 0.137908 0.150566 2
14 429 0.142905 0.004240 0.139907 0.145903 2
15 423 0.140906 0.001413 0.139907 0.141905 2
16 423 0.140906 0.001413 0.139907 0.141905 2
17 422 0.140573 0.009422 0.133911 0.147235 2
18 418 0.139241 0.009422 0.132578 0.145903 2
19 414 0.137908 0.002827 0.135909 0.139907 2
20 407 0.135576 0.012719 0.126582 0.144570 2
21 406 0.135243 0.001884 0.133911 0.136576 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100254 0.009388 0.000058 0.298953 0.069915 1.000 2
length{all}[2] 0.098697 0.009892 0.000016 0.292335 0.067979 1.000 2
length{all}[3] 0.101170 0.010277 0.000033 0.308987 0.067990 1.000 2
length{all}[4] 0.098515 0.009351 0.000011 0.288912 0.067370 1.000 2
length{all}[5] 0.101437 0.010581 0.000014 0.306582 0.069981 1.000 2
length{all}[6] 0.100960 0.009939 0.000015 0.297859 0.071183 1.000 2
length{all}[7] 0.094605 0.008684 0.000017 0.297195 0.064025 0.999 2
length{all}[8] 0.105874 0.010968 0.000072 0.330019 0.079800 1.001 2
length{all}[9] 0.097770 0.009332 0.000435 0.297295 0.067293 1.001 2
length{all}[10] 0.101560 0.009738 0.000118 0.278291 0.074577 0.998 2
length{all}[11] 0.089456 0.008315 0.000609 0.258375 0.066299 1.003 2
length{all}[12] 0.092810 0.008033 0.000178 0.274099 0.061135 1.006 2
length{all}[13] 0.106564 0.011411 0.000099 0.303381 0.074686 0.999 2
length{all}[14] 0.100390 0.010176 0.000077 0.325162 0.067252 0.998 2
length{all}[15] 0.094691 0.008918 0.000712 0.278528 0.066814 1.008 2
length{all}[16] 0.094455 0.009220 0.000005 0.289230 0.066764 0.999 2
length{all}[17] 0.102520 0.012442 0.000074 0.337621 0.068166 0.999 2
length{all}[18] 0.103348 0.010615 0.000048 0.305445 0.077229 0.999 2
length{all}[19] 0.100182 0.010902 0.000131 0.308581 0.072018 1.000 2
length{all}[20] 0.108921 0.012746 0.000020 0.342830 0.070811 0.998 2
length{all}[21] 0.101127 0.008689 0.000162 0.287191 0.075216 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005684
Maximum standard deviation of split frequencies = 0.014604
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 408
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 46 patterns at 136 / 136 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 46 patterns at 136 / 136 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
44896 bytes for conP
4048 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.030428 0.037205 0.013771 0.042516 0.029795 0.097878 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -563.816226
Iterating by ming2
Initial: fx= 563.816226
x= 0.03043 0.03720 0.01377 0.04252 0.02979 0.09788 0.30000 1.30000
1 h-m-p 0.0000 0.0001 326.8208 ++ 552.841286 m 0.0001 13 | 1/8
2 h-m-p 0.0007 0.0074 45.2650 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 298.8171 ++ 542.126330 m 0.0001 44 | 2/8
4 h-m-p 0.0009 0.0098 35.4307 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 267.8746 ++ 541.786496 m 0.0000 75 | 3/8
6 h-m-p 0.0000 0.0128 27.7252 ---------.. | 3/8
7 h-m-p 0.0000 0.0001 231.6868 ++ 539.060725 m 0.0001 104 | 4/8
8 h-m-p 0.0004 0.0165 21.4699 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 189.0124 ++ 537.637770 m 0.0000 135 | 5/8
10 h-m-p 0.0004 0.0235 14.8343 ----------.. | 5/8
11 h-m-p 0.0000 0.0004 133.0583 +++ 530.168586 m 0.0004 166 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 530.168586 m 8.0000 177 | 6/8
13 h-m-p 0.0805 8.0000 0.0005 ----Y 530.168586 0 0.0000 194 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 +++++ 530.168586 m 8.0000 210 | 6/8
15 h-m-p 0.0023 1.1424 1.2908 +++++ 530.168540 m 1.1424 226 | 7/8
16 h-m-p 0.2213 1.1065 0.9011 ++ 530.168395 m 1.1065 237 | 8/8
17 h-m-p 0.0160 8.0000 0.0000 Y 530.168395 0 0.0160 249
Out..
lnL = -530.168395
250 lfun, 250 eigenQcodon, 1500 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.064675 0.085960 0.098276 0.013048 0.041845 0.094977 0.000100 0.709536 0.154680
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 15.428720
np = 9
lnL0 = -578.286098
Iterating by ming2
Initial: fx= 578.286098
x= 0.06468 0.08596 0.09828 0.01305 0.04184 0.09498 0.00011 0.70954 0.15468
1 h-m-p 0.0000 0.0000 273.0939 ++ 578.145845 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0001 352.1969 ++ 568.902005 m 0.0001 26 | 2/9
3 h-m-p 0.0001 0.0007 98.1504 ++ 555.376647 m 0.0007 38 | 3/9
4 h-m-p 0.0001 0.0006 223.7598 ++ 543.444947 m 0.0006 50 | 4/9
5 h-m-p 0.0000 0.0000 3259.5299 ++ 534.041604 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 661.7585 ++ 533.437808 m 0.0000 74 | 6/9
7 h-m-p 0.0003 0.0013 16.7505 ----------.. | 6/9
8 h-m-p 0.0000 0.0001 175.9052 ++ 530.754452 m 0.0001 106 | 7/9
9 h-m-p 0.0004 0.0020 11.2317 ++ 530.647753 m 0.0020 118 | 8/9
10 h-m-p 0.0035 0.0173 0.2199 ++ 530.168395 m 0.0173 130 | 9/9
11 h-m-p 0.0160 8.0000 0.0000 Y 530.168395 0 0.0160 143
Out..
lnL = -530.168395
144 lfun, 432 eigenQcodon, 1728 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.054694 0.089240 0.044301 0.028565 0.063333 0.064951 0.000100 1.757890 0.363646 0.288785 2.652148
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.553348
np = 11
lnL0 = -570.792040
Iterating by ming2
Initial: fx= 570.792040
x= 0.05469 0.08924 0.04430 0.02856 0.06333 0.06495 0.00011 1.75789 0.36365 0.28878 2.65215
1 h-m-p 0.0000 0.0000 259.7647 ++ 570.594309 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0012 150.7574 ++++ 549.845426 m 0.0012 32 | 2/11
3 h-m-p 0.0000 0.0001 414.2559 ++ 541.623746 m 0.0001 46 | 3/11
4 h-m-p 0.0002 0.0012 72.8959 ++ 537.079600 m 0.0012 60 | 4/11
5 h-m-p 0.0012 0.0061 10.0213 -----------.. | 4/11
6 h-m-p 0.0000 0.0000 240.0324 ++ 536.124192 m 0.0000 97 | 5/11
7 h-m-p 0.0007 0.0462 4.7355 -----------.. | 5/11
8 h-m-p 0.0000 0.0001 210.2470 ++ 533.307870 m 0.0001 134 | 6/11
9 h-m-p 0.0030 0.0577 3.5395 ------------.. | 6/11
10 h-m-p 0.0000 0.0000 178.5666 ++ 532.948160 m 0.0000 172 | 7/11
11 h-m-p 0.0160 8.0000 2.4314 -------------.. | 7/11
12 h-m-p 0.0000 0.0002 126.0407 +++ 530.168541 m 0.0002 212 | 8/11
13 h-m-p 0.6294 8.0000 0.0000 ++ 530.168541 m 8.0000 226 | 8/11
14 h-m-p 0.0160 8.0000 0.0442 ----------Y 530.168541 0 0.0000 253 | 8/11
15 h-m-p 0.0160 8.0000 0.0001 +++++ 530.168541 m 8.0000 273 | 8/11
16 h-m-p 0.0160 8.0000 3.1811 -----------Y 530.168541 0 0.0000 301 | 8/11
17 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 530.168541 m 8.0000 346 | 8/11
19 h-m-p 0.0160 8.0000 1.3911 -------------.. | 8/11
20 h-m-p 0.0160 8.0000 0.0000 +++++ 530.168541 m 8.0000 391 | 8/11
21 h-m-p 0.0160 8.0000 0.2583 -------------.. | 8/11
22 h-m-p 0.0160 8.0000 0.0000 +++++ 530.168541 m 8.0000 439 | 8/11
23 h-m-p 0.0160 8.0000 1.6609 -----------Y 530.168541 0 0.0000 467 | 8/11
24 h-m-p 0.0160 8.0000 0.0007 +++++ 530.168541 m 8.0000 484 | 8/11
25 h-m-p 0.0160 8.0000 1.9950 -----------N 530.168541 0 0.0000 512 | 8/11
26 h-m-p 0.0160 8.0000 0.0001 +++++ 530.168541 m 8.0000 529 | 8/11
27 h-m-p 0.0101 5.0691 1.8852 -----------N 530.168541 0 0.0000 557 | 8/11
28 h-m-p 0.0160 8.0000 0.0000 ----Y 530.168541 0 0.0000 575 | 8/11
29 h-m-p 0.0160 8.0000 0.0000 +++++ 530.168541 m 8.0000 595 | 8/11
30 h-m-p 0.0160 8.0000 0.7416 -----------Y 530.168541 0 0.0000 623 | 8/11
31 h-m-p 0.0160 8.0000 0.0000 +++++ 530.168541 m 8.0000 643 | 8/11
32 h-m-p 0.0036 1.8126 4.8898 ----------Y 530.168541 0 0.0000 670 | 8/11
33 h-m-p 0.0160 8.0000 0.0000 +++++ 530.168541 m 8.0000 687 | 8/11
34 h-m-p 0.0160 8.0000 0.0076 +++++ 530.168539 m 8.0000 707 | 8/11
35 h-m-p 0.0282 3.5795 2.1583 ------------C 530.168539 0 0.0000 736 | 8/11
36 h-m-p 0.0160 8.0000 0.0000 ----N 530.168539 0 0.0000 754 | 8/11
37 h-m-p 0.0160 8.0000 0.0000 ---------N 530.168539 0 0.0000 780
Out..
lnL = -530.168539
781 lfun, 3124 eigenQcodon, 14058 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -530.177649 S = -530.166628 -0.004217
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:04
did 20 / 46 patterns 0:04
did 30 / 46 patterns 0:04
did 40 / 46 patterns 0:04
did 46 / 46 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.032587 0.091000 0.087091 0.074860 0.027311 0.082709 0.000100 0.605338 1.307162
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.758955
np = 9
lnL0 = -578.916838
Iterating by ming2
Initial: fx= 578.916838
x= 0.03259 0.09100 0.08709 0.07486 0.02731 0.08271 0.00011 0.60534 1.30716
1 h-m-p 0.0000 0.0000 283.9303 ++ 578.770297 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0112 49.5037 +++++ 556.681047 m 0.0112 29 | 2/9
3 h-m-p 0.0000 0.0001 159.7502 ++ 554.868750 m 0.0001 41 | 3/9
4 h-m-p 0.0002 0.0017 77.6263 ++ 533.620643 m 0.0017 53 | 4/9
5 h-m-p 0.0001 0.0006 34.0198 ++ 533.091022 m 0.0006 65 | 5/9
6 h-m-p 0.0000 0.0001 128.1068 ++ 531.763218 m 0.0001 77 | 6/9
7 h-m-p 0.0000 0.0003 206.8406 ++ 530.168437 m 0.0003 89 | 7/9
8 h-m-p 1.6000 8.0000 0.0001 ++ 530.168436 m 8.0000 101 | 7/9
9 h-m-p 0.0160 8.0000 0.1549 -------------.. | 7/9
10 h-m-p 0.0160 8.0000 0.0004 +++++ 530.168435 m 8.0000 143 | 7/9
11 h-m-p 0.0219 8.0000 0.1504 ------------Y 530.168435 0 0.0000 169 | 7/9
12 h-m-p 0.0160 8.0000 0.0001 +++++ 530.168435 m 8.0000 186 | 7/9
13 h-m-p 0.0011 0.5556 1.5943 ++++
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
+ 530.168395 m 0.5556 203
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.236799e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195078e-160 2000 rounds
| 8/9
14 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
Y 530.168395 0 1.6000 215
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.236799e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19871) = 1.194996e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19847) = 1.195162e-160 2000 rounds
| 8/9
15 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
Y 530.168395 0 0.0160 228
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
Out..
lnL = -530.168395
229 lfun, 2519 eigenQcodon, 13740 P(t)
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19859) = 1.195079e-160 2000 rounds
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.047233 0.053204 0.091355 0.101946 0.041924 0.062335 0.000100 0.900000 0.729478 1.522013 2.936464
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.024445
np = 11
lnL0 = -574.064500
Iterating by ming2
Initial: fx= 574.064500
x= 0.04723 0.05320 0.09135 0.10195 0.04192 0.06234 0.00011 0.90000 0.72948 1.52201 2.93646
1 h-m-p 0.0000 0.0000 234.4704 ++ 573.956692 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 510.1001 +++ 547.985780 m 0.0003 31 | 2/11
3 h-m-p 0.0000 0.0001 213.6187 ++ 544.776267 m 0.0001 45 | 3/11
4 h-m-p 0.0015 0.0484 15.5373 +++ 537.070899 m 0.0484 60 | 3/11
5 h-m-p 0.0000 0.0000 102.5059
h-m-p: 0.00000000e+00 0.00000000e+00 1.02505905e+02 537.070899
.. | 3/11
6 h-m-p 0.0000 0.0000 251.4568 ++ 534.951069 m 0.0000 85 | 4/11
7 h-m-p 0.0000 0.0000 456282.7648 ++ 533.554307 m 0.0000 99 | 5/11
8 h-m-p 0.0000 0.0000 774.2486 ++ 530.665764 m 0.0000 113 | 6/11
9 h-m-p 0.0000 0.0001 47.3582 ++ 530.168437 m 0.0001 127 | 7/11
10 h-m-p 1.6000 8.0000 0.0020 ++ 530.168434 m 8.0000 141 | 7/11
11 h-m-p 0.0557 0.3721 0.2822 ------------Y 530.168434 0 0.0000 171 | 7/11
12 h-m-p 0.0160 8.0000 0.0006 +++++ 530.168433 m 8.0000 192 | 7/11
13 h-m-p 0.0073 0.2046 0.6467 -------------.. | 7/11
14 h-m-p 0.0001 0.0584 0.0019 +++++ 530.168433 m 0.0584 242 | 8/11
15 h-m-p 0.0160 8.0000 0.0071 ----------Y 530.168433 0 0.0000 270 | 8/11
16 h-m-p 0.0160 8.0000 0.0000 -------Y 530.168433 0 0.0000 294 | 8/11
17 h-m-p 0.0000 0.0070 61.9635 +++++ 530.168395 m 0.0070 314 | 9/11
18 h-m-p 1.6000 8.0000 0.0000 -Y 530.168395 0 0.1000 329 | 9/11
19 h-m-p 0.0160 8.0000 0.0000 +Y 530.168395 0 0.0640 346 | 9/11
20 h-m-p 0.2769 8.0000 0.0000 C 530.168395 0 0.0692 362 | 9/11
21 h-m-p 0.3830 8.0000 0.0000 N 530.168395 0 0.3830 378 | 9/11
22 h-m-p 0.6207 8.0000 0.0000 --N 530.168395 0 0.0097 396
Out..
lnL = -530.168395
397 lfun, 4764 eigenQcodon, 26202 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -530.210561 S = -530.169050 -0.018359
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:14
did 20 / 46 patterns 0:14
did 30 / 46 patterns 0:15
did 40 / 46 patterns 0:15
did 46 / 46 patterns 0:15
Time used: 0:15
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=136
NC_011896_1_WP_010908736_1_2287_MLBR_RS10840 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
NC_002677_1_NP_302416_1_1288_cspB VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
NZ_LVXE01000011_1_WP_010908736_1_360_A3216_RS05360 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
NZ_LYPH01000017_1_WP_010908736_1_606_A8144_RS02850 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
NZ_CP029543_1_WP_010908736_1_2308_DIJ64_RS11740 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
NZ_AP014567_1_WP_010908736_1_2373_JK2ML_RS12065 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
**************************************************
NC_011896_1_WP_010908736_1_2287_MLBR_RS10840 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
NC_002677_1_NP_302416_1_1288_cspB ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
NZ_LVXE01000011_1_WP_010908736_1_360_A3216_RS05360 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
NZ_LYPH01000017_1_WP_010908736_1_606_A8144_RS02850 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
NZ_CP029543_1_WP_010908736_1_2308_DIJ64_RS11740 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
NZ_AP014567_1_WP_010908736_1_2373_JK2ML_RS12065 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
**************************************************
NC_011896_1_WP_010908736_1_2287_MLBR_RS10840 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
NC_002677_1_NP_302416_1_1288_cspB LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
NZ_LVXE01000011_1_WP_010908736_1_360_A3216_RS05360 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
NZ_LYPH01000017_1_WP_010908736_1_606_A8144_RS02850 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
NZ_CP029543_1_WP_010908736_1_2308_DIJ64_RS11740 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
NZ_AP014567_1_WP_010908736_1_2373_JK2ML_RS12065 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
************************************
>NC_011896_1_WP_010908736_1_2287_MLBR_RS10840 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT TCGACGCG >NC_002677_1_NP_302416_1_1288_cspB GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT TCGACGCG >NZ_LVXE01000011_1_WP_010908736_1_360_A3216_RS05360 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT TCGACGCG >NZ_LYPH01000017_1_WP_010908736_1_606_A8144_RS02850 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT TCGACGCG >NZ_CP029543_1_WP_010908736_1_2308_DIJ64_RS11740 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT TCGACGCG >NZ_AP014567_1_WP_010908736_1_2373_JK2ML_RS12065 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT TCGACGCG
>NC_011896_1_WP_010908736_1_2287_MLBR_RS10840 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA >NC_002677_1_NP_302416_1_1288_cspB VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA >NZ_LVXE01000011_1_WP_010908736_1_360_A3216_RS05360 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA >NZ_LYPH01000017_1_WP_010908736_1_606_A8144_RS02850 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA >NZ_CP029543_1_WP_010908736_1_2308_DIJ64_RS11740 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA >NZ_AP014567_1_WP_010908736_1_2373_JK2ML_RS12065 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
#NEXUS
[ID: 8835211020]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908736_1_2287_MLBR_RS10840
NC_002677_1_NP_302416_1_1288_cspB
NZ_LVXE01000011_1_WP_010908736_1_360_A3216_RS05360
NZ_LYPH01000017_1_WP_010908736_1_606_A8144_RS02850
NZ_CP029543_1_WP_010908736_1_2308_DIJ64_RS11740
NZ_AP014567_1_WP_010908736_1_2373_JK2ML_RS12065
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908736_1_2287_MLBR_RS10840,
2 NC_002677_1_NP_302416_1_1288_cspB,
3 NZ_LVXE01000011_1_WP_010908736_1_360_A3216_RS05360,
4 NZ_LYPH01000017_1_WP_010908736_1_606_A8144_RS02850,
5 NZ_CP029543_1_WP_010908736_1_2308_DIJ64_RS11740,
6 NZ_AP014567_1_WP_010908736_1_2373_JK2ML_RS12065
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06991541,2:0.06797891,3:0.06798959,4:0.06736975,5:0.06998108,6:0.0711832);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06991541,2:0.06797891,3:0.06798959,4:0.06736975,5:0.06998108,6:0.0711832);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -550.79 -553.92
2 -550.79 -554.38
--------------------------------------
TOTAL -550.79 -554.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900510 0.091042 0.383513 1.503505 0.866592 1297.47 1399.23 1.000
r(A<->C){all} 0.162318 0.019763 0.000420 0.450981 0.124596 162.60 181.94 1.000
r(A<->G){all} 0.166558 0.019812 0.000007 0.449714 0.129190 226.88 256.50 1.000
r(A<->T){all} 0.162782 0.019771 0.000062 0.453373 0.124088 199.40 233.57 1.011
r(C<->G){all} 0.175740 0.021727 0.000059 0.463401 0.141105 178.72 197.63 1.000
r(C<->T){all} 0.162734 0.018953 0.000237 0.442528 0.126766 248.27 248.41 1.002
r(G<->T){all} 0.169867 0.021818 0.000049 0.467964 0.126619 217.21 256.46 1.000
pi(A){all} 0.191926 0.000406 0.153950 0.231017 0.190793 1307.85 1385.91 1.000
pi(C){all} 0.264076 0.000458 0.220846 0.304657 0.263788 1386.21 1424.19 1.000
pi(G){all} 0.361691 0.000572 0.316234 0.408662 0.361790 875.56 1151.56 1.001
pi(T){all} 0.182307 0.000353 0.148210 0.221505 0.181706 1317.30 1386.28 1.002
alpha{1,2} 0.413444 0.244141 0.000188 1.393553 0.240819 1253.77 1272.56 1.000
alpha{3} 0.464488 0.263879 0.000175 1.486292 0.290096 1137.01 1231.08 1.000
pinvar{all} 0.996044 0.000023 0.986885 0.999998 0.997589 1180.27 1336.97 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/cspB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 136
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2
CTC 2 2 2 2 2 2 | CCC 2 2 2 2 2 2 | CAC 3 3 3 3 3 3 | CGC 7 7 7 7 7 7
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 3 3 3 3 3 3 | CGA 0 0 0 0 0 0
CTG 3 3 3 3 3 3 | CCG 6 6 6 6 6 6 | CAG 2 2 2 2 2 2 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 1 1 1 1 1 1 | ACC 1 1 1 1 1 1 | AAC 0 0 0 0 0 0 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 2 2 2 2 2 2 | AAG 5 5 5 5 5 5 | AGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 2 2 2 2 2 2 | Asp GAT 5 5 5 5 5 5 | Gly GGT 1 1 1 1 1 1
GTC 4 4 4 4 4 4 | GCC 5 5 5 5 5 5 | GAC 4 4 4 4 4 4 | GGC 7 7 7 7 7 7
GTA 2 2 2 2 2 2 | GCA 1 1 1 1 1 1 | Glu GAA 4 4 4 4 4 4 | GGA 0 0 0 0 0 0
GTG 7 7 7 7 7 7 | GCG 5 5 5 5 5 5 | GAG 8 8 8 8 8 8 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908736_1_2287_MLBR_RS10840
position 1: T:0.13971 C:0.25000 A:0.16912 G:0.44118
position 2: T:0.25000 C:0.22794 A:0.29412 G:0.22794
position 3: T:0.15441 C:0.31618 A:0.11029 G:0.41912
Average T:0.18137 C:0.26471 A:0.19118 G:0.36275
#2: NC_002677_1_NP_302416_1_1288_cspB
position 1: T:0.13971 C:0.25000 A:0.16912 G:0.44118
position 2: T:0.25000 C:0.22794 A:0.29412 G:0.22794
position 3: T:0.15441 C:0.31618 A:0.11029 G:0.41912
Average T:0.18137 C:0.26471 A:0.19118 G:0.36275
#3: NZ_LVXE01000011_1_WP_010908736_1_360_A3216_RS05360
position 1: T:0.13971 C:0.25000 A:0.16912 G:0.44118
position 2: T:0.25000 C:0.22794 A:0.29412 G:0.22794
position 3: T:0.15441 C:0.31618 A:0.11029 G:0.41912
Average T:0.18137 C:0.26471 A:0.19118 G:0.36275
#4: NZ_LYPH01000017_1_WP_010908736_1_606_A8144_RS02850
position 1: T:0.13971 C:0.25000 A:0.16912 G:0.44118
position 2: T:0.25000 C:0.22794 A:0.29412 G:0.22794
position 3: T:0.15441 C:0.31618 A:0.11029 G:0.41912
Average T:0.18137 C:0.26471 A:0.19118 G:0.36275
#5: NZ_CP029543_1_WP_010908736_1_2308_DIJ64_RS11740
position 1: T:0.13971 C:0.25000 A:0.16912 G:0.44118
position 2: T:0.25000 C:0.22794 A:0.29412 G:0.22794
position 3: T:0.15441 C:0.31618 A:0.11029 G:0.41912
Average T:0.18137 C:0.26471 A:0.19118 G:0.36275
#6: NZ_AP014567_1_WP_010908736_1_2373_JK2ML_RS12065
position 1: T:0.13971 C:0.25000 A:0.16912 G:0.44118
position 2: T:0.25000 C:0.22794 A:0.29412 G:0.22794
position 3: T:0.15441 C:0.31618 A:0.11029 G:0.41912
Average T:0.18137 C:0.26471 A:0.19118 G:0.36275
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 12 | Tyr Y TAT 12 | Cys C TGT 0
TTC 12 | TCC 0 | TAC 6 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 12 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 12
CTC 12 | CCC 12 | CAC 18 | CGC 42
CTA 0 | CCA 6 | Gln Q CAA 18 | CGA 0
CTG 18 | CCG 36 | CAG 12 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 0
ATC 6 | ACC 6 | AAC 0 | AGC 24
ATA 0 | ACA 0 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 12 | ACG 12 | AAG 30 | AGG 18
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 12 | Asp D GAT 30 | Gly G GGT 6
GTC 24 | GCC 30 | GAC 24 | GGC 42
GTA 12 | GCA 6 | Glu E GAA 24 | GGA 0
GTG 42 | GCG 30 | GAG 48 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13971 C:0.25000 A:0.16912 G:0.44118
position 2: T:0.25000 C:0.22794 A:0.29412 G:0.22794
position 3: T:0.15441 C:0.31618 A:0.11029 G:0.41912
Average T:0.18137 C:0.26471 A:0.19118 G:0.36275
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -530.168395 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908736_1_2287_MLBR_RS10840: 0.000004, NC_002677_1_NP_302416_1_1288_cspB: 0.000004, NZ_LVXE01000011_1_WP_010908736_1_360_A3216_RS05360: 0.000004, NZ_LYPH01000017_1_WP_010908736_1_606_A8144_RS02850: 0.000004, NZ_CP029543_1_WP_010908736_1_2308_DIJ64_RS11740: 0.000004, NZ_AP014567_1_WP_010908736_1_2373_JK2ML_RS12065: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 326.8 81.2 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 326.8 81.2 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 326.8 81.2 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 326.8 81.2 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 326.8 81.2 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 326.8 81.2 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -530.168395 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908736_1_2287_MLBR_RS10840: 0.000004, NC_002677_1_NP_302416_1_1288_cspB: 0.000004, NZ_LVXE01000011_1_WP_010908736_1_360_A3216_RS05360: 0.000004, NZ_LYPH01000017_1_WP_010908736_1_606_A8144_RS02850: 0.000004, NZ_CP029543_1_WP_010908736_1_2308_DIJ64_RS11740: 0.000004, NZ_AP014567_1_WP_010908736_1_2373_JK2ML_RS12065: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -530.168539 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.722312 0.162451 0.000001 2.701383
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908736_1_2287_MLBR_RS10840: 0.000004, NC_002677_1_NP_302416_1_1288_cspB: 0.000004, NZ_LVXE01000011_1_WP_010908736_1_360_A3216_RS05360: 0.000004, NZ_LYPH01000017_1_WP_010908736_1_606_A8144_RS02850: 0.000004, NZ_CP029543_1_WP_010908736_1_2308_DIJ64_RS11740: 0.000004, NZ_AP014567_1_WP_010908736_1_2373_JK2ML_RS12065: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.72231 0.16245 0.11524
w: 0.00000 1.00000 2.70138
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 326.8 81.2 0.4738 0.0000 0.0000 0.0 0.0
7..2 0.000 326.8 81.2 0.4738 0.0000 0.0000 0.0 0.0
7..3 0.000 326.8 81.2 0.4738 0.0000 0.0000 0.0 0.0
7..4 0.000 326.8 81.2 0.4738 0.0000 0.0000 0.0 0.0
7..5 0.000 326.8 81.2 0.4738 0.0000 0.0000 0.0 0.0
7..6 0.000 326.8 81.2 0.4738 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908736_1_2287_MLBR_RS10840)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908736_1_2287_MLBR_RS10840)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -530.168395 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 2.198587
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908736_1_2287_MLBR_RS10840: 0.000004, NC_002677_1_NP_302416_1_1288_cspB: 0.000004, NZ_LVXE01000011_1_WP_010908736_1_360_A3216_RS05360: 0.000004, NZ_LYPH01000017_1_WP_010908736_1_606_A8144_RS02850: 0.000004, NZ_CP029543_1_WP_010908736_1_2308_DIJ64_RS11740: 0.000004, NZ_AP014567_1_WP_010908736_1_2373_JK2ML_RS12065: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 2.19859
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -530.168395 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.365911 3.230948
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908736_1_2287_MLBR_RS10840: 0.000004, NC_002677_1_NP_302416_1_1288_cspB: 0.000004, NZ_LVXE01000011_1_WP_010908736_1_360_A3216_RS05360: 0.000004, NZ_LYPH01000017_1_WP_010908736_1_606_A8144_RS02850: 0.000004, NZ_CP029543_1_WP_010908736_1_2308_DIJ64_RS11740: 0.000004, NZ_AP014567_1_WP_010908736_1_2373_JK2ML_RS12065: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.36591
(p1 = 0.00001) w = 3.23095
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 3.23095
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 326.8 81.2 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908736_1_2287_MLBR_RS10840)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.103 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Time used: 0:15
Model 1: NearlyNeutral -530.168395 Model 2: PositiveSelection -530.168539 Model 0: one-ratio -530.168395 Model 7: beta -530.168395 Model 8: beta&w>1 -530.168395 Model 0 vs 1 0.0 Model 2 vs 1 2.879999999549909E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
