--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 10:12:48 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/cspB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -550.79 -553.92
2 -550.79 -554.38
--------------------------------------
TOTAL -550.79 -554.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900510 0.091042 0.383513 1.503505 0.866592 1297.47 1399.23 1.000
r(A<->C){all} 0.162318 0.019763 0.000420 0.450981 0.124596 162.60 181.94 1.000
r(A<->G){all} 0.166558 0.019812 0.000007 0.449714 0.129190 226.88 256.50 1.000
r(A<->T){all} 0.162782 0.019771 0.000062 0.453373 0.124088 199.40 233.57 1.011
r(C<->G){all} 0.175740 0.021727 0.000059 0.463401 0.141105 178.72 197.63 1.000
r(C<->T){all} 0.162734 0.018953 0.000237 0.442528 0.126766 248.27 248.41 1.002
r(G<->T){all} 0.169867 0.021818 0.000049 0.467964 0.126619 217.21 256.46 1.000
pi(A){all} 0.191926 0.000406 0.153950 0.231017 0.190793 1307.85 1385.91 1.000
pi(C){all} 0.264076 0.000458 0.220846 0.304657 0.263788 1386.21 1424.19 1.000
pi(G){all} 0.361691 0.000572 0.316234 0.408662 0.361790 875.56 1151.56 1.001
pi(T){all} 0.182307 0.000353 0.148210 0.221505 0.181706 1317.30 1386.28 1.002
alpha{1,2} 0.413444 0.244141 0.000188 1.393553 0.240819 1253.77 1272.56 1.000
alpha{3} 0.464488 0.263879 0.000175 1.486292 0.290096 1137.01 1231.08 1.000
pinvar{all} 0.996044 0.000023 0.986885 0.999998 0.997589 1180.27 1336.97 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -530.168395
Model 2: PositiveSelection -530.168539
Model 0: one-ratio -530.168395
Model 7: beta -530.168395
Model 8: beta&w>1 -530.168395
Model 0 vs 1 0.0
Model 2 vs 1 2.879999999549909E-4
Model 8 vs 7 0.0
>C1
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C2
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C3
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C4
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C5
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C6
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=136
C1 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C2 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C3 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C4 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C5 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C6 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
**************************************************
C1 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C2 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C3 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C4 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C5 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C6 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
**************************************************
C1 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C2 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C3 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C4 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C5 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C6 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 136 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 136 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4080]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4080]--->[4080]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.463 Mb, Max= 30.667 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C2 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C3 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C4 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C5 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
C6 VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
**************************************************
C1 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C2 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C3 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C4 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C5 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
C6 ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
**************************************************
C1 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C2 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C3 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C4 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C5 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
C6 LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
C2 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
C3 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
C4 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
C5 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
C6 GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
**************************************************
C1 CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
C2 CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
C3 CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
C4 CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
C5 CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
C6 CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
**************************************************
C1 CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
C2 CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
C3 CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
C4 CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
C5 CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
C6 CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
**************************************************
C1 GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
C2 GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
C3 GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
C4 GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
C5 GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
C6 GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
**************************************************
C1 GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
C2 GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
C3 GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
C4 GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
C5 GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
C6 GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
**************************************************
C1 GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
C2 GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
C3 GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
C4 GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
C5 GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
C6 GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
**************************************************
C1 CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
C2 CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
C3 CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
C4 CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
C5 CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
C6 CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
**************************************************
C1 CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
C2 CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
C3 CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
C4 CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
C5 CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
C6 CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
**************************************************
C1 TCGACGCG
C2 TCGACGCG
C3 TCGACGCG
C4 TCGACGCG
C5 TCGACGCG
C6 TCGACGCG
********
>C1
GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
TCGACGCG
>C2
GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
TCGACGCG
>C3
GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
TCGACGCG
>C4
GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
TCGACGCG
>C5
GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
TCGACGCG
>C6
GTGCCGACCGGCAAGGTGAAGTGGTATGACGCCGACAAGGGGTTTGGCTT
CCTTTCACAGGAGGATGGCGAAGACGTCTATGTTCGCTCGTCGGCGTTGC
CCGCGGGTGTCGAGGGGCTCAAAGCCGGGCAACGGGTAGAGTTTGGCGTG
GCTTCTGGCCGGCGTGGGCCGCAAGCATTGAGCCTCAAGTTGATTGATCC
GCCACCGAGCTTTGCTCGCCAAGTGCGCCGCGAGGCGCTGGCCGAGCACA
GGCACAGCCCGGATGAACTGCACGGCATGGTCGAAGATATGATCACTTTG
CTGGAGAGCACGGTGCAGCCCGAATTGCGTAAAGGCCGCTACCCGGATCG
CAAAACGGCCAGGAGGGTATCTGAGGTGGTCAAGGCGGTGGCCCGCGAGT
TCGACGCG
>C1
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C2
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C3
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C4
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C5
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
>C6
VPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGV
ASGRRGPQALSLKLIDPPPSFARQVRREALAEHRHSPDELHGMVEDMITL
LESTVQPELRKGRYPDRKTARRVSEVVKAVAREFDA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 408 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579774290
Setting output file names to "/data/1res/cspB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1822642686
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8835211020
Seed = 1022277194
Swapseed = 1579774290
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -913.123558 -- -24.965149
Chain 2 -- -913.123558 -- -24.965149
Chain 3 -- -913.123558 -- -24.965149
Chain 4 -- -913.123558 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -913.123419 -- -24.965149
Chain 2 -- -913.123558 -- -24.965149
Chain 3 -- -913.123558 -- -24.965149
Chain 4 -- -913.123505 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-913.124] (-913.124) (-913.124) (-913.124) * [-913.123] (-913.124) (-913.124) (-913.124)
500 -- [-562.296] (-568.775) (-563.418) (-568.599) * [-566.774] (-572.115) (-565.221) (-574.889) -- 0:00:00
1000 -- (-562.257) (-569.709) (-554.271) [-552.615] * (-558.314) (-564.265) [-558.595] (-566.742) -- 0:00:00
1500 -- (-568.262) [-563.759] (-563.035) (-561.109) * (-563.812) (-558.808) [-559.231] (-564.270) -- 0:00:00
2000 -- [-557.237] (-561.422) (-563.326) (-567.111) * (-564.122) (-557.968) [-555.551] (-562.581) -- 0:00:00
2500 -- [-554.828] (-553.604) (-571.216) (-562.784) * (-569.485) (-566.136) (-560.692) [-556.788] -- 0:00:00
3000 -- (-560.111) [-556.414] (-562.477) (-567.825) * (-560.634) [-560.661] (-555.743) (-561.396) -- 0:05:32
3500 -- (-563.836) (-566.120) [-557.503] (-563.061) * (-559.569) (-562.700) [-556.729] (-555.934) -- 0:04:44
4000 -- [-555.982] (-566.728) (-571.509) (-560.964) * (-568.674) (-559.791) [-554.355] (-555.351) -- 0:04:09
4500 -- (-559.214) (-564.602) [-557.526] (-563.631) * [-558.455] (-567.307) (-565.392) (-561.640) -- 0:03:41
5000 -- (-558.316) (-565.429) (-553.963) [-562.516] * [-563.568] (-558.644) (-563.971) (-571.179) -- 0:03:19
Average standard deviation of split frequencies: 0.099995
5500 -- [-560.527] (-561.226) (-559.048) (-564.010) * (-564.593) [-562.207] (-564.193) (-564.394) -- 0:03:00
6000 -- (-559.697) (-556.333) (-559.670) [-559.914] * (-560.833) (-559.687) (-563.836) [-558.936] -- 0:02:45
6500 -- (-563.643) (-560.493) [-561.589] (-560.853) * (-555.869) (-563.605) (-559.550) [-564.117] -- 0:02:32
7000 -- [-555.790] (-556.571) (-562.140) (-563.537) * (-567.514) (-561.542) (-558.828) [-555.223] -- 0:02:21
7500 -- [-558.569] (-559.948) (-561.437) (-565.826) * (-565.132) (-561.330) (-557.142) [-564.974] -- 0:02:12
8000 -- [-563.506] (-559.989) (-565.978) (-564.651) * [-555.382] (-566.175) (-557.870) (-568.598) -- 0:02:04
8500 -- (-554.255) (-572.120) (-568.333) [-561.704] * [-559.219] (-554.989) (-563.790) (-552.060) -- 0:01:56
9000 -- (-565.739) (-561.629) (-562.969) [-550.023] * (-568.648) (-557.085) [-553.460] (-549.870) -- 0:01:50
9500 -- (-557.903) (-570.642) [-561.403] (-552.367) * (-560.393) (-562.537) (-563.690) [-550.157] -- 0:01:44
10000 -- (-559.641) (-556.284) (-575.090) [-550.318] * (-555.410) [-552.837] (-564.213) (-551.728) -- 0:01:39
Average standard deviation of split frequencies: 0.061030
10500 -- (-559.526) [-570.416] (-560.156) (-552.990) * [-557.724] (-566.205) (-562.939) (-551.563) -- 0:01:34
11000 -- (-562.106) [-555.386] (-561.063) (-552.303) * [-560.860] (-559.930) (-565.169) (-550.520) -- 0:01:29
11500 -- (-559.956) [-561.162] (-560.932) (-549.818) * (-555.984) [-557.578] (-568.295) (-550.778) -- 0:01:25
12000 -- (-559.956) (-562.406) (-560.774) [-552.355] * (-566.496) [-555.919] (-572.586) (-550.227) -- 0:01:22
12500 -- [-557.167] (-560.380) (-563.715) (-550.750) * [-562.750] (-564.274) (-568.500) (-552.529) -- 0:01:19
13000 -- (-556.319) (-561.088) (-561.146) [-553.351] * [-561.784] (-569.136) (-564.134) (-552.856) -- 0:01:15
13500 -- (-561.473) (-566.962) (-563.687) [-551.395] * [-556.049] (-559.532) (-550.697) (-550.606) -- 0:01:13
14000 -- (-557.732) (-558.793) [-562.183] (-552.364) * [-562.747] (-568.344) (-552.447) (-553.473) -- 0:01:10
14500 -- (-559.682) (-558.107) (-563.027) [-550.010] * [-561.622] (-556.098) (-550.248) (-551.838) -- 0:01:07
15000 -- (-561.923) (-561.546) [-558.022] (-549.914) * (-563.493) (-556.717) [-550.210] (-551.129) -- 0:01:05
Average standard deviation of split frequencies: 0.067591
15500 -- [-561.209] (-563.627) (-558.904) (-553.509) * [-561.360] (-559.017) (-551.768) (-550.385) -- 0:01:03
16000 -- (-562.454) (-558.368) (-559.544) [-549.919] * (-563.617) [-557.752] (-550.851) (-552.287) -- 0:01:01
16500 -- (-560.896) [-558.518] (-559.284) (-553.164) * [-561.329] (-564.594) (-550.029) (-556.864) -- 0:00:59
17000 -- (-560.874) (-560.544) (-560.586) [-553.174] * (-560.615) [-560.135] (-551.627) (-554.059) -- 0:00:57
17500 -- (-562.659) (-559.775) (-561.673) [-551.359] * (-559.655) [-558.038] (-554.011) (-550.553) -- 0:00:56
18000 -- [-555.835] (-562.963) (-558.261) (-552.343) * (-562.655) (-563.963) (-551.125) [-551.858] -- 0:00:54
18500 -- [-560.800] (-561.620) (-558.249) (-555.223) * (-559.230) (-557.728) (-550.940) [-551.796] -- 0:01:46
19000 -- (-559.907) (-562.391) (-560.300) [-550.008] * (-557.354) (-560.874) [-549.986] (-551.673) -- 0:01:43
19500 -- [-559.019] (-566.109) (-567.460) (-552.206) * (-566.581) (-559.118) [-550.473] (-551.849) -- 0:01:40
20000 -- (-555.294) [-562.007] (-561.797) (-554.276) * (-562.190) (-566.986) [-551.179] (-552.214) -- 0:01:38
Average standard deviation of split frequencies: 0.041343
20500 -- (-560.363) [-566.170] (-564.376) (-553.891) * (-559.663) (-564.083) [-550.984] (-552.117) -- 0:01:35
21000 -- (-558.084) (-569.598) [-556.048] (-550.880) * (-567.042) (-556.110) [-551.684] (-554.903) -- 0:01:33
21500 -- (-570.482) (-560.491) [-556.208] (-552.869) * (-564.500) [-559.059] (-551.503) (-551.272) -- 0:01:31
22000 -- [-557.098] (-566.835) (-558.348) (-551.587) * [-558.392] (-555.180) (-557.851) (-550.186) -- 0:01:28
22500 -- (-567.286) (-558.148) [-560.053] (-552.596) * (-562.598) [-553.428] (-550.087) (-549.500) -- 0:01:26
23000 -- (-552.822) (-557.663) (-552.569) [-554.441] * [-558.849] (-560.930) (-553.117) (-550.243) -- 0:01:24
23500 -- (-557.622) (-561.302) [-550.712] (-554.868) * (-557.734) [-558.068] (-549.579) (-550.613) -- 0:01:23
24000 -- [-551.609] (-562.962) (-549.982) (-551.981) * (-559.453) (-562.481) [-551.644] (-550.168) -- 0:01:21
24500 -- (-553.203) (-564.123) [-553.596] (-551.348) * [-556.938] (-556.781) (-552.064) (-556.303) -- 0:01:19
25000 -- (-550.477) [-565.126] (-552.619) (-551.562) * (-559.748) (-567.418) [-550.988] (-552.368) -- 0:01:18
Average standard deviation of split frequencies: 0.033897
25500 -- [-551.949] (-561.427) (-552.297) (-551.817) * [-562.598] (-568.406) (-550.193) (-553.522) -- 0:01:16
26000 -- (-549.602) [-564.520] (-549.991) (-551.912) * (-555.706) (-560.808) [-551.612] (-553.173) -- 0:01:14
26500 -- (-550.183) [-555.542] (-550.699) (-549.805) * (-559.253) (-562.430) (-549.979) [-551.010] -- 0:01:13
27000 -- (-552.249) [-563.066] (-553.815) (-549.640) * (-571.009) [-557.560] (-549.846) (-551.269) -- 0:01:12
27500 -- (-552.680) (-558.355) (-552.967) [-549.435] * (-558.063) (-557.803) (-553.097) [-550.633] -- 0:01:10
28000 -- (-551.512) [-556.572] (-551.598) (-552.698) * (-558.868) [-563.066] (-551.463) (-555.328) -- 0:01:09
28500 -- (-551.487) (-559.657) [-551.944] (-555.555) * (-566.753) (-556.889) (-552.223) [-551.758] -- 0:01:08
29000 -- (-552.073) [-567.652] (-552.072) (-550.424) * (-560.688) [-555.759] (-551.416) (-551.861) -- 0:01:06
29500 -- [-550.123] (-561.987) (-549.662) (-550.166) * (-560.697) [-565.875] (-551.686) (-551.857) -- 0:01:05
30000 -- (-552.722) (-560.375) (-550.978) [-549.956] * (-555.471) (-565.674) (-550.969) [-553.467] -- 0:01:04
Average standard deviation of split frequencies: 0.039528
30500 -- [-550.169] (-557.651) (-551.434) (-553.944) * (-556.573) [-557.571] (-550.079) (-550.158) -- 0:01:03
31000 -- [-550.907] (-572.859) (-550.588) (-550.999) * (-563.051) [-564.781] (-551.068) (-550.902) -- 0:01:02
31500 -- [-551.201] (-550.290) (-549.989) (-550.993) * [-558.066] (-568.727) (-549.580) (-562.099) -- 0:01:01
32000 -- (-550.985) [-550.202] (-550.607) (-550.572) * [-558.445] (-571.170) (-554.820) (-551.929) -- 0:01:00
32500 -- (-549.624) [-553.253] (-551.131) (-551.347) * (-558.058) (-551.481) (-553.953) [-550.070] -- 0:00:59
33000 -- (-550.484) (-552.822) (-549.821) [-551.248] * (-564.066) (-552.608) (-555.159) [-551.869] -- 0:00:58
33500 -- (-552.279) (-550.597) (-550.683) [-549.301] * [-557.716] (-550.653) (-550.984) (-550.736) -- 0:00:57
34000 -- (-554.388) [-551.518] (-552.775) (-549.597) * [-560.877] (-554.843) (-552.139) (-551.285) -- 0:00:56
34500 -- (-553.815) (-552.760) (-551.513) [-553.213] * (-560.520) (-553.913) (-550.758) [-551.023] -- 0:00:55
35000 -- [-550.246] (-553.878) (-552.781) (-551.446) * (-554.854) [-552.733] (-554.231) (-553.186) -- 0:01:22
Average standard deviation of split frequencies: 0.035868
35500 -- [-550.544] (-552.444) (-554.234) (-551.839) * [-558.545] (-550.966) (-556.585) (-553.298) -- 0:01:21
36000 -- (-552.230) (-551.247) [-550.967] (-550.006) * (-573.820) (-550.874) [-551.028] (-550.345) -- 0:01:20
36500 -- (-551.486) (-551.584) [-551.772] (-552.862) * (-565.139) (-554.636) (-550.699) [-551.059] -- 0:01:19
37000 -- (-550.086) (-551.733) (-550.481) [-550.769] * (-573.223) [-551.410] (-550.193) (-550.594) -- 0:01:18
37500 -- (-550.272) [-552.896] (-552.530) (-550.037) * [-564.019] (-552.472) (-551.321) (-550.135) -- 0:01:17
38000 -- (-550.761) (-554.079) [-550.785] (-550.767) * (-567.530) (-550.448) (-553.923) [-549.891] -- 0:01:15
38500 -- (-552.090) [-552.837] (-549.468) (-555.458) * (-556.056) (-551.580) (-557.451) [-555.600] -- 0:01:14
39000 -- (-551.473) [-552.593] (-549.365) (-552.091) * (-558.247) [-550.064] (-554.120) (-555.478) -- 0:01:13
39500 -- [-551.863] (-550.516) (-555.548) (-550.823) * [-557.971] (-550.105) (-551.382) (-553.222) -- 0:01:12
40000 -- [-549.247] (-550.800) (-554.857) (-559.520) * (-587.233) (-550.286) (-550.821) [-552.651] -- 0:01:12
Average standard deviation of split frequencies: 0.039046
40500 -- [-553.296] (-552.317) (-551.313) (-550.143) * (-574.956) [-552.791] (-550.683) (-550.535) -- 0:01:11
41000 -- [-551.781] (-554.365) (-549.511) (-551.066) * (-557.340) [-553.513] (-553.191) (-551.971) -- 0:01:10
41500 -- (-549.444) (-550.967) (-550.129) [-551.793] * [-550.356] (-553.006) (-551.861) (-550.603) -- 0:01:09
42000 -- [-549.609] (-549.729) (-552.135) (-549.879) * [-550.461] (-554.908) (-554.336) (-554.861) -- 0:01:08
42500 -- (-553.142) (-549.824) [-553.335] (-551.398) * (-550.626) (-552.905) (-555.765) [-552.655] -- 0:01:07
43000 -- (-552.699) [-550.149] (-554.647) (-554.039) * [-551.080] (-550.386) (-550.600) (-553.133) -- 0:01:06
43500 -- (-553.483) (-552.620) [-551.069] (-551.062) * (-550.203) (-551.496) [-551.475] (-554.288) -- 0:01:05
44000 -- [-553.091] (-553.750) (-552.785) (-550.272) * (-552.274) [-551.259] (-552.321) (-551.317) -- 0:01:05
44500 -- (-552.130) (-554.842) [-555.324] (-549.907) * (-550.386) [-550.900] (-553.362) (-550.335) -- 0:01:04
45000 -- [-550.263] (-552.308) (-552.752) (-550.617) * (-550.451) (-551.986) (-550.314) [-550.232] -- 0:01:03
Average standard deviation of split frequencies: 0.033539
45500 -- (-550.740) (-553.952) (-551.106) [-551.566] * (-549.898) (-551.021) (-557.505) [-550.672] -- 0:01:02
46000 -- (-552.003) (-551.267) (-550.012) [-551.289] * (-551.571) [-551.516] (-554.412) (-554.309) -- 0:01:02
46500 -- (-552.322) [-552.228] (-552.465) (-551.225) * (-551.403) [-550.750] (-550.626) (-549.370) -- 0:01:01
47000 -- (-551.132) [-550.795] (-554.302) (-552.743) * (-551.680) (-551.087) [-550.406] (-551.243) -- 0:01:00
47500 -- (-553.075) (-557.271) (-551.458) [-551.154] * [-550.067] (-550.058) (-554.512) (-555.360) -- 0:01:00
48000 -- (-550.008) [-553.118] (-549.885) (-557.601) * (-551.723) [-550.978] (-551.371) (-552.037) -- 0:00:59
48500 -- (-551.779) [-551.676] (-550.549) (-553.895) * [-552.445] (-553.055) (-549.594) (-550.425) -- 0:00:58
49000 -- (-552.538) (-554.739) [-550.123] (-550.563) * (-558.658) [-550.175] (-551.277) (-550.191) -- 0:00:58
49500 -- (-550.737) (-549.534) [-550.794] (-551.044) * (-550.677) (-551.190) (-554.903) [-552.930] -- 0:00:57
50000 -- (-550.143) [-550.095] (-549.660) (-553.136) * (-550.107) (-550.105) [-551.815] (-556.303) -- 0:00:57
Average standard deviation of split frequencies: 0.036773
50500 -- (-551.265) [-555.345] (-551.610) (-552.613) * [-549.830] (-550.930) (-557.279) (-554.404) -- 0:00:56
51000 -- (-549.477) (-554.007) (-553.710) [-552.679] * (-553.409) [-549.892] (-557.383) (-550.880) -- 0:00:55
51500 -- (-551.147) (-552.666) [-553.470] (-552.068) * [-551.472] (-550.352) (-555.920) (-553.007) -- 0:00:55
52000 -- (-552.705) (-550.188) [-551.597] (-553.781) * (-551.745) (-550.243) [-554.509] (-551.116) -- 0:00:54
52500 -- [-553.258] (-550.579) (-551.398) (-555.181) * (-551.884) [-550.030] (-553.889) (-550.234) -- 0:01:12
53000 -- (-553.736) (-552.455) [-549.849] (-555.348) * (-550.320) (-550.276) (-551.633) [-549.830] -- 0:01:11
53500 -- (-553.376) (-553.278) (-549.143) [-551.402] * [-554.748] (-553.326) (-554.077) (-553.780) -- 0:01:10
54000 -- (-555.021) (-550.299) (-551.073) [-549.943] * (-554.756) (-553.971) [-549.505] (-553.297) -- 0:01:10
54500 -- [-549.517] (-549.218) (-549.873) (-550.626) * (-551.910) (-552.342) [-551.550] (-550.062) -- 0:01:09
55000 -- (-553.626) (-552.995) [-551.367] (-550.618) * (-551.008) [-550.025] (-549.779) (-549.969) -- 0:01:08
Average standard deviation of split frequencies: 0.033306
55500 -- (-551.672) [-551.996] (-552.577) (-549.799) * (-551.188) (-550.281) [-550.820] (-553.378) -- 0:01:08
56000 -- (-551.740) (-550.835) [-550.212] (-552.267) * (-550.251) (-552.162) (-551.165) [-550.083] -- 0:01:07
56500 -- (-552.817) (-551.375) [-549.598] (-552.253) * (-550.260) (-552.759) (-550.518) [-552.669] -- 0:01:06
57000 -- (-550.445) (-551.321) [-554.675] (-551.062) * [-549.852] (-553.314) (-550.123) (-550.917) -- 0:01:06
57500 -- (-550.082) (-549.847) (-555.745) [-550.907] * [-549.866] (-552.538) (-549.804) (-552.564) -- 0:01:05
58000 -- (-552.966) (-553.965) (-550.348) [-550.641] * (-550.937) (-549.954) [-549.630] (-551.978) -- 0:01:04
58500 -- (-550.851) (-551.627) (-553.439) [-550.138] * (-551.050) (-551.579) [-549.663] (-553.630) -- 0:01:04
59000 -- (-552.018) [-551.640] (-550.831) (-552.513) * [-552.481] (-551.998) (-554.606) (-552.177) -- 0:01:03
59500 -- [-551.669] (-549.661) (-551.413) (-554.015) * (-553.353) [-550.465] (-551.288) (-555.994) -- 0:01:03
60000 -- [-551.920] (-549.903) (-551.400) (-549.959) * (-550.714) [-549.998] (-552.196) (-553.566) -- 0:01:02
Average standard deviation of split frequencies: 0.038075
60500 -- (-551.326) (-552.060) [-551.519] (-552.776) * (-550.986) [-552.357] (-552.717) (-549.573) -- 0:01:02
61000 -- (-553.294) (-551.616) [-555.816] (-552.130) * (-551.463) (-551.628) (-558.168) [-550.653] -- 0:01:01
61500 -- (-552.068) (-551.993) (-559.536) [-550.361] * (-553.212) [-551.177] (-552.829) (-550.259) -- 0:01:01
62000 -- [-557.796] (-550.245) (-550.590) (-550.121) * (-549.250) (-552.504) [-553.486] (-549.823) -- 0:01:00
62500 -- (-549.799) (-552.453) [-550.616] (-553.571) * (-550.555) (-552.319) [-551.669] (-551.330) -- 0:01:00
63000 -- [-549.448] (-554.641) (-549.695) (-554.803) * (-549.999) (-551.409) [-554.578] (-552.285) -- 0:00:59
63500 -- (-551.091) (-553.741) (-551.090) [-555.787] * [-551.493] (-556.493) (-551.938) (-550.636) -- 0:00:58
64000 -- [-549.989] (-554.179) (-551.087) (-552.752) * (-551.440) (-550.815) (-553.666) [-550.720] -- 0:00:58
64500 -- (-551.133) [-553.002] (-551.432) (-552.379) * (-552.449) (-558.175) (-552.746) [-552.201] -- 0:00:58
65000 -- [-549.472] (-553.188) (-552.583) (-551.767) * (-553.545) [-558.293] (-552.279) (-552.440) -- 0:00:57
Average standard deviation of split frequencies: 0.031986
65500 -- (-552.542) [-552.081] (-550.620) (-552.540) * (-556.063) (-554.939) [-550.673] (-551.967) -- 0:00:57
66000 -- [-555.133] (-552.612) (-550.759) (-553.154) * (-553.758) (-550.389) (-554.538) [-552.406] -- 0:00:56
66500 -- (-553.546) (-550.738) (-550.080) [-551.048] * (-550.148) (-553.158) (-551.853) [-551.013] -- 0:00:56
67000 -- (-550.280) [-550.723] (-552.291) (-553.271) * (-550.154) (-552.251) (-550.848) [-550.711] -- 0:00:55
67500 -- [-549.744] (-552.100) (-554.807) (-550.644) * [-551.592] (-552.310) (-552.030) (-551.479) -- 0:00:55
68000 -- [-550.043] (-551.668) (-549.785) (-550.065) * (-553.852) (-555.182) [-550.908] (-550.055) -- 0:00:54
68500 -- [-551.514] (-552.447) (-549.779) (-550.015) * (-553.376) (-552.448) (-550.563) [-551.080] -- 0:00:54
69000 -- (-556.394) (-550.839) [-550.766] (-550.099) * (-555.667) (-551.682) [-549.557] (-551.673) -- 0:00:53
69500 -- (-552.120) (-551.470) (-550.441) [-551.386] * [-550.809] (-553.323) (-550.068) (-552.371) -- 0:01:06
70000 -- [-551.379] (-551.011) (-549.647) (-551.610) * (-551.959) [-551.853] (-552.736) (-555.350) -- 0:01:06
Average standard deviation of split frequencies: 0.025470
70500 -- [-549.258] (-553.468) (-552.783) (-549.991) * (-550.879) (-550.979) (-551.547) [-553.717] -- 0:01:05
71000 -- [-549.254] (-549.683) (-551.082) (-550.464) * [-550.672] (-552.322) (-553.571) (-550.540) -- 0:01:05
71500 -- (-549.758) [-550.523] (-551.110) (-550.701) * (-550.768) (-550.383) (-555.790) [-550.086] -- 0:01:04
72000 -- (-549.836) [-550.004] (-550.828) (-552.673) * (-550.981) [-550.464] (-554.087) (-553.392) -- 0:01:04
72500 -- (-552.043) (-549.331) [-549.790] (-555.808) * [-549.182] (-551.305) (-551.835) (-553.168) -- 0:01:03
73000 -- (-553.397) (-551.792) (-549.771) [-551.943] * (-549.971) (-549.987) [-551.159] (-551.604) -- 0:01:03
73500 -- (-551.762) (-552.009) (-551.890) [-551.186] * [-551.509] (-551.991) (-552.039) (-550.780) -- 0:01:03
74000 -- [-553.537] (-552.467) (-557.143) (-552.811) * [-553.342] (-550.111) (-550.572) (-549.468) -- 0:01:02
74500 -- (-554.363) (-553.700) [-550.977] (-550.730) * [-554.125] (-552.285) (-552.755) (-550.030) -- 0:01:02
75000 -- (-553.998) (-550.478) [-551.243] (-550.443) * (-552.681) [-550.516] (-551.624) (-550.715) -- 0:01:01
Average standard deviation of split frequencies: 0.028355
75500 -- [-552.257] (-549.755) (-551.854) (-550.541) * (-557.330) (-552.257) (-552.288) [-550.660] -- 0:01:01
76000 -- (-550.547) [-550.948] (-555.126) (-549.251) * (-559.226) (-550.433) (-549.781) [-553.524] -- 0:01:00
76500 -- (-550.930) [-552.843] (-552.228) (-551.316) * (-558.110) (-550.072) (-553.502) [-552.477] -- 0:01:00
77000 -- [-551.463] (-550.227) (-549.857) (-552.627) * (-556.596) [-551.129] (-554.278) (-552.168) -- 0:00:59
77500 -- (-549.234) (-549.829) [-550.771] (-551.739) * (-556.724) [-551.219] (-554.096) (-555.064) -- 0:00:59
78000 -- [-551.806] (-553.868) (-552.085) (-552.145) * (-554.601) [-551.390] (-554.315) (-553.994) -- 0:00:59
78500 -- [-550.251] (-551.942) (-556.106) (-551.521) * (-554.187) (-550.248) (-553.080) [-551.457] -- 0:00:58
79000 -- (-551.155) (-551.382) (-552.828) [-552.774] * (-549.957) (-551.012) [-553.934] (-552.411) -- 0:00:58
79500 -- (-554.551) (-550.183) (-553.690) [-550.833] * [-550.030] (-551.413) (-555.922) (-550.394) -- 0:00:57
80000 -- (-551.156) (-549.553) [-551.799] (-552.306) * (-551.134) (-550.711) (-551.962) [-549.666] -- 0:00:57
Average standard deviation of split frequencies: 0.028604
80500 -- (-550.853) (-551.185) [-552.158] (-550.818) * (-550.160) (-551.500) [-550.620] (-551.053) -- 0:00:57
81000 -- (-551.032) (-551.312) [-550.777] (-552.979) * (-553.143) (-552.436) (-550.937) [-550.671] -- 0:00:56
81500 -- (-550.823) [-550.809] (-553.861) (-557.235) * (-554.423) (-551.269) [-553.061] (-551.052) -- 0:00:56
82000 -- (-550.033) [-551.045] (-553.073) (-550.105) * (-552.495) (-550.115) [-555.157] (-550.151) -- 0:00:55
82500 -- [-549.809] (-550.411) (-550.528) (-550.517) * (-550.344) (-550.053) (-554.965) [-551.885] -- 0:00:55
83000 -- [-551.015] (-555.983) (-550.650) (-550.826) * (-550.500) (-550.501) (-553.511) [-551.554] -- 0:00:55
83500 -- [-549.793] (-553.303) (-550.693) (-550.545) * [-550.542] (-552.990) (-552.765) (-551.000) -- 0:00:54
84000 -- (-549.736) (-550.435) (-549.631) [-552.663] * (-551.141) [-549.903] (-554.359) (-550.943) -- 0:00:54
84500 -- (-551.646) [-549.432] (-552.332) (-553.669) * [-552.422] (-550.022) (-553.972) (-551.281) -- 0:00:54
85000 -- [-554.680] (-550.909) (-550.297) (-554.306) * (-554.661) (-552.040) (-557.422) [-552.654] -- 0:00:53
Average standard deviation of split frequencies: 0.026885
85500 -- (-551.942) [-549.920] (-549.898) (-553.270) * (-554.333) (-552.456) [-553.406] (-553.557) -- 0:00:53
86000 -- (-551.601) [-554.419] (-549.748) (-550.982) * (-556.934) (-551.581) (-551.674) [-550.267] -- 0:01:03
86500 -- (-553.367) (-550.544) (-549.605) [-550.930] * [-552.520] (-550.687) (-555.877) (-551.510) -- 0:01:03
87000 -- (-551.175) [-553.036] (-549.513) (-550.700) * (-550.587) (-553.336) (-550.938) [-550.899] -- 0:01:02
87500 -- (-552.903) [-553.842] (-549.932) (-551.117) * [-549.389] (-552.735) (-550.534) (-557.500) -- 0:01:02
88000 -- (-549.488) [-551.061] (-552.843) (-551.137) * (-551.488) (-550.082) (-555.896) [-550.462] -- 0:01:02
88500 -- (-551.681) (-550.830) (-550.267) [-550.989] * (-552.218) [-551.685] (-553.716) (-552.553) -- 0:01:01
89000 -- (-550.507) (-550.680) [-550.928] (-554.795) * (-550.477) [-549.757] (-554.335) (-552.179) -- 0:01:01
89500 -- (-551.086) (-552.289) [-553.782] (-550.230) * (-549.948) (-551.639) (-557.315) [-550.061] -- 0:01:01
90000 -- (-550.121) (-552.597) [-553.549] (-551.476) * (-549.991) (-553.771) [-552.560] (-550.769) -- 0:01:00
Average standard deviation of split frequencies: 0.031196
90500 -- (-553.478) (-550.311) (-552.595) [-550.335] * (-549.618) (-554.752) [-549.670] (-552.253) -- 0:01:00
91000 -- (-552.467) (-551.135) [-556.588] (-549.699) * (-552.198) [-553.426] (-552.199) (-553.735) -- 0:00:59
91500 -- (-553.461) (-550.805) [-552.807] (-552.970) * [-553.054] (-555.720) (-551.500) (-551.040) -- 0:00:59
92000 -- (-553.732) [-552.129] (-551.593) (-552.662) * (-551.293) (-550.442) (-550.116) [-551.047] -- 0:00:59
92500 -- (-549.723) (-553.371) (-552.739) [-552.379] * (-549.844) [-551.127] (-552.859) (-553.965) -- 0:00:58
93000 -- (-550.239) (-552.977) [-554.902] (-551.052) * (-550.966) (-552.727) [-554.584] (-555.357) -- 0:00:58
93500 -- (-549.433) [-553.366] (-554.695) (-551.164) * [-550.214] (-551.727) (-550.500) (-555.006) -- 0:00:58
94000 -- (-550.727) (-551.920) (-556.055) [-549.577] * (-549.572) (-552.613) [-550.696] (-551.342) -- 0:00:57
94500 -- [-549.903] (-553.200) (-555.362) (-550.424) * [-552.928] (-549.734) (-550.913) (-550.921) -- 0:00:57
95000 -- (-551.832) [-552.667] (-554.429) (-552.328) * (-551.368) [-550.406] (-555.091) (-550.980) -- 0:00:57
Average standard deviation of split frequencies: 0.028294
95500 -- (-551.274) [-549.579] (-549.491) (-550.762) * [-549.988] (-549.973) (-551.495) (-558.500) -- 0:00:56
96000 -- (-550.975) (-554.671) (-550.988) [-550.942] * (-552.706) (-550.872) [-551.894] (-553.502) -- 0:00:56
96500 -- (-551.345) [-551.323] (-553.460) (-550.858) * [-555.009] (-553.026) (-551.786) (-550.516) -- 0:00:56
97000 -- (-549.625) (-553.492) [-549.440] (-551.865) * (-549.628) [-551.759] (-549.927) (-550.881) -- 0:00:55
97500 -- (-549.864) [-554.716] (-555.588) (-553.366) * (-549.652) (-552.907) [-554.649] (-551.555) -- 0:00:55
98000 -- [-550.463] (-552.801) (-552.005) (-555.652) * [-551.369] (-553.396) (-553.553) (-550.503) -- 0:00:55
98500 -- [-551.409] (-553.678) (-553.291) (-549.186) * [-552.665] (-551.447) (-552.683) (-552.287) -- 0:00:54
99000 -- [-550.028] (-549.890) (-552.625) (-549.648) * (-550.864) (-552.199) [-551.154] (-551.129) -- 0:00:54
99500 -- (-549.551) [-552.531] (-550.994) (-554.082) * (-553.588) (-556.203) [-553.297] (-552.570) -- 0:00:54
100000 -- (-554.546) [-550.773] (-549.418) (-552.448) * (-552.118) (-553.690) (-549.521) [-553.397] -- 0:00:54
Average standard deviation of split frequencies: 0.028975
100500 -- (-550.402) (-549.931) (-551.538) [-550.119] * (-553.286) [-557.126] (-551.843) (-550.730) -- 0:00:53
101000 -- (-549.449) (-563.244) [-549.742] (-549.756) * (-553.531) (-551.005) [-551.055] (-550.744) -- 0:00:53
101500 -- (-549.684) [-554.797] (-552.432) (-552.862) * (-549.462) [-552.897] (-551.511) (-550.609) -- 0:00:53
102000 -- [-550.050] (-553.013) (-551.222) (-554.121) * (-551.026) [-551.536] (-550.458) (-556.216) -- 0:00:52
102500 -- (-551.010) (-554.574) (-552.160) [-557.178] * (-552.807) (-551.178) [-553.402] (-554.523) -- 0:00:52
103000 -- (-554.399) (-553.350) [-553.495] (-554.454) * [-553.297] (-557.372) (-549.423) (-550.891) -- 0:01:00
103500 -- (-551.395) [-553.130] (-549.860) (-554.337) * [-551.406] (-551.490) (-555.051) (-551.501) -- 0:01:00
104000 -- [-549.615] (-554.152) (-550.654) (-552.940) * (-553.617) [-552.851] (-556.652) (-552.660) -- 0:01:00
104500 -- (-549.937) [-549.979] (-558.688) (-551.910) * (-552.081) (-550.459) (-551.133) [-555.107] -- 0:00:59
105000 -- [-552.841] (-555.795) (-551.642) (-551.626) * (-550.506) [-557.458] (-553.211) (-556.765) -- 0:00:59
Average standard deviation of split frequencies: 0.024067
105500 -- (-553.011) (-552.261) [-551.199] (-550.203) * (-551.844) (-551.667) (-549.849) [-551.942] -- 0:00:59
106000 -- (-551.434) [-550.128] (-549.532) (-550.541) * (-550.528) [-549.746] (-550.295) (-552.331) -- 0:00:59
106500 -- (-555.009) [-549.625] (-552.588) (-551.048) * [-550.079] (-554.279) (-554.863) (-551.900) -- 0:00:58
107000 -- [-551.479] (-551.756) (-554.473) (-550.109) * (-549.927) [-553.757] (-553.120) (-553.693) -- 0:00:58
107500 -- [-551.837] (-552.295) (-550.729) (-550.764) * [-551.793] (-554.215) (-553.159) (-554.675) -- 0:00:58
108000 -- (-553.805) (-550.269) (-549.808) [-552.340] * (-553.400) (-550.566) [-552.724] (-552.026) -- 0:00:57
108500 -- [-549.991] (-552.074) (-553.379) (-550.951) * (-550.891) [-553.874] (-552.791) (-551.612) -- 0:00:57
109000 -- (-553.025) (-549.799) [-550.987] (-553.041) * (-551.649) [-552.776] (-555.136) (-550.527) -- 0:00:57
109500 -- (-553.663) (-552.712) (-553.376) [-551.405] * (-552.926) [-550.555] (-550.645) (-553.149) -- 0:00:56
110000 -- (-553.221) (-550.720) (-553.661) [-555.353] * (-555.701) [-549.866] (-549.811) (-553.658) -- 0:00:56
Average standard deviation of split frequencies: 0.021298
110500 -- (-552.120) (-551.141) (-553.186) [-552.384] * (-551.743) [-549.168] (-556.983) (-550.073) -- 0:00:56
111000 -- (-549.922) [-554.485] (-551.388) (-554.409) * [-550.090] (-555.036) (-551.941) (-551.317) -- 0:00:56
111500 -- (-551.800) (-550.521) [-552.186] (-551.107) * (-552.611) (-554.698) (-550.963) [-549.882] -- 0:00:55
112000 -- (-554.229) (-556.157) (-551.539) [-555.359] * (-553.410) [-553.287] (-551.044) (-550.081) -- 0:00:55
112500 -- [-551.194] (-552.447) (-556.353) (-551.098) * (-555.991) (-550.534) (-553.670) [-552.252] -- 0:00:55
113000 -- [-552.119] (-553.129) (-550.264) (-551.244) * (-550.697) (-549.674) (-554.149) [-549.871] -- 0:00:54
113500 -- (-551.895) [-550.628] (-553.305) (-551.720) * (-551.748) (-550.170) [-549.927] (-551.145) -- 0:00:54
114000 -- [-550.229] (-552.950) (-553.996) (-550.772) * (-554.965) (-554.768) [-549.435] (-554.415) -- 0:00:54
114500 -- [-551.420] (-553.524) (-550.499) (-556.502) * [-550.768] (-551.089) (-550.821) (-552.596) -- 0:00:54
115000 -- [-550.792] (-552.494) (-556.660) (-549.952) * (-550.233) [-553.500] (-552.528) (-551.594) -- 0:00:53
Average standard deviation of split frequencies: 0.020996
115500 -- (-554.444) (-555.132) (-557.986) [-550.153] * (-551.625) (-550.390) [-553.344] (-553.747) -- 0:00:53
116000 -- (-551.134) (-553.554) (-552.601) [-549.826] * (-552.866) (-552.302) [-551.035] (-552.817) -- 0:00:53
116500 -- (-553.658) [-554.030] (-553.080) (-549.290) * [-553.956] (-550.601) (-551.068) (-549.382) -- 0:00:53
117000 -- (-552.765) (-552.017) (-551.659) [-549.884] * (-551.508) (-550.075) [-551.098] (-553.714) -- 0:00:52
117500 -- [-551.336] (-551.122) (-550.384) (-549.738) * [-551.454] (-550.471) (-550.902) (-551.452) -- 0:00:52
118000 -- (-551.462) (-550.959) [-550.785] (-550.901) * (-555.941) [-551.156] (-550.756) (-550.210) -- 0:00:52
118500 -- [-549.635] (-551.865) (-550.104) (-552.440) * (-555.708) (-553.382) [-549.483] (-551.055) -- 0:00:52
119000 -- (-549.474) (-552.833) [-554.735] (-553.104) * (-554.533) [-552.313] (-551.726) (-551.097) -- 0:00:51
119500 -- [-552.547] (-551.155) (-552.590) (-549.921) * [-550.026] (-553.194) (-550.829) (-552.517) -- 0:00:51
120000 -- (-549.868) [-550.689] (-549.570) (-551.731) * (-549.676) [-549.772] (-551.983) (-553.173) -- 0:00:58
Average standard deviation of split frequencies: 0.021487
120500 -- (-549.500) (-550.364) [-550.046] (-551.730) * (-550.281) [-550.347] (-552.890) (-552.038) -- 0:00:58
121000 -- (-553.638) [-550.017] (-552.401) (-556.057) * (-551.073) [-553.097] (-556.089) (-552.048) -- 0:00:58
121500 -- (-551.821) [-551.784] (-549.402) (-549.665) * (-550.353) [-553.842] (-552.774) (-551.859) -- 0:00:57
122000 -- (-551.552) (-553.272) (-552.414) [-549.550] * (-553.231) [-555.607] (-554.241) (-553.785) -- 0:00:57
122500 -- [-551.920] (-551.558) (-551.565) (-549.902) * (-550.846) (-551.811) [-549.717] (-549.618) -- 0:00:57
123000 -- [-553.590] (-550.013) (-550.059) (-553.547) * (-551.639) [-555.064] (-551.998) (-550.870) -- 0:00:57
123500 -- (-550.039) (-550.868) (-550.176) [-551.008] * (-550.796) (-550.488) [-550.139] (-552.302) -- 0:00:56
124000 -- [-549.693] (-549.180) (-550.469) (-554.276) * (-552.012) (-550.552) (-550.458) [-555.538] -- 0:00:56
124500 -- (-549.901) [-550.615] (-550.727) (-554.323) * (-553.734) (-551.163) (-550.101) [-552.881] -- 0:00:56
125000 -- (-550.255) (-554.159) [-552.166] (-551.083) * (-552.049) (-551.353) [-551.669] (-550.617) -- 0:00:56
Average standard deviation of split frequencies: 0.020873
125500 -- (-549.714) (-549.740) [-550.131] (-552.075) * (-553.401) (-550.316) (-551.444) [-549.535] -- 0:00:55
126000 -- (-551.673) (-550.838) [-551.601] (-553.228) * (-555.203) (-551.774) [-553.781] (-551.539) -- 0:00:55
126500 -- (-550.519) (-550.417) [-549.788] (-552.977) * (-552.431) [-554.688] (-556.567) (-552.171) -- 0:00:55
127000 -- [-550.673] (-551.114) (-551.344) (-551.863) * [-550.692] (-550.234) (-553.236) (-552.514) -- 0:00:54
127500 -- (-549.997) (-549.239) [-552.752] (-552.239) * (-550.766) (-549.428) (-551.585) [-556.128] -- 0:00:54
128000 -- (-553.793) (-552.389) [-550.276] (-551.620) * (-550.546) [-550.925] (-551.698) (-553.584) -- 0:00:54
128500 -- (-552.757) (-553.488) [-552.468] (-555.196) * (-549.320) [-550.822] (-550.612) (-556.362) -- 0:00:54
129000 -- [-551.844] (-552.040) (-553.294) (-550.544) * (-551.323) (-551.188) (-550.390) [-551.693] -- 0:00:54
129500 -- (-550.772) (-552.392) [-552.522] (-550.993) * (-549.569) [-553.982] (-551.522) (-555.232) -- 0:00:53
130000 -- (-556.396) (-552.859) (-549.929) [-549.455] * (-550.711) (-552.924) (-553.333) [-551.776] -- 0:00:53
Average standard deviation of split frequencies: 0.023132
130500 -- (-556.270) [-551.996] (-550.085) (-550.750) * [-550.554] (-552.406) (-550.270) (-550.087) -- 0:00:53
131000 -- (-558.333) (-550.850) [-549.802] (-551.853) * (-551.955) (-552.819) [-550.538] (-552.416) -- 0:00:53
131500 -- (-553.982) (-551.137) [-551.159] (-556.515) * (-550.284) (-551.407) [-550.384] (-550.702) -- 0:00:52
132000 -- (-549.825) [-550.758] (-549.526) (-555.410) * (-551.438) [-550.586] (-549.824) (-551.294) -- 0:00:52
132500 -- (-550.340) (-555.106) (-550.142) [-551.931] * (-552.721) (-550.156) [-551.645] (-562.856) -- 0:00:52
133000 -- (-550.120) [-549.935] (-552.045) (-549.701) * (-552.355) (-550.179) [-550.383] (-558.453) -- 0:00:52
133500 -- [-552.686] (-555.191) (-553.168) (-550.050) * (-549.910) (-552.002) (-550.311) [-552.095] -- 0:00:51
134000 -- (-550.523) (-551.402) (-552.890) [-549.250] * (-549.502) [-554.808] (-549.487) (-550.485) -- 0:00:51
134500 -- (-552.159) (-550.409) (-550.616) [-551.200] * (-549.705) [-552.467] (-549.173) (-552.966) -- 0:00:51
135000 -- (-553.295) [-550.079] (-550.448) (-550.167) * (-551.536) [-551.121] (-554.379) (-554.785) -- 0:00:51
Average standard deviation of split frequencies: 0.022338
135500 -- (-550.149) [-550.473] (-549.984) (-550.843) * [-550.515] (-555.902) (-550.568) (-552.232) -- 0:00:51
136000 -- (-555.309) [-549.316] (-549.263) (-554.893) * [-555.132] (-557.318) (-552.300) (-552.063) -- 0:00:50
136500 -- (-552.834) (-550.702) [-551.035] (-552.556) * (-551.675) (-552.214) [-554.453] (-552.124) -- 0:00:56
137000 -- (-550.050) (-552.706) [-553.271] (-551.173) * [-551.906] (-553.842) (-551.939) (-551.076) -- 0:00:56
137500 -- [-550.859] (-554.758) (-554.483) (-552.314) * (-550.193) (-553.032) (-559.622) [-550.681] -- 0:00:56
138000 -- (-550.393) (-551.194) (-553.792) [-551.430] * (-549.813) (-549.847) (-550.979) [-554.396] -- 0:00:56
138500 -- (-553.909) [-550.291] (-549.581) (-553.798) * (-551.900) (-552.311) [-551.589] (-551.658) -- 0:00:55
139000 -- (-552.630) [-550.385] (-552.354) (-554.312) * [-552.318] (-551.875) (-553.991) (-551.566) -- 0:00:55
139500 -- (-554.166) (-550.484) [-552.062] (-552.117) * (-552.530) [-553.458] (-549.764) (-554.535) -- 0:00:55
140000 -- [-551.993] (-555.955) (-555.460) (-550.923) * (-553.004) [-549.877] (-556.736) (-555.347) -- 0:00:55
Average standard deviation of split frequencies: 0.019122
140500 -- (-551.817) (-552.871) (-551.405) [-550.296] * (-550.201) (-551.323) [-550.878] (-550.128) -- 0:00:55
141000 -- (-550.510) [-552.801] (-551.206) (-552.493) * (-551.448) (-553.554) [-556.138] (-553.572) -- 0:00:54
141500 -- (-550.406) [-552.456] (-550.830) (-553.201) * (-553.556) (-549.847) [-549.866] (-551.541) -- 0:00:54
142000 -- (-549.595) (-553.529) [-550.949] (-554.017) * (-554.039) (-552.012) (-554.181) [-549.599] -- 0:00:54
142500 -- (-556.091) (-551.657) [-553.142] (-552.539) * (-552.766) [-553.090] (-550.543) (-549.751) -- 0:00:54
143000 -- [-555.397] (-551.820) (-550.916) (-551.465) * (-550.788) (-552.417) [-550.262] (-552.055) -- 0:00:53
143500 -- [-550.449] (-552.785) (-551.823) (-551.432) * (-550.287) (-549.997) (-551.040) [-550.214] -- 0:00:53
144000 -- (-551.442) [-551.732] (-550.742) (-553.919) * (-550.032) [-551.723] (-550.027) (-550.263) -- 0:00:53
144500 -- [-551.590] (-552.698) (-554.242) (-553.978) * (-558.415) (-552.536) (-552.808) [-549.901] -- 0:00:53
145000 -- (-551.111) (-551.778) [-549.524] (-550.676) * (-556.157) [-552.177] (-552.409) (-553.105) -- 0:00:53
Average standard deviation of split frequencies: 0.018404
145500 -- (-551.138) [-549.477] (-550.867) (-550.540) * [-558.338] (-551.851) (-553.956) (-551.528) -- 0:00:52
146000 -- (-552.738) (-551.608) (-552.503) [-552.269] * (-561.365) [-550.672] (-551.127) (-549.840) -- 0:00:52
146500 -- [-553.703] (-550.557) (-550.160) (-550.391) * (-555.183) (-551.678) (-549.673) [-549.582] -- 0:00:52
147000 -- (-551.816) [-549.363] (-553.319) (-549.621) * (-553.087) (-553.036) (-550.898) [-550.884] -- 0:00:52
147500 -- [-551.693] (-549.878) (-554.108) (-549.628) * (-549.774) [-549.541] (-554.495) (-551.706) -- 0:00:52
148000 -- (-551.184) (-552.269) (-552.923) [-553.371] * (-553.777) (-552.554) (-553.951) [-552.906] -- 0:00:51
148500 -- (-551.385) [-552.054] (-551.562) (-551.909) * (-553.251) (-554.614) (-551.311) [-552.103] -- 0:00:51
149000 -- (-550.861) [-552.748] (-551.052) (-557.233) * (-550.059) (-550.750) [-550.549] (-554.648) -- 0:00:51
149500 -- [-549.770] (-552.478) (-555.387) (-553.660) * [-553.162] (-550.125) (-551.626) (-552.523) -- 0:00:51
150000 -- (-549.516) (-556.482) (-553.926) [-550.689] * (-550.057) (-550.159) [-551.387] (-551.944) -- 0:00:51
Average standard deviation of split frequencies: 0.017556
150500 -- (-551.435) (-553.714) [-552.012] (-551.771) * (-551.804) [-550.793] (-549.968) (-553.898) -- 0:00:50
151000 -- [-551.243] (-553.879) (-551.716) (-552.520) * (-552.328) (-551.169) (-550.305) [-554.049] -- 0:00:50
151500 -- (-553.998) [-550.790] (-550.124) (-549.835) * (-553.052) (-552.091) (-551.255) [-553.828] -- 0:00:50
152000 -- [-550.984] (-550.069) (-550.361) (-551.925) * (-549.627) (-553.598) (-551.461) [-551.984] -- 0:00:50
152500 -- (-554.361) (-551.418) (-553.865) [-549.559] * (-550.512) (-551.820) (-552.819) [-550.226] -- 0:00:50
153000 -- [-549.197] (-549.620) (-551.655) (-551.460) * (-550.312) (-553.914) (-557.234) [-552.580] -- 0:00:49
153500 -- (-551.174) (-549.098) [-550.963] (-550.006) * (-550.114) (-551.311) [-552.225] (-554.134) -- 0:00:55
154000 -- (-552.471) (-550.827) [-553.278] (-554.282) * (-556.515) [-550.413] (-552.245) (-553.297) -- 0:00:54
154500 -- (-551.440) (-551.804) (-552.806) [-553.539] * (-556.363) (-551.078) [-550.415] (-550.842) -- 0:00:54
155000 -- (-552.497) (-550.106) [-551.481] (-552.054) * [-550.971] (-550.051) (-552.195) (-551.724) -- 0:00:54
Average standard deviation of split frequencies: 0.017598
155500 -- [-551.698] (-551.180) (-552.037) (-557.162) * (-554.121) (-550.684) (-550.884) [-551.303] -- 0:00:54
156000 -- (-550.481) (-555.337) [-551.134] (-553.096) * [-551.581] (-550.773) (-557.446) (-550.076) -- 0:00:54
156500 -- [-549.620] (-551.516) (-549.694) (-549.634) * (-550.896) (-551.630) [-555.048] (-553.495) -- 0:00:53
157000 -- (-550.169) (-550.496) (-550.590) [-549.754] * (-555.061) (-550.739) (-553.108) [-551.696] -- 0:00:53
157500 -- (-549.622) (-550.319) [-550.141] (-553.380) * [-551.350] (-552.592) (-552.243) (-551.151) -- 0:00:53
158000 -- (-550.700) (-553.975) (-550.109) [-551.092] * [-554.094] (-550.403) (-551.826) (-551.343) -- 0:00:53
158500 -- [-554.684] (-552.824) (-555.738) (-551.023) * (-550.343) (-551.795) (-553.831) [-550.264] -- 0:00:53
159000 -- [-555.354] (-556.477) (-553.227) (-550.910) * (-552.251) (-554.545) (-550.958) [-551.453] -- 0:00:52
159500 -- [-550.869] (-561.847) (-550.220) (-551.700) * (-551.299) (-555.440) (-550.187) [-551.698] -- 0:00:52
160000 -- (-555.105) (-553.075) (-554.291) [-550.398] * (-551.133) [-550.433] (-553.402) (-549.901) -- 0:00:52
Average standard deviation of split frequencies: 0.018154
160500 -- [-553.812] (-550.547) (-551.688) (-550.949) * [-554.215] (-552.624) (-552.665) (-552.082) -- 0:00:52
161000 -- (-552.742) [-552.450] (-550.702) (-551.845) * (-551.124) [-550.388] (-552.707) (-553.229) -- 0:00:52
161500 -- (-550.386) (-551.622) (-551.187) [-549.694] * (-552.512) [-549.653] (-554.062) (-551.540) -- 0:00:51
162000 -- (-550.897) (-554.780) (-551.272) [-551.800] * (-550.947) (-549.250) [-554.496] (-554.029) -- 0:00:51
162500 -- [-553.388] (-553.109) (-550.347) (-550.224) * (-553.250) (-550.245) [-551.034] (-551.825) -- 0:00:51
163000 -- (-551.102) (-552.383) [-550.177] (-549.146) * (-552.451) (-549.902) [-549.934] (-552.235) -- 0:00:51
163500 -- (-554.510) (-550.517) [-551.553] (-555.430) * [-553.843] (-549.679) (-549.539) (-550.406) -- 0:00:51
164000 -- (-557.841) (-551.340) (-552.282) [-549.570] * (-551.102) [-549.966] (-551.391) (-554.043) -- 0:00:50
164500 -- (-552.888) (-550.461) (-554.628) [-551.406] * (-551.769) (-551.818) [-550.918] (-550.462) -- 0:00:50
165000 -- (-549.730) [-550.418] (-555.480) (-550.874) * (-551.443) [-553.477] (-553.473) (-551.159) -- 0:00:50
Average standard deviation of split frequencies: 0.015395
165500 -- [-553.321] (-555.565) (-550.878) (-551.028) * [-550.118] (-553.723) (-551.456) (-550.004) -- 0:00:50
166000 -- (-553.003) (-551.154) (-550.434) [-552.353] * (-552.188) (-551.442) (-552.750) [-550.056] -- 0:00:50
166500 -- (-551.528) [-550.477] (-550.988) (-552.886) * (-550.589) (-552.321) [-552.286] (-550.251) -- 0:00:50
167000 -- (-551.187) (-550.749) (-550.800) [-550.863] * (-550.924) [-551.571] (-551.305) (-550.810) -- 0:00:49
167500 -- (-551.889) (-549.989) [-555.592] (-552.170) * (-551.693) (-549.976) [-549.618] (-550.953) -- 0:00:49
168000 -- (-550.787) (-550.722) [-551.194] (-552.478) * (-552.474) [-552.349] (-552.129) (-550.315) -- 0:00:49
168500 -- [-549.327] (-549.935) (-550.107) (-551.567) * (-553.042) [-550.548] (-550.023) (-550.761) -- 0:00:49
169000 -- (-550.468) [-552.241] (-549.780) (-552.073) * (-552.461) (-552.444) [-551.735] (-551.662) -- 0:00:49
169500 -- (-550.027) (-551.749) [-549.845] (-550.100) * [-552.586] (-551.184) (-551.010) (-551.671) -- 0:00:48
170000 -- (-553.027) (-553.053) (-551.916) [-551.326] * [-550.834] (-555.047) (-550.895) (-553.492) -- 0:00:53
Average standard deviation of split frequencies: 0.018317
170500 -- [-554.728] (-552.496) (-552.213) (-551.220) * [-551.852] (-552.810) (-550.690) (-549.651) -- 0:00:53
171000 -- (-552.822) (-555.072) (-551.659) [-554.791] * (-552.040) (-553.758) (-549.651) [-551.986] -- 0:00:53
171500 -- (-553.983) (-555.102) (-550.193) [-551.450] * [-550.790] (-554.829) (-551.208) (-550.816) -- 0:00:53
172000 -- (-553.127) (-551.368) [-553.980] (-550.492) * (-550.300) (-552.225) [-550.132] (-554.518) -- 0:00:52
172500 -- (-552.045) (-552.787) (-553.908) [-554.156] * (-554.039) (-556.934) [-552.502] (-552.677) -- 0:00:52
173000 -- (-549.668) [-554.449] (-551.360) (-553.896) * (-551.722) [-554.124] (-549.973) (-551.806) -- 0:00:52
173500 -- (-549.830) (-553.487) [-549.551] (-550.064) * (-549.153) [-553.413] (-552.501) (-549.792) -- 0:00:52
174000 -- (-553.512) (-552.031) (-551.704) [-550.366] * (-550.335) (-552.059) [-550.392] (-551.479) -- 0:00:52
174500 -- (-551.461) (-555.923) (-550.592) [-550.202] * [-552.032] (-551.734) (-551.581) (-550.922) -- 0:00:52
175000 -- (-550.215) [-550.935] (-552.214) (-551.673) * (-550.997) (-552.172) [-559.103] (-551.783) -- 0:00:51
Average standard deviation of split frequencies: 0.019694
175500 -- [-550.815] (-550.304) (-551.216) (-550.939) * (-553.639) (-552.222) (-551.776) [-552.980] -- 0:00:51
176000 -- (-551.459) (-555.577) [-550.649] (-551.984) * (-551.712) (-550.339) [-550.238] (-550.875) -- 0:00:51
176500 -- (-550.254) (-554.076) (-552.037) [-553.322] * (-552.284) [-549.574] (-552.636) (-554.801) -- 0:00:51
177000 -- (-551.202) [-550.901] (-550.444) (-554.389) * (-554.538) (-549.328) [-550.409] (-552.749) -- 0:00:51
177500 -- (-551.528) (-553.379) [-549.913] (-550.628) * [-551.762] (-549.511) (-551.340) (-552.568) -- 0:00:50
178000 -- (-555.075) [-552.028] (-552.955) (-553.347) * (-552.632) (-551.323) (-550.928) [-552.701] -- 0:00:50
178500 -- (-553.810) (-551.109) [-554.324] (-554.266) * (-550.886) (-551.575) [-552.672] (-552.452) -- 0:00:50
179000 -- (-552.149) (-552.626) [-549.551] (-550.837) * (-551.812) (-554.810) (-550.753) [-551.384] -- 0:00:50
179500 -- (-550.150) (-550.475) [-551.046] (-551.497) * (-550.447) (-553.359) (-550.211) [-551.329] -- 0:00:50
180000 -- (-550.732) (-551.433) (-549.655) [-555.582] * [-550.727] (-553.909) (-550.652) (-551.948) -- 0:00:50
Average standard deviation of split frequencies: 0.019135
180500 -- (-551.346) (-556.932) [-556.540] (-552.222) * (-550.710) (-553.743) [-552.494] (-552.027) -- 0:00:49
181000 -- (-552.995) (-552.364) (-553.794) [-552.164] * (-550.708) (-553.333) (-554.144) [-554.134] -- 0:00:49
181500 -- [-552.143] (-551.776) (-561.406) (-552.463) * (-553.572) [-550.894] (-553.744) (-550.910) -- 0:00:49
182000 -- (-554.211) [-551.282] (-552.200) (-551.940) * (-553.681) (-551.427) [-553.079] (-551.317) -- 0:00:49
182500 -- (-550.161) (-551.614) [-553.332] (-550.398) * (-551.399) (-550.976) [-550.985] (-551.305) -- 0:00:49
183000 -- (-550.679) (-551.473) [-553.251] (-552.127) * (-550.721) (-551.784) (-550.258) [-550.042] -- 0:00:49
183500 -- (-552.654) (-550.621) (-557.967) [-554.633] * (-549.211) (-552.056) [-553.949] (-552.348) -- 0:00:48
184000 -- (-552.571) [-550.365] (-554.691) (-560.710) * [-551.376] (-550.598) (-552.303) (-555.203) -- 0:00:48
184500 -- [-550.776] (-551.041) (-550.572) (-552.000) * (-552.898) (-550.743) [-553.548] (-550.533) -- 0:00:48
185000 -- (-550.927) (-552.776) (-553.765) [-549.982] * (-550.777) [-551.759] (-555.126) (-551.923) -- 0:00:48
Average standard deviation of split frequencies: 0.017868
185500 -- (-550.374) (-556.146) [-552.614] (-553.014) * (-556.189) (-551.382) (-549.898) [-550.185] -- 0:00:48
186000 -- [-550.933] (-554.483) (-551.722) (-552.813) * (-555.282) (-554.908) [-549.932] (-551.030) -- 0:00:48
186500 -- (-551.116) (-552.368) [-550.500] (-553.514) * (-555.023) (-552.737) (-553.190) [-550.750] -- 0:00:47
187000 -- [-554.036] (-552.129) (-551.524) (-551.351) * (-553.271) (-550.440) [-550.898] (-550.224) -- 0:00:52
187500 -- (-553.946) (-550.519) [-553.598] (-551.082) * (-552.261) (-551.948) [-549.890] (-551.247) -- 0:00:52
188000 -- (-553.512) [-549.421] (-550.663) (-558.217) * (-551.196) (-550.897) (-549.304) [-549.846] -- 0:00:51
188500 -- [-552.077] (-549.610) (-554.235) (-550.659) * [-550.256] (-556.230) (-551.486) (-552.016) -- 0:00:51
189000 -- (-553.916) (-552.861) (-558.985) [-551.458] * [-550.383] (-550.549) (-554.212) (-550.833) -- 0:00:51
189500 -- (-551.714) [-553.581] (-553.064) (-552.044) * (-553.585) (-551.522) (-553.423) [-551.980] -- 0:00:51
190000 -- (-554.800) (-552.301) (-552.894) [-553.404] * (-557.371) [-549.263] (-552.285) (-551.645) -- 0:00:51
Average standard deviation of split frequencies: 0.019129
190500 -- [-552.599] (-558.674) (-554.150) (-551.696) * [-552.885] (-549.653) (-549.247) (-550.098) -- 0:00:50
191000 -- (-549.740) [-550.146] (-552.832) (-549.866) * (-551.520) (-549.626) [-549.737] (-554.615) -- 0:00:50
191500 -- (-553.295) (-553.167) [-554.724] (-550.604) * (-552.262) (-549.810) [-550.388] (-554.378) -- 0:00:50
192000 -- (-553.207) [-552.058] (-552.139) (-550.728) * (-552.199) [-550.602] (-552.101) (-557.382) -- 0:00:50
192500 -- (-553.140) (-555.602) (-553.805) [-551.395] * (-549.922) [-553.105] (-549.384) (-558.626) -- 0:00:50
193000 -- (-551.278) (-550.995) [-554.719] (-551.524) * (-552.392) (-551.034) [-550.809] (-552.353) -- 0:00:50
193500 -- (-552.510) [-550.329] (-550.983) (-552.965) * (-551.369) [-554.361] (-553.424) (-551.699) -- 0:00:50
194000 -- (-551.009) (-556.998) [-551.579] (-552.266) * (-556.698) (-556.033) (-549.958) [-549.525] -- 0:00:49
194500 -- (-549.520) [-551.853] (-553.630) (-552.041) * (-551.921) (-550.838) (-550.916) [-550.964] -- 0:00:49
195000 -- (-549.734) [-553.045] (-556.801) (-554.551) * (-550.474) (-555.215) [-549.594] (-551.409) -- 0:00:49
Average standard deviation of split frequencies: 0.020254
195500 -- (-553.459) (-551.385) (-554.027) [-555.012] * (-550.205) (-551.500) [-550.970] (-551.177) -- 0:00:49
196000 -- [-556.084] (-552.820) (-551.414) (-552.459) * (-550.269) [-550.499] (-552.812) (-549.850) -- 0:00:49
196500 -- (-551.558) (-549.278) [-552.274] (-550.136) * [-550.142] (-550.679) (-550.572) (-550.278) -- 0:00:49
197000 -- (-552.425) [-550.648] (-549.966) (-551.902) * [-550.727] (-550.866) (-549.729) (-549.959) -- 0:00:48
197500 -- (-551.125) (-550.858) [-551.041] (-551.299) * [-552.052] (-549.970) (-549.593) (-552.192) -- 0:00:48
198000 -- (-550.148) (-549.693) (-550.790) [-552.228] * (-550.273) [-549.523] (-552.153) (-549.430) -- 0:00:48
198500 -- [-549.783] (-549.676) (-553.675) (-550.862) * (-550.916) (-556.055) (-554.443) [-551.029] -- 0:00:48
199000 -- (-551.933) (-551.699) [-551.987] (-552.443) * [-550.635] (-550.022) (-551.012) (-550.136) -- 0:00:48
199500 -- (-550.415) (-552.948) [-549.361] (-549.859) * (-554.769) [-550.565] (-550.289) (-549.109) -- 0:00:48
200000 -- (-552.607) (-549.740) [-557.456] (-550.771) * (-552.624) (-552.724) (-550.249) [-553.158] -- 0:00:48
Average standard deviation of split frequencies: 0.020728
200500 -- (-550.254) [-551.061] (-551.375) (-554.087) * (-551.476) [-554.653] (-549.566) (-555.273) -- 0:00:47
201000 -- (-553.183) (-549.455) [-549.479] (-550.556) * (-552.970) [-553.077] (-551.819) (-555.584) -- 0:00:47
201500 -- (-549.567) (-551.098) (-553.318) [-551.425] * (-554.521) (-551.305) [-551.221] (-550.272) -- 0:00:47
202000 -- (-552.918) (-551.075) (-550.786) [-552.384] * (-549.954) [-552.346] (-552.683) (-549.334) -- 0:00:47
202500 -- (-552.341) (-549.589) (-551.013) [-550.779] * (-555.421) (-555.878) (-553.071) [-551.681] -- 0:00:47
203000 -- (-550.709) [-549.850] (-551.169) (-551.066) * (-551.919) (-555.667) [-549.174] (-553.318) -- 0:00:47
203500 -- (-551.725) (-550.386) (-552.194) [-549.737] * (-550.007) (-553.748) [-550.108] (-552.589) -- 0:00:46
204000 -- (-549.301) (-549.884) [-550.247] (-550.238) * (-551.269) (-562.032) [-553.960] (-552.790) -- 0:00:50
204500 -- (-551.673) (-551.092) (-551.132) [-551.481] * (-549.427) (-552.041) (-550.191) [-549.462] -- 0:00:50
205000 -- [-549.484] (-552.414) (-550.504) (-550.668) * [-553.495] (-549.490) (-553.862) (-550.132) -- 0:00:50
Average standard deviation of split frequencies: 0.019451
205500 -- (-549.986) [-557.929] (-551.340) (-552.398) * [-551.628] (-550.752) (-551.337) (-554.388) -- 0:00:50
206000 -- [-549.732] (-556.264) (-554.038) (-553.778) * (-550.637) (-551.496) (-551.337) [-552.937] -- 0:00:50
206500 -- [-551.348] (-550.092) (-550.997) (-550.050) * (-551.646) (-551.287) [-550.143] (-551.098) -- 0:00:49
207000 -- [-551.997] (-553.751) (-551.752) (-552.621) * (-557.601) [-549.861] (-549.456) (-552.346) -- 0:00:49
207500 -- (-550.692) (-551.165) (-550.192) [-550.720] * [-552.910] (-550.728) (-554.621) (-551.649) -- 0:00:49
208000 -- (-551.012) [-551.060] (-551.659) (-552.679) * (-555.885) (-552.478) [-550.549] (-555.480) -- 0:00:49
208500 -- (-552.718) [-553.536] (-549.656) (-551.459) * (-554.672) (-553.713) [-551.604] (-551.361) -- 0:00:49
209000 -- (-553.079) (-552.440) [-549.508] (-551.585) * (-550.094) (-552.125) [-549.589] (-550.960) -- 0:00:49
209500 -- (-551.031) (-551.827) [-553.661] (-550.154) * [-552.338] (-550.763) (-551.227) (-551.684) -- 0:00:49
210000 -- (-550.620) [-550.387] (-555.105) (-550.056) * (-552.151) (-550.303) (-550.403) [-550.930] -- 0:00:48
Average standard deviation of split frequencies: 0.018274
210500 -- (-553.396) (-552.627) [-549.510] (-550.684) * (-552.637) (-550.432) (-552.468) [-552.785] -- 0:00:48
211000 -- (-553.960) (-549.996) (-550.846) [-549.668] * [-552.701] (-549.489) (-550.805) (-549.766) -- 0:00:48
211500 -- (-551.738) (-549.902) (-552.125) [-551.127] * [-552.197] (-553.755) (-550.875) (-550.072) -- 0:00:48
212000 -- (-552.370) [-553.445] (-551.237) (-549.959) * (-549.627) [-550.560] (-551.778) (-550.950) -- 0:00:48
212500 -- [-551.430] (-549.977) (-551.209) (-549.367) * (-550.474) (-550.217) (-550.919) [-553.492] -- 0:00:48
213000 -- [-551.640] (-551.698) (-553.031) (-550.609) * (-551.216) [-551.423] (-555.664) (-550.178) -- 0:00:48
213500 -- (-552.931) (-552.665) [-551.328] (-551.008) * (-551.171) [-551.412] (-552.709) (-550.569) -- 0:00:47
214000 -- (-550.526) (-553.145) [-550.353] (-550.833) * (-550.732) [-552.144] (-552.981) (-554.546) -- 0:00:47
214500 -- (-550.899) [-549.888] (-555.122) (-550.197) * (-550.642) (-550.888) (-553.275) [-552.922] -- 0:00:47
215000 -- (-551.461) (-552.639) (-550.478) [-550.883] * (-552.379) [-552.510] (-552.946) (-557.406) -- 0:00:47
Average standard deviation of split frequencies: 0.019770
215500 -- (-552.882) (-553.032) [-551.016] (-554.351) * (-549.630) (-550.649) (-550.302) [-550.395] -- 0:00:47
216000 -- (-551.672) (-552.498) [-550.208] (-555.967) * (-551.012) (-554.979) (-551.173) [-551.573] -- 0:00:47
216500 -- (-554.103) [-550.791] (-553.485) (-558.978) * (-550.775) [-550.874] (-550.562) (-553.010) -- 0:00:47
217000 -- [-551.267] (-553.589) (-552.452) (-550.449) * (-550.497) (-550.351) [-550.267] (-550.143) -- 0:00:46
217500 -- (-550.665) (-551.596) (-553.941) [-554.121] * (-551.427) (-551.587) (-554.201) [-551.288] -- 0:00:46
218000 -- (-550.603) (-551.525) (-552.307) [-551.926] * (-551.386) [-552.279] (-551.610) (-552.165) -- 0:00:46
218500 -- [-552.485] (-554.498) (-553.930) (-552.081) * (-550.142) (-550.612) (-551.337) [-551.388] -- 0:00:46
219000 -- (-551.436) (-551.172) [-550.414] (-551.335) * (-553.555) [-550.744] (-551.568) (-550.351) -- 0:00:46
219500 -- (-551.294) (-551.535) (-550.706) [-550.620] * (-552.605) (-554.399) [-551.756] (-550.878) -- 0:00:46
220000 -- (-549.214) [-552.474] (-550.277) (-550.989) * [-550.518] (-551.448) (-556.522) (-552.927) -- 0:00:46
Average standard deviation of split frequencies: 0.019729
220500 -- (-550.234) (-553.750) [-551.373] (-550.991) * (-551.008) (-550.547) [-551.165] (-550.478) -- 0:00:45
221000 -- (-554.768) (-554.373) (-554.292) [-549.940] * [-551.520] (-550.706) (-550.909) (-551.011) -- 0:00:49
221500 -- (-553.089) (-550.372) (-551.112) [-549.619] * (-555.769) (-551.320) [-551.145] (-551.052) -- 0:00:49
222000 -- (-552.611) (-549.403) [-551.616] (-551.074) * (-550.128) (-552.294) (-550.672) [-551.415] -- 0:00:49
222500 -- [-551.894] (-552.188) (-553.497) (-552.226) * (-550.402) (-553.039) (-549.900) [-550.665] -- 0:00:48
223000 -- (-551.077) (-554.557) [-551.814] (-554.139) * (-550.680) (-550.681) [-552.688] (-553.992) -- 0:00:48
223500 -- (-551.535) (-553.017) (-551.380) [-551.272] * [-551.098] (-550.331) (-551.069) (-555.215) -- 0:00:48
224000 -- (-553.219) [-550.929] (-551.153) (-550.079) * (-553.058) [-550.068] (-551.932) (-550.146) -- 0:00:48
224500 -- [-550.845] (-551.787) (-550.120) (-551.341) * (-552.188) (-550.193) (-557.627) [-549.334] -- 0:00:48
225000 -- (-553.751) (-552.921) [-553.054] (-549.752) * [-549.259] (-550.838) (-550.049) (-549.849) -- 0:00:48
Average standard deviation of split frequencies: 0.019264
225500 -- (-552.257) (-553.178) (-554.484) [-549.914] * (-553.089) (-550.290) [-552.720] (-549.918) -- 0:00:48
226000 -- (-556.213) (-554.906) [-553.496] (-552.021) * (-557.320) (-550.205) (-549.383) [-550.693] -- 0:00:47
226500 -- (-553.845) (-551.207) (-556.533) [-553.043] * [-552.677] (-551.539) (-550.499) (-551.556) -- 0:00:47
227000 -- (-549.837) (-550.687) [-551.356] (-552.367) * (-552.169) (-553.109) (-552.340) [-550.898] -- 0:00:47
227500 -- [-555.529] (-551.402) (-550.667) (-558.282) * (-549.834) (-553.435) [-549.218] (-549.783) -- 0:00:47
228000 -- (-552.848) (-553.079) (-552.063) [-553.825] * (-550.079) (-553.555) (-549.557) [-549.759] -- 0:00:47
228500 -- (-550.512) (-551.460) [-552.858] (-551.871) * [-550.310] (-549.764) (-549.411) (-551.756) -- 0:00:47
229000 -- [-550.510] (-551.067) (-555.540) (-551.758) * (-551.447) [-551.199] (-551.789) (-551.132) -- 0:00:47
229500 -- [-549.816] (-552.121) (-549.290) (-550.344) * (-550.723) (-551.409) (-552.825) [-550.330] -- 0:00:47
230000 -- (-554.340) (-558.060) (-550.307) [-549.783] * (-552.317) (-553.016) [-552.439] (-550.560) -- 0:00:46
Average standard deviation of split frequencies: 0.017551
230500 -- [-551.818] (-551.190) (-549.245) (-550.731) * (-553.187) [-551.432] (-553.487) (-552.041) -- 0:00:46
231000 -- [-550.776] (-551.145) (-551.101) (-555.079) * (-552.270) [-552.272] (-550.920) (-550.611) -- 0:00:46
231500 -- (-553.222) (-552.805) (-550.616) [-551.542] * [-551.770] (-552.558) (-550.182) (-550.274) -- 0:00:46
232000 -- (-552.445) [-551.031] (-550.641) (-552.954) * (-550.907) (-552.279) [-549.631] (-549.765) -- 0:00:46
232500 -- (-555.024) (-550.917) [-551.333] (-550.051) * (-551.722) [-551.586] (-551.105) (-553.165) -- 0:00:46
233000 -- [-549.252] (-549.915) (-555.187) (-549.622) * (-550.646) (-554.055) (-551.283) [-551.929] -- 0:00:46
233500 -- [-550.273] (-550.312) (-555.219) (-550.770) * [-550.714] (-551.157) (-552.061) (-549.696) -- 0:00:45
234000 -- (-550.994) [-554.264] (-553.571) (-551.246) * (-550.423) (-557.410) (-551.494) [-550.138] -- 0:00:45
234500 -- (-550.129) [-552.486] (-551.681) (-554.516) * (-550.910) (-552.057) (-552.733) [-549.688] -- 0:00:45
235000 -- [-550.498] (-552.423) (-551.300) (-551.516) * (-550.647) [-556.331] (-550.393) (-552.156) -- 0:00:45
Average standard deviation of split frequencies: 0.016479
235500 -- [-552.194] (-553.242) (-549.735) (-550.830) * (-556.071) (-552.385) [-550.559] (-552.598) -- 0:00:45
236000 -- (-551.826) (-550.346) [-552.386] (-549.189) * (-551.154) [-551.091] (-551.699) (-554.949) -- 0:00:45
236500 -- (-550.365) (-550.138) [-551.624] (-549.710) * (-549.807) [-550.299] (-550.805) (-554.303) -- 0:00:45
237000 -- (-555.115) [-551.288] (-553.021) (-552.816) * (-552.145) (-550.927) [-550.470] (-551.852) -- 0:00:45
237500 -- (-553.344) [-553.926] (-550.506) (-550.369) * (-552.317) (-550.369) (-550.919) [-550.643] -- 0:00:48
238000 -- (-550.997) [-554.504] (-551.219) (-553.328) * (-551.463) (-550.592) [-551.326] (-550.910) -- 0:00:48
238500 -- (-550.745) (-550.447) (-550.175) [-552.080] * [-552.625] (-553.078) (-552.022) (-551.045) -- 0:00:47
239000 -- (-554.371) [-552.118] (-552.303) (-552.893) * [-551.613] (-550.372) (-551.526) (-550.350) -- 0:00:47
239500 -- (-551.215) [-551.826] (-552.218) (-555.800) * (-552.631) (-550.069) (-555.677) [-549.714] -- 0:00:47
240000 -- (-552.147) [-551.270] (-551.119) (-550.942) * (-551.538) (-549.445) [-552.699] (-549.499) -- 0:00:47
Average standard deviation of split frequencies: 0.017996
240500 -- [-549.992] (-550.593) (-552.158) (-550.100) * (-550.353) (-550.719) (-554.441) [-551.998] -- 0:00:47
241000 -- (-549.432) (-553.326) (-553.275) [-550.093] * (-553.091) [-550.131] (-557.668) (-552.492) -- 0:00:47
241500 -- (-555.212) [-553.759] (-557.087) (-551.769) * [-549.213] (-550.788) (-555.291) (-553.448) -- 0:00:47
242000 -- [-551.643] (-555.208) (-550.958) (-550.671) * (-549.666) [-550.943] (-553.028) (-550.244) -- 0:00:46
242500 -- [-552.179] (-557.544) (-550.780) (-553.760) * [-549.935] (-550.899) (-551.630) (-550.624) -- 0:00:46
243000 -- (-553.964) (-551.940) (-555.044) [-551.864] * (-550.374) (-550.385) (-550.520) [-550.726] -- 0:00:46
243500 -- (-550.502) (-552.167) (-551.356) [-552.120] * [-549.793] (-551.051) (-550.637) (-551.854) -- 0:00:46
244000 -- (-552.094) (-552.845) (-552.284) [-551.139] * [-550.191] (-549.618) (-550.384) (-551.986) -- 0:00:46
244500 -- [-549.249] (-553.698) (-552.538) (-551.048) * [-555.227] (-549.592) (-550.033) (-550.161) -- 0:00:46
245000 -- (-551.204) (-553.769) [-550.892] (-549.429) * (-558.350) (-553.547) (-553.354) [-552.271] -- 0:00:46
Average standard deviation of split frequencies: 0.016182
245500 -- (-550.435) (-555.698) (-550.958) [-549.698] * (-552.754) [-551.539] (-554.299) (-550.090) -- 0:00:46
246000 -- (-549.695) (-550.652) [-550.553] (-550.941) * (-551.918) [-552.186] (-551.373) (-549.645) -- 0:00:45
246500 -- (-549.394) (-552.278) [-550.865] (-550.655) * (-552.243) [-550.745] (-551.418) (-549.568) -- 0:00:45
247000 -- (-549.343) [-554.060] (-553.894) (-554.530) * (-550.760) [-554.756] (-551.636) (-550.537) -- 0:00:45
247500 -- (-549.542) [-550.923] (-549.807) (-552.861) * [-549.499] (-554.631) (-552.924) (-551.425) -- 0:00:45
248000 -- (-550.722) (-550.886) (-551.217) [-549.243] * (-551.009) [-550.456] (-550.746) (-550.421) -- 0:00:45
248500 -- (-551.443) [-551.027] (-550.037) (-551.897) * (-551.324) [-550.045] (-551.768) (-553.230) -- 0:00:45
249000 -- [-551.955] (-553.865) (-549.718) (-549.976) * (-550.280) [-550.357] (-555.465) (-554.495) -- 0:00:45
249500 -- (-553.407) (-551.940) (-553.389) [-550.319] * (-550.533) (-553.574) (-554.425) [-551.285] -- 0:00:45
250000 -- (-550.773) (-553.700) [-553.639] (-550.008) * (-551.882) (-552.222) (-551.645) [-553.499] -- 0:00:45
Average standard deviation of split frequencies: 0.016403
250500 -- (-553.647) [-553.080] (-552.078) (-552.493) * (-552.511) (-554.933) [-551.012] (-556.933) -- 0:00:44
251000 -- (-549.886) (-549.719) (-549.764) [-551.687] * (-552.651) (-553.404) (-549.984) [-555.992] -- 0:00:44
251500 -- (-550.969) (-549.892) (-552.211) [-553.364] * (-555.407) [-550.663] (-552.152) (-555.108) -- 0:00:44
252000 -- (-551.850) (-550.273) [-550.957] (-550.713) * (-551.156) (-553.310) (-551.050) [-550.746] -- 0:00:44
252500 -- (-554.835) (-549.669) (-555.733) [-553.968] * (-552.308) [-551.253] (-550.814) (-556.323) -- 0:00:44
253000 -- [-551.649] (-551.456) (-553.125) (-556.123) * (-552.376) (-554.222) [-550.244] (-552.702) -- 0:00:44
253500 -- (-556.377) [-550.973] (-553.648) (-549.847) * (-550.462) (-551.220) [-553.445] (-554.613) -- 0:00:44
254000 -- (-552.677) [-553.062] (-553.404) (-550.819) * (-554.986) (-550.838) (-550.236) [-550.866] -- 0:00:44
254500 -- (-556.619) [-550.051] (-549.840) (-555.656) * (-554.171) [-549.949] (-550.412) (-553.210) -- 0:00:46
255000 -- (-554.399) [-550.279] (-550.846) (-554.620) * (-552.977) [-550.270] (-553.756) (-553.007) -- 0:00:46
Average standard deviation of split frequencies: 0.017084
255500 -- (-553.564) [-550.833] (-556.071) (-551.341) * (-553.951) [-552.265] (-552.209) (-552.420) -- 0:00:46
256000 -- [-551.670] (-550.693) (-553.078) (-549.912) * (-554.273) (-552.110) (-551.112) [-553.289] -- 0:00:46
256500 -- (-552.902) (-551.294) (-551.716) [-551.773] * [-549.685] (-549.442) (-552.250) (-557.841) -- 0:00:46
257000 -- (-550.160) (-550.580) [-550.085] (-551.335) * (-550.560) [-551.529] (-550.338) (-551.417) -- 0:00:46
257500 -- (-551.426) (-553.568) [-555.503] (-556.234) * (-551.274) (-551.502) [-553.573] (-555.800) -- 0:00:46
258000 -- (-553.057) [-553.690] (-551.130) (-552.844) * [-550.227] (-552.264) (-550.423) (-551.860) -- 0:00:46
258500 -- (-550.191) [-553.071] (-555.923) (-551.856) * (-550.009) [-551.546] (-551.746) (-553.824) -- 0:00:45
259000 -- [-550.334] (-551.724) (-550.914) (-549.592) * (-550.200) (-556.533) [-550.222] (-550.252) -- 0:00:45
259500 -- (-550.101) (-552.433) [-550.319] (-549.684) * (-551.139) [-550.091] (-553.493) (-550.314) -- 0:00:45
260000 -- [-550.646] (-552.134) (-550.971) (-550.036) * (-550.615) [-549.649] (-551.064) (-550.879) -- 0:00:45
Average standard deviation of split frequencies: 0.015824
260500 -- (-551.749) [-552.895] (-551.754) (-549.604) * (-552.536) (-549.567) [-549.490] (-551.237) -- 0:00:45
261000 -- (-557.270) (-551.859) [-550.553] (-551.671) * (-553.355) [-549.933] (-553.882) (-552.737) -- 0:00:45
261500 -- (-553.341) [-550.524] (-553.109) (-550.115) * (-559.192) [-553.432] (-551.664) (-552.816) -- 0:00:45
262000 -- [-553.426] (-551.855) (-553.590) (-551.182) * [-551.572] (-560.036) (-553.716) (-550.217) -- 0:00:45
262500 -- (-552.435) (-550.272) [-555.268] (-552.891) * [-554.220] (-551.272) (-553.595) (-554.143) -- 0:00:44
263000 -- (-551.482) [-553.583] (-552.990) (-549.785) * (-553.811) [-550.655] (-552.205) (-550.483) -- 0:00:44
263500 -- (-551.899) [-551.643] (-551.739) (-551.835) * (-550.530) [-549.134] (-553.124) (-551.638) -- 0:00:44
264000 -- [-552.840] (-553.724) (-551.534) (-552.342) * (-553.865) (-549.513) [-550.418] (-552.467) -- 0:00:44
264500 -- (-557.501) (-553.641) [-552.138] (-559.670) * (-552.448) (-550.626) [-558.273] (-554.952) -- 0:00:44
265000 -- (-550.391) (-549.973) (-552.116) [-553.839] * [-553.316] (-551.831) (-550.057) (-552.325) -- 0:00:44
Average standard deviation of split frequencies: 0.016471
265500 -- (-552.306) (-551.054) [-551.874] (-553.796) * (-552.895) (-552.674) [-551.123] (-554.896) -- 0:00:44
266000 -- [-549.831] (-552.356) (-550.041) (-549.960) * (-553.313) (-550.441) (-551.018) [-555.314] -- 0:00:44
266500 -- (-550.514) (-551.459) [-553.697] (-552.320) * (-554.335) [-550.332] (-551.191) (-551.113) -- 0:00:44
267000 -- (-550.024) [-551.366] (-555.005) (-551.414) * (-550.498) (-550.911) [-549.924] (-549.536) -- 0:00:43
267500 -- [-550.605] (-553.005) (-550.437) (-550.321) * (-550.457) (-551.583) (-552.431) [-550.422] -- 0:00:43
268000 -- [-550.148] (-555.525) (-552.332) (-550.788) * (-552.929) [-551.486] (-552.843) (-549.732) -- 0:00:43
268500 -- (-551.288) (-551.026) [-551.578] (-552.695) * [-551.549] (-551.174) (-552.609) (-551.846) -- 0:00:43
269000 -- [-550.276] (-554.098) (-550.778) (-552.335) * [-552.700] (-550.232) (-551.572) (-551.580) -- 0:00:43
269500 -- (-551.244) (-554.019) (-551.662) [-551.127] * (-552.105) [-550.882] (-555.022) (-549.814) -- 0:00:43
270000 -- (-555.783) (-552.616) (-550.607) [-552.252] * (-550.663) [-550.776] (-553.093) (-549.781) -- 0:00:43
Average standard deviation of split frequencies: 0.014260
270500 -- (-550.487) (-551.981) (-553.182) [-552.239] * (-549.957) [-552.273] (-551.544) (-553.247) -- 0:00:43
271000 -- [-550.893] (-549.849) (-553.810) (-549.984) * (-549.485) (-551.107) [-552.791] (-550.838) -- 0:00:43
271500 -- [-551.280] (-551.647) (-550.999) (-551.921) * (-551.160) [-552.833] (-549.695) (-557.607) -- 0:00:45
272000 -- [-549.751] (-550.560) (-550.705) (-549.559) * (-553.278) (-551.305) (-555.040) [-552.376] -- 0:00:45
272500 -- (-552.396) (-550.983) [-553.944] (-549.848) * (-550.796) (-552.126) [-549.616] (-550.643) -- 0:00:45
273000 -- [-550.731] (-552.141) (-554.881) (-551.282) * [-551.021] (-551.955) (-550.417) (-550.353) -- 0:00:45
273500 -- [-551.488] (-551.714) (-551.590) (-549.968) * (-551.633) [-551.013] (-550.373) (-551.089) -- 0:00:45
274000 -- [-549.999] (-552.229) (-549.917) (-550.272) * (-553.385) [-550.673] (-552.168) (-549.964) -- 0:00:45
274500 -- (-550.834) (-553.058) [-551.263] (-549.500) * [-551.063] (-550.881) (-551.820) (-554.005) -- 0:00:44
275000 -- (-551.300) [-557.506] (-552.330) (-555.824) * (-554.427) [-550.098] (-551.145) (-552.479) -- 0:00:44
Average standard deviation of split frequencies: 0.014625
275500 -- [-549.947] (-554.806) (-558.588) (-553.830) * [-551.387] (-549.598) (-551.567) (-553.323) -- 0:00:44
276000 -- (-556.154) (-553.703) (-554.088) [-551.427] * [-551.286] (-552.024) (-550.029) (-553.822) -- 0:00:44
276500 -- (-555.628) (-554.854) [-550.357] (-552.787) * (-550.540) [-550.809] (-553.623) (-551.629) -- 0:00:44
277000 -- (-556.573) (-552.301) [-552.578] (-554.029) * [-555.199] (-550.809) (-549.795) (-551.743) -- 0:00:44
277500 -- [-553.566] (-554.156) (-553.137) (-554.787) * (-551.737) (-554.170) [-550.304] (-549.549) -- 0:00:44
278000 -- (-549.639) (-555.791) [-551.252] (-552.046) * [-551.004] (-551.707) (-556.251) (-551.412) -- 0:00:44
278500 -- (-549.761) [-551.753] (-555.478) (-549.967) * (-552.606) [-553.364] (-555.294) (-549.625) -- 0:00:44
279000 -- (-551.871) [-551.097] (-553.728) (-553.965) * [-552.319] (-550.868) (-553.341) (-549.669) -- 0:00:43
279500 -- (-551.917) [-551.076] (-551.606) (-551.428) * (-551.057) (-552.712) (-549.374) [-550.735] -- 0:00:43
280000 -- (-554.701) [-551.486] (-552.683) (-551.830) * (-551.608) [-555.870] (-555.912) (-551.147) -- 0:00:43
Average standard deviation of split frequencies: 0.015221
280500 -- (-555.732) (-552.121) [-551.875] (-550.147) * (-552.243) [-551.383] (-554.204) (-557.226) -- 0:00:43
281000 -- (-551.417) (-550.694) [-555.772] (-554.712) * (-555.923) (-551.121) [-556.806] (-551.457) -- 0:00:43
281500 -- (-553.598) (-556.761) (-552.389) [-556.304] * (-551.543) (-551.544) (-554.029) [-551.281] -- 0:00:43
282000 -- (-552.128) [-551.715] (-552.339) (-552.188) * [-552.382] (-551.252) (-553.248) (-550.619) -- 0:00:43
282500 -- [-552.027] (-552.479) (-555.398) (-555.045) * [-552.056] (-553.091) (-552.123) (-552.607) -- 0:00:43
283000 -- (-551.284) (-551.782) (-555.750) [-553.804] * (-550.664) [-551.717] (-550.175) (-551.391) -- 0:00:43
283500 -- (-549.795) (-550.460) [-551.087] (-552.126) * [-550.473] (-551.937) (-549.664) (-549.737) -- 0:00:42
284000 -- (-551.795) (-550.777) [-551.892] (-554.565) * (-552.185) (-550.851) [-549.874] (-550.072) -- 0:00:42
284500 -- (-553.395) [-553.509] (-553.630) (-557.046) * (-551.690) (-550.847) (-551.526) [-549.665] -- 0:00:42
285000 -- (-552.372) [-550.558] (-555.778) (-550.888) * (-554.519) (-551.311) (-552.281) [-549.556] -- 0:00:42
Average standard deviation of split frequencies: 0.016391
285500 -- [-550.346] (-549.855) (-549.425) (-549.545) * (-549.901) (-551.025) [-549.544] (-550.074) -- 0:00:42
286000 -- (-551.245) (-550.134) [-549.505] (-551.776) * (-552.611) (-551.142) (-551.918) [-549.672] -- 0:00:42
286500 -- (-551.568) (-553.005) (-551.932) [-551.906] * (-553.758) (-552.487) [-552.314] (-550.607) -- 0:00:42
287000 -- (-552.206) [-550.110] (-551.428) (-553.217) * (-554.108) [-551.852] (-553.120) (-552.552) -- 0:00:42
287500 -- (-554.611) (-552.352) (-555.164) [-553.063] * [-552.777] (-552.794) (-551.228) (-550.642) -- 0:00:42
288000 -- (-551.127) [-553.503] (-554.246) (-550.728) * (-553.672) (-550.417) (-553.973) [-549.586] -- 0:00:44
288500 -- (-553.215) (-552.066) (-556.018) [-550.513] * (-553.072) (-553.463) [-550.064] (-552.688) -- 0:00:44
289000 -- (-554.457) (-553.364) [-550.778] (-553.906) * (-552.827) (-550.180) [-549.288] (-550.562) -- 0:00:44
289500 -- (-553.538) (-552.828) (-551.347) [-549.806] * (-551.540) (-552.815) (-550.803) [-551.815] -- 0:00:44
290000 -- [-550.624] (-550.430) (-554.110) (-550.233) * (-550.519) [-551.023] (-552.446) (-558.537) -- 0:00:44
Average standard deviation of split frequencies: 0.016398
290500 -- [-549.901] (-550.805) (-552.578) (-550.386) * (-553.765) (-553.178) (-552.100) [-552.834] -- 0:00:43
291000 -- (-552.507) (-550.569) (-552.064) [-551.573] * (-554.262) (-557.275) (-557.635) [-551.930] -- 0:00:43
291500 -- (-549.821) (-551.211) (-551.326) [-549.891] * (-551.514) [-551.642] (-550.860) (-554.311) -- 0:00:43
292000 -- (-552.360) [-551.339] (-557.277) (-551.142) * [-552.564] (-550.094) (-551.608) (-552.781) -- 0:00:43
292500 -- (-552.247) (-550.469) (-553.602) [-551.706] * (-552.010) [-552.390] (-554.370) (-558.248) -- 0:00:43
293000 -- (-550.700) (-558.184) [-550.764] (-550.538) * (-550.128) (-550.684) [-552.955] (-554.598) -- 0:00:43
293500 -- (-550.348) (-554.801) [-551.029] (-549.949) * (-551.865) [-552.616] (-551.722) (-554.151) -- 0:00:43
294000 -- (-551.711) (-553.318) (-550.543) [-549.468] * (-550.935) [-551.121] (-549.894) (-551.641) -- 0:00:43
294500 -- (-550.778) (-553.465) (-556.611) [-550.429] * (-550.532) (-553.160) (-553.427) [-550.253] -- 0:00:43
295000 -- (-550.614) (-555.183) [-551.895] (-549.682) * [-550.722] (-552.394) (-553.471) (-549.328) -- 0:00:43
Average standard deviation of split frequencies: 0.016811
295500 -- (-553.801) [-550.293] (-553.019) (-550.681) * (-550.466) (-552.675) [-550.284] (-550.259) -- 0:00:42
296000 -- (-553.217) [-550.987] (-550.885) (-550.159) * (-550.251) (-552.027) (-550.568) [-550.001] -- 0:00:42
296500 -- (-551.950) (-549.870) (-550.529) [-550.260] * (-556.354) (-556.023) (-550.635) [-552.032] -- 0:00:42
297000 -- (-549.456) (-550.889) [-550.730] (-554.146) * (-554.452) (-551.320) [-550.044] (-551.335) -- 0:00:42
297500 -- (-553.063) (-554.470) [-555.219] (-555.940) * (-553.564) (-550.774) (-554.345) [-550.935] -- 0:00:42
298000 -- (-551.893) (-553.006) [-550.134] (-551.585) * (-553.290) (-551.710) (-551.857) [-551.153] -- 0:00:42
298500 -- (-550.037) (-551.889) (-554.015) [-550.810] * [-554.593] (-549.373) (-550.879) (-550.138) -- 0:00:42
299000 -- (-550.036) (-552.552) [-554.617] (-550.627) * (-553.975) (-551.712) [-549.949] (-552.164) -- 0:00:42
299500 -- (-551.169) (-551.348) [-552.256] (-549.818) * (-552.145) (-550.675) (-549.897) [-550.897] -- 0:00:42
300000 -- (-550.329) (-552.405) (-551.942) [-550.625] * (-552.801) [-550.088] (-553.181) (-552.596) -- 0:00:42
Average standard deviation of split frequencies: 0.017508
300500 -- (-551.836) (-554.569) (-550.630) [-550.182] * (-554.188) (-556.834) [-550.532] (-553.106) -- 0:00:41
301000 -- (-552.215) [-550.704] (-549.860) (-551.420) * (-551.502) (-555.194) [-549.436] (-553.470) -- 0:00:41
301500 -- (-550.260) (-559.669) (-550.277) [-553.729] * (-552.187) (-553.387) [-553.250] (-551.233) -- 0:00:41
302000 -- (-550.709) (-552.737) [-551.801] (-549.898) * (-554.247) (-554.791) (-552.918) [-552.121] -- 0:00:41
302500 -- (-550.777) (-553.408) [-552.854] (-550.485) * [-554.646] (-558.363) (-552.324) (-552.004) -- 0:00:41
303000 -- (-554.636) [-550.664] (-555.341) (-552.781) * (-553.036) [-550.956] (-550.647) (-554.181) -- 0:00:41
303500 -- (-549.952) (-551.776) (-550.664) [-554.530] * (-552.287) [-550.466] (-551.492) (-554.373) -- 0:00:41
304000 -- (-550.062) (-556.128) [-550.410] (-554.809) * (-552.170) (-549.890) [-551.863] (-551.962) -- 0:00:41
304500 -- (-555.067) (-551.762) (-550.647) [-551.208] * (-556.658) (-549.772) (-554.566) [-552.636] -- 0:00:41
305000 -- (-552.237) (-551.254) (-550.343) [-551.001] * (-558.062) (-553.586) [-552.693] (-552.384) -- 0:00:43
Average standard deviation of split frequencies: 0.017031
305500 -- (-552.081) (-550.349) (-553.132) [-549.448] * (-554.222) (-552.351) [-551.839] (-558.202) -- 0:00:43
306000 -- (-552.287) (-551.692) [-553.209] (-550.809) * (-553.798) (-552.284) [-550.727] (-550.348) -- 0:00:43
306500 -- (-554.896) (-550.703) (-554.600) [-551.179] * (-551.570) (-551.774) [-553.179] (-550.277) -- 0:00:42
307000 -- [-554.632] (-550.481) (-550.556) (-550.308) * [-553.633] (-553.857) (-551.699) (-551.407) -- 0:00:42
307500 -- (-552.808) (-554.013) (-550.412) [-551.520] * (-550.648) [-552.100] (-554.121) (-554.302) -- 0:00:42
308000 -- (-552.202) (-551.373) [-550.420] (-551.174) * (-550.702) (-550.690) (-551.238) [-551.677] -- 0:00:42
308500 -- [-552.743] (-549.967) (-549.785) (-551.450) * [-552.391] (-551.008) (-553.555) (-555.272) -- 0:00:42
309000 -- [-551.390] (-552.073) (-550.164) (-555.950) * (-550.642) (-552.825) [-550.785] (-555.199) -- 0:00:42
309500 -- [-551.158] (-552.198) (-550.880) (-550.260) * (-551.302) (-550.181) (-551.278) [-550.162] -- 0:00:42
310000 -- (-550.900) (-553.379) [-551.759] (-550.914) * (-551.817) (-549.772) [-550.227] (-550.404) -- 0:00:42
Average standard deviation of split frequencies: 0.015174
310500 -- [-553.020] (-551.703) (-550.220) (-552.628) * [-551.761] (-549.798) (-551.222) (-551.864) -- 0:00:42
311000 -- (-556.781) [-555.149] (-551.293) (-550.881) * (-555.863) (-550.408) [-550.988] (-549.233) -- 0:00:42
311500 -- [-555.170] (-550.919) (-551.445) (-551.670) * (-555.150) [-551.231] (-552.096) (-554.083) -- 0:00:41
312000 -- (-551.637) [-550.811] (-551.018) (-551.681) * (-550.875) (-551.317) (-553.292) [-552.027] -- 0:00:41
312500 -- (-552.864) (-550.757) [-551.390] (-551.046) * (-549.963) [-550.565] (-551.056) (-552.614) -- 0:00:41
313000 -- (-552.879) [-551.833] (-550.444) (-551.264) * (-551.973) (-554.798) (-550.817) [-552.723] -- 0:00:41
313500 -- (-550.265) (-552.931) [-549.889] (-553.346) * (-551.490) (-552.614) [-550.856] (-551.229) -- 0:00:41
314000 -- (-551.087) (-556.170) [-551.104] (-551.210) * [-552.164] (-551.637) (-551.224) (-551.194) -- 0:00:41
314500 -- (-554.062) (-551.896) (-552.101) [-552.697] * [-551.507] (-551.865) (-551.254) (-550.602) -- 0:00:41
315000 -- (-551.078) [-555.319] (-552.966) (-550.661) * (-550.856) (-550.651) [-551.093] (-552.033) -- 0:00:41
Average standard deviation of split frequencies: 0.014918
315500 -- (-554.070) [-557.510] (-549.481) (-550.028) * [-550.380] (-551.711) (-550.524) (-551.290) -- 0:00:41
316000 -- (-555.023) [-550.782] (-551.655) (-553.266) * [-551.835] (-549.905) (-551.288) (-550.855) -- 0:00:41
316500 -- (-552.945) [-549.627] (-551.331) (-551.892) * [-550.529] (-550.210) (-552.763) (-549.633) -- 0:00:41
317000 -- (-550.070) (-550.449) (-550.602) [-550.311] * (-551.957) (-556.227) [-551.745] (-551.331) -- 0:00:40
317500 -- (-552.587) (-555.261) (-551.522) [-549.727] * (-551.358) (-549.729) (-550.476) [-550.005] -- 0:00:40
318000 -- (-554.350) [-551.561] (-552.678) (-549.358) * (-552.879) (-551.324) [-550.914] (-549.763) -- 0:00:40
318500 -- [-552.592] (-549.659) (-552.245) (-557.629) * (-551.923) (-553.120) [-551.103] (-550.384) -- 0:00:40
319000 -- (-551.734) [-550.629] (-550.293) (-551.672) * (-552.370) [-550.420] (-550.168) (-552.182) -- 0:00:40
319500 -- (-552.762) (-550.336) (-552.118) [-551.095] * (-553.117) (-550.060) [-550.357] (-550.427) -- 0:00:40
320000 -- (-551.473) (-552.145) (-549.964) [-551.717] * (-553.516) [-552.560] (-550.987) (-550.419) -- 0:00:40
Average standard deviation of split frequencies: 0.015027
320500 -- (-551.696) (-551.230) (-553.962) [-554.076] * (-553.605) [-552.412] (-549.752) (-550.481) -- 0:00:40
321000 -- (-550.054) [-551.024] (-551.324) (-554.849) * (-551.365) (-557.501) (-554.367) [-549.987] -- 0:00:40
321500 -- (-549.653) (-552.777) (-551.085) [-550.931] * (-552.587) (-557.505) (-555.631) [-552.897] -- 0:00:42
322000 -- (-552.672) [-551.056] (-554.354) (-550.313) * [-552.596] (-557.599) (-556.229) (-550.375) -- 0:00:42
322500 -- (-554.231) [-552.018] (-550.902) (-551.591) * (-550.350) (-549.810) [-553.852] (-551.441) -- 0:00:42
323000 -- (-550.550) (-552.355) [-553.274] (-550.733) * (-550.416) (-553.592) [-552.493] (-550.185) -- 0:00:41
323500 -- [-551.661] (-551.318) (-551.778) (-549.228) * (-552.866) (-553.941) (-556.040) [-552.373] -- 0:00:41
324000 -- [-552.233] (-551.499) (-554.532) (-552.443) * (-551.987) (-552.908) (-552.062) [-554.121] -- 0:00:41
324500 -- (-556.207) [-551.610] (-554.495) (-551.602) * [-552.706] (-553.271) (-552.752) (-553.469) -- 0:00:41
325000 -- [-550.596] (-553.472) (-552.153) (-551.334) * (-554.715) (-550.783) (-550.466) [-551.340] -- 0:00:41
Average standard deviation of split frequencies: 0.014380
325500 -- (-553.111) (-556.411) [-551.500] (-550.405) * (-551.136) (-551.609) [-551.325] (-551.279) -- 0:00:41
326000 -- (-550.114) (-551.448) [-552.554] (-553.192) * (-550.207) (-551.388) (-550.508) [-550.177] -- 0:00:41
326500 -- (-549.986) (-553.874) (-551.931) [-552.086] * (-550.056) (-552.118) (-550.642) [-553.908] -- 0:00:41
327000 -- [-550.510] (-550.770) (-551.494) (-555.600) * (-553.121) (-549.451) (-549.786) [-549.606] -- 0:00:41
327500 -- (-549.911) (-550.397) [-551.291] (-552.284) * (-550.333) [-551.721] (-550.067) (-551.771) -- 0:00:41
328000 -- (-549.463) [-549.496] (-551.931) (-550.840) * (-551.359) (-550.061) (-549.984) [-555.343] -- 0:00:40
328500 -- [-550.733] (-552.653) (-553.177) (-551.922) * (-550.486) [-553.034] (-554.258) (-554.198) -- 0:00:40
329000 -- [-550.200] (-549.956) (-552.906) (-550.737) * (-555.095) (-550.130) (-556.873) [-549.571] -- 0:00:40
329500 -- [-552.392] (-554.519) (-555.670) (-549.771) * [-552.148] (-550.317) (-552.346) (-549.693) -- 0:00:40
330000 -- (-555.158) (-549.460) (-555.189) [-551.075] * (-558.531) [-551.026] (-553.555) (-554.516) -- 0:00:40
Average standard deviation of split frequencies: 0.013623
330500 -- (-551.620) [-550.383] (-552.377) (-552.459) * (-555.457) (-556.890) (-553.454) [-551.347] -- 0:00:40
331000 -- [-556.542] (-551.653) (-552.834) (-551.554) * (-552.134) [-550.365] (-553.536) (-551.822) -- 0:00:40
331500 -- (-553.489) (-553.438) [-554.351] (-551.645) * (-551.624) [-551.065] (-553.900) (-551.205) -- 0:00:40
332000 -- (-552.719) [-550.819] (-554.809) (-551.006) * (-551.152) [-551.411] (-552.486) (-552.324) -- 0:00:40
332500 -- [-550.198] (-550.070) (-553.803) (-551.468) * [-551.666] (-551.657) (-552.174) (-553.704) -- 0:00:40
333000 -- (-550.097) [-549.714] (-549.687) (-549.408) * (-551.330) (-557.175) [-549.353] (-552.057) -- 0:00:40
333500 -- (-553.065) (-554.995) [-550.935] (-552.746) * (-553.278) (-550.770) (-549.813) [-550.745] -- 0:00:39
334000 -- [-550.768] (-553.404) (-551.093) (-551.938) * (-552.888) [-549.930] (-552.482) (-550.555) -- 0:00:39
334500 -- (-550.109) (-550.567) [-553.139] (-553.680) * (-552.814) (-553.106) (-550.676) [-551.019] -- 0:00:39
335000 -- (-551.597) (-550.415) (-554.232) [-553.529] * [-550.446] (-552.970) (-552.708) (-549.536) -- 0:00:39
Average standard deviation of split frequencies: 0.013484
335500 -- (-552.191) (-554.882) (-552.700) [-551.726] * (-557.616) (-551.830) (-552.705) [-553.694] -- 0:00:39
336000 -- (-552.193) (-550.312) [-551.052] (-557.887) * (-555.695) (-551.064) [-550.333] (-552.033) -- 0:00:39
336500 -- [-552.860] (-550.357) (-549.617) (-558.673) * (-552.732) (-550.525) [-552.709] (-549.902) -- 0:00:39
337000 -- (-558.534) [-551.792] (-551.694) (-555.327) * [-550.542] (-553.146) (-550.753) (-552.878) -- 0:00:39
337500 -- (-550.700) (-550.888) [-553.623] (-549.479) * (-552.705) (-550.535) [-552.969] (-552.085) -- 0:00:41
338000 -- (-553.436) [-554.185] (-554.504) (-550.712) * (-551.915) (-551.072) [-550.192] (-553.433) -- 0:00:41
338500 -- [-556.360] (-549.845) (-550.287) (-554.635) * (-550.558) [-551.467] (-551.895) (-551.676) -- 0:00:41
339000 -- (-552.255) [-550.945] (-552.727) (-550.461) * (-551.893) [-552.229] (-553.876) (-557.749) -- 0:00:40
339500 -- (-555.658) (-552.025) [-550.624] (-551.579) * [-552.244] (-553.883) (-552.794) (-554.661) -- 0:00:40
340000 -- (-552.355) [-552.666] (-552.431) (-553.956) * (-551.959) (-551.324) [-551.822] (-551.802) -- 0:00:40
Average standard deviation of split frequencies: 0.012838
340500 -- (-551.741) (-553.780) [-550.664] (-551.199) * (-562.341) [-550.923] (-552.490) (-551.602) -- 0:00:40
341000 -- (-550.255) (-552.017) (-551.570) [-550.209] * (-554.043) (-550.739) [-552.818] (-551.167) -- 0:00:40
341500 -- [-551.122] (-552.421) (-552.682) (-552.209) * (-554.331) (-552.851) (-553.260) [-552.404] -- 0:00:40
342000 -- (-555.020) (-551.475) (-551.165) [-552.752] * (-555.218) (-551.704) [-551.404] (-551.496) -- 0:00:40
342500 -- (-552.809) (-551.034) [-551.814] (-549.636) * [-551.846] (-551.555) (-549.701) (-551.553) -- 0:00:40
343000 -- [-552.327] (-551.437) (-553.907) (-549.648) * (-550.187) (-551.454) (-550.247) [-549.731] -- 0:00:40
343500 -- (-554.032) (-551.264) [-550.449] (-550.256) * [-550.433] (-554.638) (-551.723) (-556.293) -- 0:00:40
344000 -- [-555.009] (-552.398) (-550.088) (-551.970) * (-550.600) (-551.494) (-555.485) [-551.487] -- 0:00:40
344500 -- (-552.825) (-552.235) [-549.538] (-550.589) * [-552.767] (-549.128) (-555.452) (-555.909) -- 0:00:39
345000 -- (-551.885) (-552.394) (-552.487) [-555.145] * [-553.068] (-550.479) (-549.885) (-552.288) -- 0:00:39
Average standard deviation of split frequencies: 0.011975
345500 -- (-554.845) [-551.133] (-551.690) (-551.708) * [-550.999] (-553.092) (-553.018) (-550.699) -- 0:00:39
346000 -- (-554.623) (-550.972) (-555.397) [-551.300] * [-551.673] (-553.427) (-551.810) (-552.503) -- 0:00:39
346500 -- (-552.078) [-550.860] (-555.416) (-552.435) * [-551.204] (-551.450) (-550.553) (-550.924) -- 0:00:39
347000 -- (-554.009) (-550.071) (-554.757) [-551.092] * (-556.506) (-553.455) [-551.913] (-550.879) -- 0:00:39
347500 -- (-550.860) [-551.413] (-552.304) (-551.267) * (-553.457) [-552.934] (-550.974) (-554.214) -- 0:00:39
348000 -- (-554.276) (-550.798) (-554.409) [-552.683] * (-552.559) (-552.930) (-551.984) [-551.156] -- 0:00:39
348500 -- (-551.818) (-549.980) (-549.815) [-549.788] * (-552.548) [-552.897] (-554.502) (-550.904) -- 0:00:39
349000 -- (-551.833) (-551.776) [-550.621] (-552.655) * (-552.184) (-550.180) (-554.536) [-554.240] -- 0:00:39
349500 -- (-551.460) (-551.032) [-549.522] (-551.435) * (-549.252) (-549.879) (-551.672) [-550.349] -- 0:00:39
350000 -- [-550.800] (-551.597) (-550.693) (-551.403) * (-549.866) [-550.363] (-551.267) (-554.039) -- 0:00:39
Average standard deviation of split frequencies: 0.011229
350500 -- (-553.158) [-550.818] (-550.357) (-551.805) * [-553.213] (-552.460) (-555.176) (-551.538) -- 0:00:38
351000 -- [-550.747] (-550.092) (-551.752) (-555.419) * [-554.121] (-550.841) (-554.711) (-551.071) -- 0:00:38
351500 -- (-555.103) [-552.995] (-550.957) (-550.470) * [-550.432] (-555.559) (-551.639) (-553.358) -- 0:00:38
352000 -- (-549.942) [-551.363] (-556.042) (-551.120) * [-550.675] (-552.169) (-554.897) (-551.273) -- 0:00:38
352500 -- [-549.568] (-552.606) (-551.664) (-550.795) * [-551.283] (-553.528) (-554.055) (-553.431) -- 0:00:38
353000 -- (-550.401) (-551.455) [-551.412] (-550.827) * [-551.377] (-551.897) (-551.791) (-550.814) -- 0:00:38
353500 -- (-550.568) (-549.847) [-549.971] (-552.340) * [-552.034] (-551.053) (-549.833) (-552.778) -- 0:00:38
354000 -- (-551.140) (-551.546) [-549.362] (-551.724) * (-553.089) [-551.264] (-550.504) (-549.730) -- 0:00:40
354500 -- (-551.888) (-551.442) [-550.307] (-550.348) * (-553.014) [-551.326] (-551.638) (-552.248) -- 0:00:40
355000 -- (-557.326) (-552.002) [-551.342] (-553.010) * [-552.785] (-551.005) (-551.183) (-551.977) -- 0:00:39
Average standard deviation of split frequencies: 0.011061
355500 -- [-550.359] (-549.752) (-549.998) (-553.660) * (-553.073) (-550.757) (-550.602) [-552.428] -- 0:00:39
356000 -- (-553.447) (-552.231) [-550.840] (-554.065) * (-552.048) (-550.712) [-553.563] (-555.972) -- 0:00:39
356500 -- (-550.172) [-555.987] (-555.654) (-551.114) * (-550.724) (-550.347) (-551.797) [-551.354] -- 0:00:39
357000 -- (-550.574) (-551.615) [-551.285] (-551.949) * (-551.325) (-553.223) (-552.550) [-553.482] -- 0:00:39
357500 -- [-550.278] (-552.656) (-551.125) (-551.595) * [-551.002] (-551.695) (-553.866) (-551.706) -- 0:00:39
358000 -- (-550.295) (-551.562) (-552.518) [-550.094] * (-551.851) (-551.121) (-551.802) [-550.048] -- 0:00:39
358500 -- (-551.969) [-550.164] (-552.317) (-551.463) * (-550.528) [-550.874] (-554.318) (-554.065) -- 0:00:39
359000 -- [-551.513] (-551.103) (-551.897) (-552.747) * (-550.392) (-552.660) (-551.397) [-550.793] -- 0:00:39
359500 -- [-550.999] (-552.100) (-551.101) (-550.133) * [-550.782] (-550.069) (-549.974) (-549.961) -- 0:00:39
360000 -- (-551.681) [-550.465] (-549.664) (-549.528) * (-550.068) [-550.025] (-556.536) (-552.423) -- 0:00:39
Average standard deviation of split frequencies: 0.009884
360500 -- (-550.477) (-555.228) [-550.352] (-551.291) * (-552.209) [-553.645] (-550.220) (-553.231) -- 0:00:39
361000 -- (-549.591) [-551.976] (-552.639) (-555.205) * (-549.700) [-553.301] (-549.905) (-549.558) -- 0:00:38
361500 -- [-550.865] (-549.617) (-549.760) (-553.891) * (-550.995) (-549.607) (-555.150) [-551.326] -- 0:00:38
362000 -- [-549.984] (-549.269) (-551.274) (-551.255) * (-550.333) (-553.450) (-553.720) [-549.450] -- 0:00:38
362500 -- [-550.949] (-550.946) (-551.622) (-555.249) * [-550.435] (-556.076) (-551.365) (-550.890) -- 0:00:38
363000 -- (-552.743) [-553.274] (-551.133) (-550.087) * (-551.426) [-550.162] (-554.684) (-549.503) -- 0:00:38
363500 -- (-550.411) [-549.757] (-550.293) (-551.292) * (-552.897) (-550.824) (-550.102) [-553.301] -- 0:00:38
364000 -- (-553.581) [-552.430] (-550.978) (-552.802) * (-552.363) (-550.369) [-553.559] (-560.959) -- 0:00:38
364500 -- (-552.452) [-550.150] (-552.258) (-552.298) * [-553.130] (-549.645) (-553.411) (-551.950) -- 0:00:38
365000 -- (-550.119) (-550.924) (-552.961) [-551.107] * (-551.107) (-549.445) (-555.024) [-551.875] -- 0:00:38
Average standard deviation of split frequencies: 0.009471
365500 -- (-551.337) (-551.436) [-549.915] (-550.493) * (-553.863) [-551.595] (-550.034) (-551.284) -- 0:00:38
366000 -- (-553.609) [-550.131] (-554.513) (-552.894) * (-553.407) (-553.215) [-549.597] (-551.201) -- 0:00:38
366500 -- (-551.630) (-552.526) (-550.712) [-549.690] * (-552.318) [-554.257] (-554.265) (-551.888) -- 0:00:38
367000 -- (-553.530) (-551.712) (-553.556) [-551.627] * (-551.229) (-553.374) [-550.782] (-550.171) -- 0:00:37
367500 -- (-553.605) (-550.717) [-550.195] (-551.651) * (-550.566) (-551.106) (-551.222) [-554.761] -- 0:00:37
368000 -- [-553.156] (-550.837) (-551.776) (-553.340) * [-552.004] (-550.009) (-550.236) (-552.545) -- 0:00:37
368500 -- (-554.813) [-554.209] (-551.062) (-552.996) * (-550.612) (-550.478) (-551.640) [-553.548] -- 0:00:37
369000 -- (-549.619) [-550.426] (-551.378) (-551.566) * (-552.765) (-551.587) [-553.109] (-550.220) -- 0:00:37
369500 -- (-552.555) (-553.319) (-554.364) [-549.699] * (-552.442) (-554.006) [-550.224] (-551.385) -- 0:00:37
370000 -- (-556.298) [-551.469] (-551.079) (-550.550) * [-552.330] (-550.293) (-552.708) (-551.463) -- 0:00:37
Average standard deviation of split frequencies: 0.010399
370500 -- [-551.547] (-551.087) (-554.171) (-551.706) * (-554.512) (-550.867) [-549.898] (-553.040) -- 0:00:37
371000 -- [-551.575] (-550.445) (-550.164) (-553.215) * (-553.668) (-550.910) (-552.711) [-550.725] -- 0:00:38
371500 -- (-553.903) [-550.502] (-549.570) (-549.692) * (-550.425) (-550.426) [-550.019] (-550.969) -- 0:00:38
372000 -- (-551.682) (-550.660) (-550.806) [-550.295] * [-550.363] (-550.217) (-549.879) (-550.283) -- 0:00:38
372500 -- (-550.351) [-552.487] (-550.340) (-550.345) * (-549.523) (-552.205) (-556.612) [-552.012] -- 0:00:38
373000 -- (-550.617) (-554.638) (-550.474) [-552.168] * (-551.893) (-550.789) (-550.911) [-550.727] -- 0:00:38
373500 -- (-553.015) (-553.051) [-550.855] (-553.740) * (-551.383) (-550.299) [-551.952] (-550.783) -- 0:00:38
374000 -- (-553.139) (-551.648) (-554.301) [-550.205] * (-552.556) (-549.824) (-552.412) [-550.834] -- 0:00:38
374500 -- (-554.436) [-550.992] (-552.752) (-550.554) * (-550.645) [-551.396] (-550.582) (-554.314) -- 0:00:38
375000 -- [-554.231] (-550.217) (-552.283) (-552.657) * (-554.467) (-552.695) [-551.967] (-556.887) -- 0:00:38
Average standard deviation of split frequencies: 0.011049
375500 -- (-552.129) [-550.213] (-551.074) (-550.358) * [-551.056] (-551.285) (-551.843) (-555.167) -- 0:00:38
376000 -- (-550.983) (-554.569) (-549.988) [-551.807] * (-551.434) (-556.306) (-549.730) [-552.744] -- 0:00:38
376500 -- (-553.978) (-552.628) (-554.077) [-550.869] * (-553.453) (-550.754) [-553.214] (-550.503) -- 0:00:38
377000 -- (-551.077) (-550.010) [-552.063] (-550.419) * (-552.635) (-549.656) (-554.651) [-552.431] -- 0:00:38
377500 -- (-550.611) (-553.545) (-550.354) [-553.413] * (-551.926) [-552.192] (-549.771) (-550.283) -- 0:00:37
378000 -- (-550.370) (-551.333) (-555.904) [-552.595] * (-552.666) (-551.470) [-549.950] (-551.462) -- 0:00:37
378500 -- (-549.596) (-553.800) (-551.691) [-550.961] * [-550.053] (-551.664) (-553.018) (-552.135) -- 0:00:37
379000 -- [-549.329] (-551.917) (-556.964) (-550.605) * (-551.384) (-551.411) (-553.593) [-550.564] -- 0:00:37
379500 -- [-550.303] (-552.694) (-550.874) (-552.306) * (-551.021) (-552.802) (-553.400) [-550.015] -- 0:00:37
380000 -- (-550.999) [-550.921] (-552.149) (-552.536) * (-551.437) (-552.248) [-554.176] (-550.304) -- 0:00:37
Average standard deviation of split frequencies: 0.010062
380500 -- (-551.523) [-551.389] (-552.210) (-551.809) * (-552.654) (-551.184) [-551.010] (-550.605) -- 0:00:37
381000 -- (-559.978) [-550.716] (-553.265) (-552.376) * [-552.006] (-551.387) (-555.139) (-553.342) -- 0:00:37
381500 -- (-556.918) (-552.034) [-552.305] (-551.767) * (-551.158) (-551.539) (-558.176) [-551.738] -- 0:00:37
382000 -- [-553.926] (-551.117) (-551.030) (-551.726) * [-553.449] (-557.971) (-551.803) (-551.299) -- 0:00:37
382500 -- (-553.311) (-551.538) (-550.390) [-551.138] * (-551.404) (-558.300) (-553.829) [-551.223] -- 0:00:37
383000 -- [-550.841] (-553.135) (-554.097) (-550.036) * (-551.618) (-555.389) (-551.671) [-552.200] -- 0:00:37
383500 -- (-550.849) [-550.813] (-551.263) (-552.842) * [-549.187] (-553.359) (-550.876) (-550.535) -- 0:00:36
384000 -- (-551.729) [-550.962] (-556.313) (-554.184) * (-549.358) (-553.876) (-550.983) [-550.294] -- 0:00:36
384500 -- (-550.534) (-553.851) [-553.564] (-553.646) * (-550.984) [-550.047] (-549.254) (-551.300) -- 0:00:36
385000 -- (-551.309) (-551.651) [-552.012] (-552.565) * (-554.448) (-551.078) (-553.649) [-549.332] -- 0:00:36
Average standard deviation of split frequencies: 0.010449
385500 -- (-551.403) (-555.988) (-557.470) [-551.620] * (-551.725) [-552.205] (-550.392) (-551.317) -- 0:00:36
386000 -- (-550.318) (-551.736) (-549.830) [-550.722] * [-555.473] (-553.614) (-550.838) (-551.160) -- 0:00:36
386500 -- (-554.170) (-553.291) (-551.414) [-550.175] * (-550.307) (-549.480) (-551.946) [-551.055] -- 0:00:36
387000 -- [-556.555] (-554.054) (-552.940) (-551.161) * (-551.740) [-549.660] (-552.617) (-549.204) -- 0:00:36
387500 -- (-552.939) (-550.903) (-551.573) [-551.822] * (-550.450) (-552.365) [-549.800] (-551.010) -- 0:00:37
388000 -- (-550.819) (-550.822) [-552.429] (-554.077) * (-554.808) [-552.232] (-551.142) (-553.707) -- 0:00:37
388500 -- (-549.846) [-551.000] (-554.071) (-551.709) * [-549.701] (-552.151) (-549.410) (-552.827) -- 0:00:37
389000 -- (-552.138) [-553.205] (-554.353) (-550.910) * (-551.677) (-551.738) (-550.036) [-553.397] -- 0:00:37
389500 -- (-551.411) (-552.153) [-551.099] (-550.572) * (-550.046) [-551.535] (-550.315) (-551.526) -- 0:00:37
390000 -- (-552.674) (-551.615) (-555.111) [-549.730] * (-550.373) [-551.458] (-551.303) (-552.302) -- 0:00:37
Average standard deviation of split frequencies: 0.010123
390500 -- (-551.668) [-552.296] (-549.832) (-551.542) * (-552.126) (-554.001) (-552.003) [-551.265] -- 0:00:37
391000 -- (-551.878) (-554.311) (-553.543) [-550.006] * (-552.423) [-549.618] (-551.914) (-550.231) -- 0:00:37
391500 -- (-550.314) [-551.227] (-551.954) (-551.939) * (-551.588) (-549.546) (-552.762) [-552.223] -- 0:00:37
392000 -- (-551.347) (-551.497) (-549.615) [-551.296] * (-549.283) [-549.268] (-555.786) (-550.565) -- 0:00:37
392500 -- [-552.724] (-551.536) (-549.663) (-552.035) * [-549.314] (-549.501) (-560.068) (-551.117) -- 0:00:37
393000 -- (-552.098) (-551.098) [-553.620] (-552.939) * [-549.956] (-550.803) (-549.713) (-549.552) -- 0:00:37
393500 -- (-554.084) (-552.980) (-553.951) [-552.906] * (-552.390) [-549.598] (-550.488) (-550.946) -- 0:00:36
394000 -- (-549.287) [-551.584] (-552.523) (-557.666) * (-551.006) (-551.427) (-553.166) [-550.860] -- 0:00:36
394500 -- (-550.527) [-552.143] (-551.233) (-552.149) * (-551.978) (-550.273) [-550.231] (-550.630) -- 0:00:36
395000 -- [-551.970] (-550.684) (-554.205) (-553.299) * (-550.574) (-553.208) (-551.553) [-553.071] -- 0:00:36
Average standard deviation of split frequencies: 0.010780
395500 -- (-552.517) (-550.208) (-554.023) [-550.086] * (-550.412) [-550.169] (-549.989) (-552.308) -- 0:00:36
396000 -- (-551.572) [-550.664] (-549.758) (-551.303) * [-550.813] (-551.233) (-551.816) (-554.596) -- 0:00:36
396500 -- [-551.314] (-551.375) (-552.287) (-553.665) * [-552.581] (-550.360) (-549.999) (-552.934) -- 0:00:36
397000 -- (-555.223) (-557.976) [-551.466] (-555.705) * [-550.353] (-550.604) (-551.664) (-555.064) -- 0:00:36
397500 -- (-551.665) (-551.819) (-551.909) [-550.442] * (-551.116) (-550.204) (-550.028) [-550.703] -- 0:00:36
398000 -- (-551.466) (-550.960) [-552.527] (-557.729) * [-552.109] (-551.025) (-550.723) (-551.988) -- 0:00:36
398500 -- (-551.546) (-551.084) [-552.129] (-552.660) * (-552.317) [-552.611] (-552.421) (-557.623) -- 0:00:36
399000 -- (-553.227) (-551.198) [-552.167] (-551.215) * [-552.640] (-553.402) (-552.622) (-553.164) -- 0:00:36
399500 -- (-559.087) [-550.460] (-552.332) (-551.139) * (-553.713) [-549.928] (-550.695) (-550.032) -- 0:00:36
400000 -- (-554.072) (-553.589) [-550.955] (-550.469) * [-552.982] (-549.591) (-550.100) (-549.935) -- 0:00:36
Average standard deviation of split frequencies: 0.010327
400500 -- (-554.351) (-553.249) [-551.216] (-551.425) * (-558.565) (-549.982) [-551.606] (-552.308) -- 0:00:35
401000 -- [-553.954] (-552.709) (-550.341) (-551.106) * (-551.820) [-551.338] (-555.762) (-554.375) -- 0:00:35
401500 -- (-550.893) [-551.494] (-552.192) (-553.231) * [-550.272] (-551.409) (-549.400) (-558.202) -- 0:00:35
402000 -- [-550.941] (-552.944) (-551.648) (-551.671) * [-551.723] (-551.449) (-551.148) (-549.534) -- 0:00:35
402500 -- (-549.943) [-551.653] (-551.461) (-554.043) * (-551.262) [-552.609] (-551.877) (-549.493) -- 0:00:35
403000 -- (-561.775) (-550.673) (-551.653) [-549.791] * (-550.371) (-549.620) (-555.475) [-550.166] -- 0:00:35
403500 -- [-550.982] (-550.180) (-550.716) (-549.899) * [-554.371] (-550.737) (-555.844) (-552.738) -- 0:00:36
404000 -- (-555.878) [-552.177] (-549.906) (-555.199) * (-553.013) (-549.856) (-554.504) [-551.821] -- 0:00:36
404500 -- (-551.824) [-550.784] (-551.310) (-550.373) * (-550.758) [-549.339] (-552.681) (-553.886) -- 0:00:36
405000 -- (-551.366) (-549.605) (-550.419) [-551.098] * (-552.436) (-551.528) (-550.860) [-549.862] -- 0:00:36
Average standard deviation of split frequencies: 0.010256
405500 -- (-550.444) [-551.767] (-553.404) (-555.316) * (-551.412) (-552.807) [-556.025] (-549.994) -- 0:00:36
406000 -- (-550.240) (-554.535) (-551.119) [-555.962] * (-549.140) (-551.846) (-555.793) [-551.198] -- 0:00:36
406500 -- (-550.391) [-554.111] (-550.064) (-549.618) * (-550.175) [-553.218] (-551.031) (-554.915) -- 0:00:36
407000 -- (-550.276) [-555.036] (-550.751) (-550.064) * (-554.221) [-552.604] (-551.020) (-553.042) -- 0:00:36
407500 -- (-551.478) (-552.022) [-552.572] (-550.643) * (-552.481) (-550.385) [-550.707] (-552.138) -- 0:00:36
408000 -- (-549.380) (-550.436) [-550.122] (-550.399) * [-552.112] (-556.690) (-552.190) (-553.848) -- 0:00:36
408500 -- (-550.010) (-551.585) [-550.134] (-554.345) * (-551.663) [-555.461] (-552.602) (-553.216) -- 0:00:36
409000 -- (-551.618) [-550.601] (-552.531) (-554.906) * [-550.660] (-555.497) (-550.115) (-552.445) -- 0:00:36
409500 -- (-549.702) (-550.921) (-550.720) [-549.378] * (-552.090) [-549.811] (-551.253) (-549.989) -- 0:00:36
410000 -- (-552.341) (-550.206) [-553.074] (-550.601) * [-554.770] (-555.091) (-549.294) (-549.674) -- 0:00:35
Average standard deviation of split frequencies: 0.010196
410500 -- (-552.884) (-551.073) [-549.097] (-550.653) * (-557.756) (-552.711) [-550.425] (-551.913) -- 0:00:35
411000 -- (-550.843) [-552.715] (-550.266) (-552.133) * (-551.138) (-551.387) [-550.634] (-549.992) -- 0:00:35
411500 -- (-550.545) [-551.397] (-550.431) (-554.217) * (-555.501) (-549.984) (-553.613) [-549.956] -- 0:00:35
412000 -- [-552.569] (-552.122) (-550.179) (-550.229) * (-556.203) (-550.153) [-550.934] (-551.315) -- 0:00:35
412500 -- (-553.676) (-552.060) [-552.406] (-551.770) * (-554.001) (-552.486) (-553.037) [-551.400] -- 0:00:35
413000 -- (-554.397) [-552.738] (-552.031) (-552.901) * (-550.443) [-549.806] (-551.743) (-549.723) -- 0:00:35
413500 -- (-552.215) [-552.310] (-553.423) (-550.990) * (-553.049) (-549.773) (-552.341) [-549.998] -- 0:00:35
414000 -- [-551.172] (-549.264) (-550.982) (-551.382) * (-550.671) [-549.680] (-551.158) (-555.531) -- 0:00:35
414500 -- (-551.252) (-552.343) [-551.004] (-552.734) * (-553.065) [-550.683] (-550.541) (-551.465) -- 0:00:35
415000 -- (-551.865) (-551.270) (-554.498) [-553.371] * (-549.964) [-549.797] (-553.241) (-550.510) -- 0:00:35
Average standard deviation of split frequencies: 0.010891
415500 -- (-556.252) (-549.677) (-551.914) [-552.590] * [-550.378] (-551.137) (-551.077) (-550.031) -- 0:00:35
416000 -- (-552.038) (-551.512) (-550.416) [-555.375] * (-553.401) [-553.984] (-552.326) (-552.617) -- 0:00:35
416500 -- [-551.276] (-550.225) (-551.483) (-552.560) * (-550.297) (-556.548) [-550.688] (-550.011) -- 0:00:35
417000 -- (-552.620) (-556.382) (-552.024) [-551.560] * (-551.060) [-551.131] (-553.370) (-549.428) -- 0:00:34
417500 -- (-556.245) (-550.038) [-550.890] (-552.957) * (-550.756) [-556.038] (-550.915) (-551.150) -- 0:00:34
418000 -- [-552.897] (-550.460) (-551.818) (-551.184) * (-552.108) (-551.254) [-552.816] (-552.515) -- 0:00:34
418500 -- [-555.206] (-552.192) (-549.865) (-551.957) * (-551.656) (-552.229) [-552.476] (-556.914) -- 0:00:34
419000 -- (-552.286) [-551.119] (-552.988) (-550.755) * (-550.272) [-550.472] (-552.900) (-551.685) -- 0:00:34
419500 -- (-551.561) (-552.505) [-552.580] (-549.530) * (-552.696) (-550.572) [-552.823] (-552.996) -- 0:00:34
420000 -- (-550.320) [-552.410] (-549.719) (-549.569) * [-551.673] (-550.248) (-557.378) (-555.252) -- 0:00:35
Average standard deviation of split frequencies: 0.010283
420500 -- (-551.497) (-550.288) [-552.360] (-552.489) * [-552.645] (-553.612) (-551.188) (-551.391) -- 0:00:35
421000 -- (-551.365) (-553.077) (-551.295) [-552.473] * (-550.739) (-553.719) [-550.687] (-552.350) -- 0:00:35
421500 -- (-552.624) [-551.279] (-551.285) (-554.091) * (-552.721) [-550.215] (-550.440) (-556.529) -- 0:00:35
422000 -- (-552.749) (-551.533) (-552.092) [-550.525] * (-552.447) (-552.437) (-553.572) [-555.806] -- 0:00:35
422500 -- [-553.089] (-551.341) (-549.736) (-552.957) * (-550.701) (-554.930) (-553.126) [-551.191] -- 0:00:35
423000 -- [-550.724] (-551.399) (-551.186) (-550.061) * (-551.735) [-551.278] (-552.974) (-553.437) -- 0:00:35
423500 -- (-551.874) (-550.438) [-549.245] (-550.884) * (-553.036) (-550.263) (-553.738) [-550.345] -- 0:00:35
424000 -- [-551.021] (-550.769) (-558.533) (-552.289) * (-553.285) (-550.693) [-550.274] (-553.530) -- 0:00:35
424500 -- [-550.283] (-555.122) (-552.616) (-553.751) * (-552.240) [-550.464] (-554.716) (-551.403) -- 0:00:35
425000 -- (-555.896) [-550.172] (-549.297) (-551.078) * (-553.508) (-553.255) [-549.838] (-557.318) -- 0:00:35
Average standard deviation of split frequencies: 0.010740
425500 -- (-556.906) (-550.301) [-549.725] (-551.096) * (-555.527) (-551.181) [-557.030] (-554.197) -- 0:00:35
426000 -- [-551.872] (-552.845) (-550.531) (-552.920) * (-553.437) (-550.783) (-550.984) [-550.785] -- 0:00:35
426500 -- (-553.456) [-551.410] (-549.827) (-550.704) * (-555.214) [-550.015] (-551.124) (-553.461) -- 0:00:34
427000 -- (-551.835) (-552.958) [-551.695] (-551.463) * (-552.132) (-554.433) [-549.802] (-550.954) -- 0:00:34
427500 -- [-549.512] (-552.914) (-550.370) (-549.863) * (-551.703) (-550.281) [-552.601] (-550.332) -- 0:00:34
428000 -- [-552.266] (-552.579) (-550.467) (-552.518) * (-550.831) (-551.441) (-558.521) [-551.652] -- 0:00:34
428500 -- (-551.337) (-551.527) [-554.174] (-557.791) * [-550.527] (-553.347) (-553.400) (-553.283) -- 0:00:34
429000 -- (-550.593) (-551.382) [-552.068] (-552.972) * (-550.000) [-551.904] (-552.831) (-553.163) -- 0:00:34
429500 -- (-549.974) (-555.221) (-552.262) [-551.901] * [-550.728] (-553.770) (-551.241) (-549.661) -- 0:00:34
430000 -- (-551.310) (-555.031) (-554.098) [-551.598] * (-554.349) (-555.518) (-552.470) [-550.446] -- 0:00:34
Average standard deviation of split frequencies: 0.009973
430500 -- (-551.210) (-551.965) (-552.275) [-549.798] * (-554.017) (-552.942) (-549.815) [-550.814] -- 0:00:34
431000 -- (-552.388) (-550.721) (-550.880) [-551.618] * (-550.146) [-549.935] (-549.857) (-555.158) -- 0:00:34
431500 -- [-551.338] (-551.234) (-550.860) (-549.496) * [-552.283] (-549.921) (-549.443) (-551.415) -- 0:00:34
432000 -- (-551.687) (-554.178) (-551.333) [-552.069] * (-554.745) (-550.772) (-550.024) [-553.451] -- 0:00:34
432500 -- (-551.788) [-554.135] (-552.932) (-551.259) * (-551.086) [-552.512] (-551.413) (-552.804) -- 0:00:34
433000 -- [-550.408] (-553.916) (-551.533) (-551.197) * (-550.151) (-553.634) (-553.126) [-552.076] -- 0:00:34
433500 -- [-551.156] (-552.086) (-551.024) (-553.313) * [-551.198] (-550.142) (-551.891) (-551.153) -- 0:00:33
434000 -- (-551.313) (-549.410) [-549.728] (-554.013) * [-551.193] (-551.190) (-550.075) (-555.458) -- 0:00:33
434500 -- (-550.168) [-549.916] (-551.729) (-554.304) * [-550.349] (-554.734) (-549.960) (-551.118) -- 0:00:33
435000 -- (-552.072) (-554.272) (-557.120) [-552.557] * [-549.714] (-553.515) (-550.641) (-552.956) -- 0:00:33
Average standard deviation of split frequencies: 0.009794
435500 -- (-553.792) [-553.473] (-549.752) (-552.710) * [-554.045] (-549.834) (-550.367) (-549.869) -- 0:00:33
436000 -- (-552.209) [-553.227] (-551.131) (-558.647) * (-549.507) (-549.318) (-550.896) [-551.432] -- 0:00:33
436500 -- (-556.927) (-549.548) [-553.424] (-552.837) * (-549.622) (-553.165) [-549.785] (-552.059) -- 0:00:33
437000 -- (-552.407) [-549.550] (-551.679) (-549.677) * (-551.191) (-549.603) (-550.303) [-552.390] -- 0:00:34
437500 -- (-552.776) [-550.713] (-553.091) (-552.865) * [-550.645] (-550.642) (-552.385) (-551.849) -- 0:00:34
438000 -- [-549.779] (-551.921) (-550.168) (-554.357) * (-555.789) (-550.914) [-555.913] (-550.716) -- 0:00:34
438500 -- [-549.558] (-553.758) (-550.841) (-550.009) * (-550.586) (-549.865) (-550.702) [-552.148] -- 0:00:34
439000 -- [-551.701] (-549.520) (-551.055) (-551.438) * (-550.854) (-549.516) [-551.283] (-549.274) -- 0:00:34
439500 -- (-552.870) (-550.369) (-554.867) [-555.963] * (-553.233) (-550.906) (-554.243) [-550.685] -- 0:00:34
440000 -- (-549.378) (-552.183) [-550.521] (-552.978) * (-551.541) (-550.651) [-552.982] (-550.067) -- 0:00:34
Average standard deviation of split frequencies: 0.010131
440500 -- (-551.189) (-550.704) [-551.491] (-553.177) * (-551.205) (-553.461) [-551.558] (-550.351) -- 0:00:34
441000 -- [-551.202] (-556.618) (-549.991) (-552.462) * (-550.301) (-552.465) (-551.510) [-553.251] -- 0:00:34
441500 -- (-550.869) (-552.412) [-553.131] (-551.321) * (-551.598) [-552.445] (-550.200) (-549.578) -- 0:00:34
442000 -- (-550.754) (-552.512) (-552.090) [-549.564] * (-550.613) [-551.287] (-551.332) (-552.479) -- 0:00:34
442500 -- [-550.677] (-554.717) (-551.545) (-551.487) * (-550.079) (-549.644) [-550.713] (-550.834) -- 0:00:34
443000 -- (-552.579) (-554.918) (-554.454) [-551.496] * [-550.298] (-551.443) (-550.324) (-550.123) -- 0:00:33
443500 -- [-551.290] (-551.987) (-554.474) (-554.791) * (-550.334) (-549.631) [-550.064] (-550.826) -- 0:00:33
444000 -- (-552.481) [-552.984] (-552.836) (-551.124) * (-552.946) (-550.845) [-551.611] (-550.410) -- 0:00:33
444500 -- (-552.079) (-551.607) [-551.148] (-553.876) * (-551.413) [-549.677] (-550.852) (-552.449) -- 0:00:33
445000 -- (-551.058) (-552.459) [-550.010] (-552.091) * (-550.249) (-551.112) [-552.424] (-550.938) -- 0:00:33
Average standard deviation of split frequencies: 0.010134
445500 -- (-555.678) (-550.893) (-551.867) [-551.692] * [-553.465] (-550.812) (-549.806) (-549.789) -- 0:00:33
446000 -- (-554.032) (-550.878) (-550.694) [-550.811] * (-549.401) (-551.324) (-551.988) [-553.651] -- 0:00:33
446500 -- (-550.705) [-552.011] (-551.710) (-552.176) * (-551.430) [-553.084] (-557.566) (-551.853) -- 0:00:33
447000 -- [-549.277] (-549.948) (-550.812) (-551.508) * (-553.245) (-552.110) (-557.225) [-550.098] -- 0:00:33
447500 -- (-552.198) [-551.289] (-557.760) (-552.446) * (-555.888) (-549.836) [-553.339] (-550.561) -- 0:00:33
448000 -- [-553.276] (-550.854) (-556.536) (-549.223) * (-554.597) [-550.150] (-550.928) (-552.421) -- 0:00:33
448500 -- (-554.633) (-554.432) (-557.137) [-552.256] * (-553.700) (-549.704) (-554.076) [-555.212] -- 0:00:33
449000 -- [-550.657] (-552.284) (-553.160) (-552.171) * (-558.171) (-555.233) [-551.813] (-551.394) -- 0:00:33
449500 -- (-553.350) (-550.051) [-554.028] (-550.927) * (-556.125) (-554.351) [-549.898] (-549.804) -- 0:00:33
450000 -- [-550.707] (-550.974) (-552.688) (-552.208) * (-552.570) (-554.449) (-553.514) [-552.952] -- 0:00:33
Average standard deviation of split frequencies: 0.010091
450500 -- (-556.156) (-549.996) [-549.875] (-554.561) * [-553.232] (-549.620) (-554.510) (-550.359) -- 0:00:32
451000 -- (-550.350) [-552.496] (-553.067) (-550.697) * (-551.488) (-553.114) (-552.045) [-552.186] -- 0:00:32
451500 -- (-552.299) [-551.595] (-550.356) (-551.964) * (-553.552) (-551.943) [-550.732] (-551.255) -- 0:00:32
452000 -- (-549.621) [-551.393] (-555.015) (-551.722) * (-553.276) [-555.607] (-549.227) (-551.415) -- 0:00:32
452500 -- [-551.908] (-550.035) (-550.046) (-551.093) * (-550.866) (-552.269) [-549.845] (-550.296) -- 0:00:32
453000 -- (-551.088) (-553.086) (-553.062) [-551.133] * (-553.740) (-553.301) [-549.949] (-550.744) -- 0:00:32
453500 -- [-550.753] (-553.820) (-550.285) (-551.892) * [-552.673] (-549.801) (-553.010) (-553.620) -- 0:00:32
454000 -- [-551.452] (-550.780) (-551.824) (-552.366) * (-553.808) (-551.444) [-551.503] (-554.873) -- 0:00:33
454500 -- (-549.757) (-557.845) [-551.407] (-553.489) * [-550.449] (-560.798) (-555.825) (-554.136) -- 0:00:33
455000 -- (-558.621) (-553.099) (-550.348) [-553.440] * (-550.122) [-552.656] (-552.733) (-552.161) -- 0:00:33
Average standard deviation of split frequencies: 0.009886
455500 -- (-552.451) (-549.735) [-551.305] (-550.859) * (-553.591) (-551.381) (-551.507) [-550.910] -- 0:00:33
456000 -- (-559.798) (-551.168) (-549.344) [-549.330] * (-550.945) [-549.335] (-550.764) (-551.541) -- 0:00:33
456500 -- (-552.141) (-555.459) (-555.081) [-550.663] * [-550.101] (-553.540) (-551.192) (-555.196) -- 0:00:33
457000 -- (-552.947) (-551.328) [-551.702] (-551.061) * (-550.612) (-553.372) [-551.824] (-551.008) -- 0:00:33
457500 -- (-553.088) (-552.738) (-550.880) [-550.168] * (-550.981) (-551.542) (-549.715) [-550.249] -- 0:00:33
458000 -- (-557.623) [-551.285] (-552.274) (-552.249) * (-558.014) [-551.061] (-552.427) (-549.376) -- 0:00:33
458500 -- (-550.914) (-550.297) (-553.686) [-551.793] * (-554.210) (-551.271) [-550.017] (-551.847) -- 0:00:33
459000 -- (-552.575) [-551.124] (-552.180) (-551.446) * (-551.881) [-551.951] (-551.803) (-550.403) -- 0:00:33
459500 -- (-556.451) (-554.213) [-551.029] (-552.736) * [-552.851] (-549.195) (-550.131) (-560.658) -- 0:00:32
460000 -- (-554.612) (-550.566) (-551.129) [-552.281] * [-551.530] (-551.256) (-551.363) (-552.224) -- 0:00:32
Average standard deviation of split frequencies: 0.009466
460500 -- (-552.574) [-552.437] (-549.699) (-553.842) * (-552.970) (-550.308) [-551.556] (-551.297) -- 0:00:32
461000 -- (-552.796) (-550.524) (-551.330) [-549.582] * (-550.706) [-549.538] (-554.541) (-549.484) -- 0:00:32
461500 -- (-553.251) (-551.799) (-551.571) [-549.693] * (-549.984) (-551.524) (-556.172) [-551.902] -- 0:00:32
462000 -- [-551.123] (-552.061) (-551.808) (-550.634) * [-551.472] (-550.684) (-550.797) (-549.799) -- 0:00:32
462500 -- [-550.573] (-558.491) (-552.751) (-549.487) * (-552.296) (-551.326) [-551.721] (-551.692) -- 0:00:32
463000 -- (-552.696) (-551.604) (-552.431) [-552.514] * (-551.817) (-553.260) [-554.710] (-549.594) -- 0:00:32
463500 -- (-550.733) (-552.159) [-553.874] (-552.202) * [-550.539] (-551.767) (-550.699) (-552.068) -- 0:00:32
464000 -- (-549.974) [-549.837] (-552.613) (-550.239) * (-550.326) (-555.682) (-550.436) [-551.365] -- 0:00:32
464500 -- (-550.579) [-551.598] (-550.739) (-549.606) * (-551.782) [-551.732] (-550.469) (-550.602) -- 0:00:32
465000 -- (-552.576) (-551.848) (-552.405) [-550.022] * (-551.293) (-551.905) (-551.312) [-552.534] -- 0:00:32
Average standard deviation of split frequencies: 0.009231
465500 -- (-555.149) (-552.047) [-549.953] (-553.286) * [-551.477] (-554.953) (-553.248) (-551.660) -- 0:00:32
466000 -- [-550.173] (-553.958) (-550.332) (-551.316) * (-552.499) [-551.835] (-551.721) (-551.609) -- 0:00:32
466500 -- (-550.115) [-550.908] (-550.440) (-551.007) * (-549.494) (-555.703) (-551.359) [-552.039] -- 0:00:32
467000 -- [-550.634] (-549.789) (-551.356) (-550.801) * [-552.877] (-551.493) (-551.428) (-551.990) -- 0:00:31
467500 -- [-551.177] (-553.070) (-550.671) (-549.406) * (-553.770) [-551.657] (-552.786) (-553.375) -- 0:00:31
468000 -- (-553.141) (-552.959) (-550.904) [-551.938] * (-549.466) (-556.320) (-550.138) [-553.674] -- 0:00:31
468500 -- (-551.328) (-552.261) (-551.228) [-554.642] * [-554.583] (-551.306) (-550.418) (-552.678) -- 0:00:31
469000 -- (-550.608) (-553.640) [-551.314] (-552.990) * (-550.295) (-552.651) (-554.102) [-549.755] -- 0:00:31
469500 -- (-551.008) (-550.780) [-550.746] (-554.674) * (-551.895) (-551.654) [-550.517] (-551.991) -- 0:00:31
470000 -- (-553.326) (-552.384) [-552.621] (-553.967) * (-554.648) (-554.497) [-550.413] (-555.398) -- 0:00:31
Average standard deviation of split frequencies: 0.008764
470500 -- (-555.720) (-556.375) (-551.364) [-552.579] * [-549.525] (-552.051) (-551.198) (-552.939) -- 0:00:32
471000 -- (-554.336) [-551.232] (-551.162) (-552.295) * (-551.754) (-552.821) [-555.357] (-551.676) -- 0:00:32
471500 -- (-550.766) (-550.640) [-551.307] (-551.249) * [-549.444] (-551.928) (-551.349) (-551.392) -- 0:00:32
472000 -- (-550.170) (-550.370) [-551.842] (-549.316) * [-553.127] (-550.504) (-555.744) (-549.764) -- 0:00:32
472500 -- [-549.346] (-554.218) (-550.126) (-549.482) * (-550.734) (-550.802) (-551.751) [-550.173] -- 0:00:32
473000 -- (-551.697) [-550.968] (-550.180) (-550.051) * [-551.076] (-550.733) (-552.441) (-550.705) -- 0:00:32
473500 -- [-551.336] (-549.747) (-551.574) (-549.843) * (-553.414) (-554.129) (-552.022) [-550.583] -- 0:00:32
474000 -- (-551.107) (-550.653) [-552.430] (-550.102) * (-551.826) [-554.056] (-552.388) (-550.487) -- 0:00:32
474500 -- (-553.538) (-555.794) [-551.048] (-549.498) * (-554.069) (-549.702) (-554.368) [-549.956] -- 0:00:32
475000 -- [-551.529] (-556.208) (-551.861) (-550.132) * [-554.513] (-551.313) (-551.288) (-551.410) -- 0:00:32
Average standard deviation of split frequencies: 0.007861
475500 -- (-551.246) (-550.649) (-550.442) [-550.378] * (-550.649) (-555.111) [-553.772] (-549.886) -- 0:00:31
476000 -- (-550.417) [-554.106] (-552.333) (-551.730) * [-549.850] (-555.285) (-550.039) (-552.740) -- 0:00:31
476500 -- (-550.042) (-560.258) (-552.157) [-550.411] * (-549.783) (-550.879) (-550.258) [-551.788] -- 0:00:31
477000 -- [-549.437] (-550.023) (-551.916) (-549.864) * (-550.129) [-552.425] (-553.240) (-550.179) -- 0:00:31
477500 -- (-551.730) (-553.907) [-553.069] (-550.440) * (-553.187) (-550.929) (-550.677) [-552.912] -- 0:00:31
478000 -- (-553.589) (-552.842) (-554.675) [-550.206] * (-553.246) [-550.628] (-551.196) (-557.991) -- 0:00:31
478500 -- (-552.132) (-557.420) (-553.095) [-551.971] * (-551.996) [-551.445] (-553.406) (-553.822) -- 0:00:31
479000 -- [-550.886] (-556.303) (-556.300) (-549.971) * (-553.209) (-551.950) (-550.450) [-552.994] -- 0:00:31
479500 -- (-552.687) (-552.387) (-551.238) [-549.979] * (-550.665) [-552.067] (-551.023) (-551.568) -- 0:00:31
480000 -- (-552.217) (-550.748) (-551.620) [-550.262] * (-552.745) (-553.170) [-552.253] (-553.194) -- 0:00:31
Average standard deviation of split frequencies: 0.008275
480500 -- (-552.078) (-554.527) [-550.341] (-555.774) * (-549.916) [-550.181] (-551.759) (-555.452) -- 0:00:31
481000 -- (-550.094) (-555.028) (-551.952) [-553.637] * [-550.245] (-552.573) (-553.520) (-551.205) -- 0:00:31
481500 -- [-550.060] (-555.917) (-552.857) (-552.228) * (-550.196) (-550.590) [-550.758] (-550.801) -- 0:00:31
482000 -- (-550.071) (-557.189) (-550.187) [-555.454] * (-551.327) (-551.754) [-552.502] (-552.299) -- 0:00:31
482500 -- (-553.375) (-550.387) (-549.337) [-550.584] * (-550.633) (-550.335) (-552.346) [-551.468] -- 0:00:31
483000 -- (-552.733) (-550.752) (-549.790) [-550.997] * (-550.230) (-550.394) (-550.457) [-552.030] -- 0:00:31
483500 -- (-549.729) (-550.528) [-550.955] (-549.686) * [-550.337] (-550.323) (-550.781) (-550.412) -- 0:00:30
484000 -- [-549.673] (-554.358) (-550.354) (-551.753) * (-549.831) (-552.104) [-554.547] (-554.818) -- 0:00:30
484500 -- [-550.624] (-551.163) (-549.477) (-550.522) * (-552.235) [-551.104] (-554.144) (-552.930) -- 0:00:30
485000 -- [-552.267] (-552.605) (-551.950) (-552.374) * (-554.873) (-549.832) [-550.902] (-550.019) -- 0:00:30
Average standard deviation of split frequencies: 0.008487
485500 -- (-552.163) (-557.564) [-551.365] (-553.200) * [-553.430] (-552.232) (-553.096) (-558.857) -- 0:00:30
486000 -- (-553.485) (-554.088) [-550.216] (-553.169) * (-550.884) (-552.792) (-550.998) [-550.245] -- 0:00:30
486500 -- (-551.503) (-552.961) [-551.208] (-550.817) * (-550.778) (-552.119) (-551.695) [-552.413] -- 0:00:30
487000 -- (-550.460) (-551.667) [-553.387] (-549.676) * (-550.537) (-554.386) (-557.356) [-552.592] -- 0:00:30
487500 -- [-554.021] (-551.040) (-550.310) (-551.207) * (-550.803) (-551.782) (-555.287) [-552.466] -- 0:00:31
488000 -- (-554.563) [-550.224] (-554.837) (-553.640) * (-550.275) (-551.089) [-552.793] (-554.537) -- 0:00:31
488500 -- (-554.470) [-550.652] (-551.708) (-555.945) * [-551.603] (-551.927) (-555.607) (-550.416) -- 0:00:31
489000 -- [-551.405] (-551.599) (-550.579) (-550.269) * (-550.773) (-551.824) [-556.623] (-552.432) -- 0:00:31
489500 -- (-549.740) (-551.378) [-549.896] (-552.352) * (-550.469) [-551.151] (-552.538) (-553.241) -- 0:00:31
490000 -- (-549.540) [-550.346] (-550.976) (-553.036) * [-550.981] (-549.832) (-556.773) (-550.520) -- 0:00:31
Average standard deviation of split frequencies: 0.008707
490500 -- (-550.698) (-552.032) [-551.503] (-551.346) * (-549.857) (-551.331) (-554.670) [-550.523] -- 0:00:31
491000 -- (-551.269) (-550.410) [-552.405] (-550.234) * (-549.904) (-551.426) [-550.316] (-551.301) -- 0:00:31
491500 -- [-550.701] (-551.182) (-549.990) (-551.455) * (-552.205) [-549.758] (-551.658) (-551.189) -- 0:00:31
492000 -- [-552.323] (-550.282) (-553.115) (-552.309) * (-552.623) [-560.259] (-551.053) (-553.714) -- 0:00:30
492500 -- [-553.338] (-549.366) (-555.504) (-550.886) * (-551.303) (-552.339) [-549.162] (-552.173) -- 0:00:30
493000 -- (-551.190) (-549.934) (-553.521) [-554.725] * [-551.591] (-551.791) (-554.147) (-552.480) -- 0:00:30
493500 -- [-550.459] (-553.073) (-553.809) (-549.815) * (-554.855) [-554.008] (-553.042) (-552.757) -- 0:00:30
494000 -- (-554.135) (-555.252) (-552.414) [-550.504] * (-554.872) (-552.437) [-551.194] (-554.159) -- 0:00:30
494500 -- (-552.014) (-551.888) (-551.916) [-550.846] * (-555.193) (-551.178) (-551.489) [-552.036] -- 0:00:30
495000 -- (-550.753) [-551.632] (-550.124) (-552.308) * [-555.103] (-552.100) (-552.311) (-552.331) -- 0:00:30
Average standard deviation of split frequencies: 0.009314
495500 -- (-550.934) (-550.793) (-551.183) [-552.039] * [-555.413] (-550.241) (-555.577) (-551.539) -- 0:00:30
496000 -- [-550.285] (-549.503) (-550.641) (-558.217) * (-552.937) (-550.591) [-551.969] (-552.061) -- 0:00:30
496500 -- (-550.767) (-552.300) (-551.066) [-552.265] * (-550.710) (-549.652) (-550.887) [-550.268] -- 0:00:30
497000 -- (-549.926) (-552.571) (-550.310) [-552.458] * [-551.645] (-551.425) (-550.693) (-550.312) -- 0:00:30
497500 -- (-550.050) (-551.564) [-550.058] (-551.849) * (-553.567) (-551.611) [-550.638] (-551.744) -- 0:00:30
498000 -- (-550.963) (-554.572) (-550.825) [-553.243] * (-549.892) [-553.917] (-549.769) (-553.733) -- 0:00:30
498500 -- (-554.573) [-551.632] (-553.357) (-551.208) * (-551.078) (-555.316) (-554.431) [-551.847] -- 0:00:30
499000 -- [-554.843] (-551.853) (-549.715) (-553.396) * [-550.284] (-550.408) (-552.967) (-551.757) -- 0:00:30
499500 -- (-556.045) (-551.058) [-552.644] (-552.136) * (-551.771) (-553.124) (-549.411) [-552.863] -- 0:00:30
500000 -- (-551.255) (-550.383) (-550.879) [-552.181] * (-551.115) (-551.157) (-551.694) [-549.586] -- 0:00:30
Average standard deviation of split frequencies: 0.010169
500500 -- (-551.894) (-550.161) (-550.309) [-549.515] * (-550.729) [-549.341] (-551.867) (-549.924) -- 0:00:29
501000 -- (-550.595) [-550.749] (-550.360) (-549.798) * (-550.930) [-551.542] (-550.326) (-551.254) -- 0:00:29
501500 -- (-549.565) (-549.974) (-551.149) [-551.152] * (-550.236) (-550.880) (-550.796) [-550.060] -- 0:00:29
502000 -- (-558.243) (-551.119) [-550.875] (-554.616) * (-553.945) (-551.215) (-551.738) [-549.742] -- 0:00:29
502500 -- [-551.367] (-551.439) (-553.409) (-553.771) * (-553.008) (-551.242) (-552.546) [-550.614] -- 0:00:29
503000 -- (-550.850) (-554.326) (-552.017) [-552.260] * (-552.740) [-552.769] (-551.012) (-550.509) -- 0:00:29
503500 -- (-552.448) (-558.692) (-550.771) [-551.187] * (-556.464) [-549.869] (-555.940) (-555.790) -- 0:00:30
504000 -- [-551.716] (-554.036) (-552.694) (-550.055) * [-555.836] (-553.490) (-552.332) (-553.830) -- 0:00:30
504500 -- (-553.944) [-550.824] (-551.372) (-550.355) * (-550.284) [-551.019] (-552.188) (-553.846) -- 0:00:30
505000 -- [-552.616] (-554.969) (-551.141) (-552.918) * [-554.517] (-554.011) (-553.925) (-555.507) -- 0:00:30
Average standard deviation of split frequencies: 0.010190
505500 -- (-552.675) (-555.463) [-549.839] (-554.055) * (-551.497) (-550.204) [-549.698] (-553.912) -- 0:00:30
506000 -- (-549.448) (-555.961) (-550.155) [-551.433] * [-553.607] (-549.579) (-551.332) (-554.253) -- 0:00:30
506500 -- [-550.905] (-551.916) (-550.477) (-552.522) * (-549.759) (-553.510) (-552.124) [-551.930] -- 0:00:30
507000 -- (-556.279) [-554.709] (-550.805) (-551.550) * (-550.208) [-551.889] (-550.915) (-551.025) -- 0:00:30
507500 -- (-551.613) [-554.378] (-551.828) (-554.476) * (-552.862) [-552.315] (-557.138) (-556.742) -- 0:00:30
508000 -- [-550.418] (-551.492) (-551.189) (-550.463) * (-550.713) (-551.879) [-551.960] (-560.542) -- 0:00:30
508500 -- (-553.359) (-550.179) (-554.027) [-554.442] * (-553.759) [-549.788] (-550.846) (-554.023) -- 0:00:29
509000 -- (-549.512) [-550.191] (-551.268) (-554.849) * (-550.143) (-550.183) [-550.518] (-550.085) -- 0:00:29
509500 -- (-550.868) (-550.533) (-550.406) [-553.784] * [-552.192] (-550.706) (-551.804) (-552.253) -- 0:00:29
510000 -- (-553.219) (-551.877) [-550.093] (-551.051) * (-551.039) [-550.703] (-550.597) (-550.939) -- 0:00:29
Average standard deviation of split frequencies: 0.010847
510500 -- (-553.261) [-554.526] (-554.720) (-550.188) * (-550.549) (-552.929) (-549.915) [-552.039] -- 0:00:29
511000 -- (-551.002) (-558.996) [-549.823] (-553.906) * (-550.350) [-550.316] (-551.645) (-551.857) -- 0:00:29
511500 -- (-551.709) (-551.019) [-550.668] (-553.199) * (-553.879) (-552.074) (-549.766) [-549.611] -- 0:00:29
512000 -- (-550.975) (-552.931) (-549.801) [-552.060] * (-555.373) (-551.462) (-549.578) [-555.338] -- 0:00:29
512500 -- [-552.069] (-553.637) (-555.303) (-552.078) * [-550.815] (-551.294) (-550.203) (-551.376) -- 0:00:29
513000 -- [-554.018] (-553.057) (-559.773) (-557.111) * (-552.864) (-551.502) (-550.526) [-550.530] -- 0:00:29
513500 -- (-551.667) [-550.464] (-556.413) (-549.647) * (-551.476) (-550.815) [-549.697] (-551.173) -- 0:00:29
514000 -- (-552.654) [-549.661] (-552.771) (-552.559) * (-551.459) [-551.772] (-551.206) (-553.077) -- 0:00:29
514500 -- [-552.305] (-551.037) (-550.565) (-551.739) * (-554.387) (-553.137) [-551.508] (-551.809) -- 0:00:29
515000 -- (-550.873) [-550.181] (-550.398) (-550.736) * (-556.229) (-555.487) [-550.295] (-551.993) -- 0:00:29
Average standard deviation of split frequencies: 0.010909
515500 -- (-550.286) [-550.954] (-552.114) (-556.425) * (-552.205) (-554.626) (-552.652) [-551.661] -- 0:00:29
516000 -- [-550.397] (-549.538) (-549.598) (-553.974) * (-551.163) (-549.971) (-554.462) [-551.932] -- 0:00:29
516500 -- (-552.000) (-551.617) (-551.074) [-549.967] * (-551.472) (-551.163) (-553.049) [-553.431] -- 0:00:29
517000 -- [-550.174] (-550.603) (-551.730) (-550.316) * (-551.862) (-552.188) [-551.253] (-550.057) -- 0:00:28
517500 -- (-552.426) [-549.439] (-551.585) (-552.543) * (-553.869) (-550.742) (-549.438) [-552.755] -- 0:00:28
518000 -- (-550.937) [-550.323] (-550.169) (-554.618) * (-551.868) [-550.739] (-549.475) (-550.669) -- 0:00:28
518500 -- (-550.366) [-551.784] (-551.004) (-552.673) * (-554.133) (-553.553) (-553.677) [-552.190] -- 0:00:28
519000 -- (-553.355) [-552.162] (-551.455) (-550.244) * (-551.921) (-551.785) [-552.072] (-551.880) -- 0:00:28
519500 -- [-553.663] (-550.421) (-555.092) (-553.096) * (-551.549) (-555.173) (-549.500) [-553.761] -- 0:00:28
520000 -- (-549.905) (-554.862) [-551.874] (-551.850) * (-554.142) [-553.027] (-549.971) (-551.488) -- 0:00:29
Average standard deviation of split frequencies: 0.011431
520500 -- [-554.070] (-551.961) (-554.434) (-549.642) * (-550.498) [-552.155] (-551.360) (-549.694) -- 0:00:29
521000 -- (-553.741) (-549.439) (-550.919) [-550.699] * (-551.892) [-550.461] (-554.559) (-549.940) -- 0:00:29
521500 -- (-549.584) (-551.607) [-550.436] (-549.948) * (-552.650) (-549.475) [-554.848] (-560.046) -- 0:00:29
522000 -- (-553.691) (-550.361) [-551.402] (-551.798) * (-552.923) (-550.384) (-552.537) [-550.363] -- 0:00:29
522500 -- [-552.937] (-551.369) (-550.728) (-550.353) * (-550.753) (-550.228) (-552.372) [-550.119] -- 0:00:29
523000 -- (-552.598) (-551.764) (-554.067) [-550.261] * [-553.044] (-553.082) (-550.795) (-549.585) -- 0:00:29
523500 -- (-551.101) [-551.278] (-552.833) (-552.914) * [-550.689] (-551.758) (-553.690) (-552.129) -- 0:00:29
524000 -- [-550.603] (-553.407) (-557.780) (-552.384) * (-555.178) (-554.429) (-552.262) [-552.977] -- 0:00:29
524500 -- (-552.442) [-552.824] (-552.883) (-553.128) * (-554.940) (-550.794) (-551.574) [-552.348] -- 0:00:29
525000 -- (-554.055) (-550.271) (-553.589) [-551.457] * (-550.441) (-552.511) (-553.756) [-550.115] -- 0:00:28
Average standard deviation of split frequencies: 0.010491
525500 -- (-556.509) (-550.275) [-550.835] (-552.231) * (-553.414) (-552.208) [-551.020] (-550.283) -- 0:00:28
526000 -- (-553.834) (-550.782) [-551.957] (-552.284) * (-555.178) (-551.758) [-551.584] (-551.570) -- 0:00:28
526500 -- (-549.997) (-551.375) [-550.120] (-552.033) * (-550.696) (-549.444) [-550.301] (-553.438) -- 0:00:28
527000 -- (-550.237) (-552.608) (-551.602) [-551.164] * (-549.261) (-551.496) (-553.476) [-550.968] -- 0:00:28
527500 -- (-551.787) (-558.327) [-551.887] (-550.219) * (-549.910) (-551.431) (-554.964) [-551.791] -- 0:00:28
528000 -- (-550.145) (-560.476) [-550.371] (-549.923) * (-552.194) (-554.958) (-552.698) [-552.971] -- 0:00:28
528500 -- (-552.934) [-551.852] (-552.461) (-551.005) * (-551.946) (-556.063) (-551.641) [-551.433] -- 0:00:28
529000 -- [-551.868] (-562.045) (-551.515) (-549.297) * (-550.655) (-553.493) [-550.545] (-551.155) -- 0:00:28
529500 -- [-552.595] (-558.298) (-550.031) (-553.115) * (-551.911) [-551.677] (-552.204) (-549.894) -- 0:00:28
530000 -- (-550.902) (-552.075) (-551.523) [-551.400] * [-550.939] (-555.049) (-552.378) (-554.613) -- 0:00:28
Average standard deviation of split frequencies: 0.011160
530500 -- [-549.164] (-552.314) (-551.704) (-552.998) * [-550.939] (-553.512) (-551.113) (-550.026) -- 0:00:28
531000 -- [-552.973] (-553.701) (-551.228) (-552.320) * [-551.683] (-556.650) (-550.435) (-549.361) -- 0:00:28
531500 -- (-554.775) (-553.694) [-551.378] (-549.898) * (-549.932) (-557.465) [-552.336] (-552.260) -- 0:00:28
532000 -- (-552.654) (-550.450) (-551.792) [-549.688] * (-550.435) (-550.706) [-550.583] (-551.243) -- 0:00:28
532500 -- (-552.720) (-550.999) [-550.303] (-553.550) * [-550.801] (-551.409) (-553.441) (-551.677) -- 0:00:28
533000 -- (-550.269) (-550.787) [-550.620] (-552.594) * (-553.391) [-550.563] (-552.155) (-553.853) -- 0:00:28
533500 -- (-554.116) (-549.692) [-554.103] (-549.383) * (-556.117) [-549.504] (-553.228) (-551.868) -- 0:00:27
534000 -- (-551.488) (-550.986) (-554.340) [-549.876] * [-550.149] (-552.201) (-555.431) (-554.864) -- 0:00:27
534500 -- [-552.429] (-550.493) (-550.358) (-551.124) * [-552.153] (-557.281) (-552.417) (-551.517) -- 0:00:27
535000 -- (-554.665) [-552.382] (-552.216) (-551.092) * [-549.959] (-558.671) (-554.727) (-551.460) -- 0:00:27
Average standard deviation of split frequencies: 0.011123
535500 -- (-551.607) (-550.659) [-553.266] (-550.534) * [-551.714] (-557.167) (-551.279) (-552.266) -- 0:00:27
536000 -- (-552.659) (-552.996) [-555.361] (-550.276) * (-549.748) (-560.778) (-552.743) [-551.339] -- 0:00:28
536500 -- (-551.566) [-550.932] (-552.331) (-549.889) * (-550.119) [-550.192] (-552.297) (-554.466) -- 0:00:28
537000 -- (-552.898) [-550.812] (-552.726) (-549.561) * (-552.561) [-551.438] (-554.761) (-550.138) -- 0:00:28
537500 -- [-550.190] (-552.004) (-550.497) (-550.439) * [-552.292] (-552.174) (-551.404) (-549.901) -- 0:00:28
538000 -- (-554.019) (-551.596) (-552.334) [-552.391] * [-555.034] (-552.293) (-557.378) (-552.378) -- 0:00:28
538500 -- (-551.661) (-550.835) (-552.011) [-551.319] * [-552.384] (-552.465) (-550.378) (-549.358) -- 0:00:28
539000 -- (-551.090) [-550.290] (-551.833) (-550.257) * (-549.685) [-551.739] (-554.036) (-555.331) -- 0:00:28
539500 -- [-550.966] (-551.615) (-550.391) (-551.450) * [-554.597] (-551.057) (-552.066) (-552.805) -- 0:00:28
540000 -- [-550.557] (-551.608) (-549.558) (-552.341) * (-550.649) (-551.806) (-550.359) [-550.360] -- 0:00:28
Average standard deviation of split frequencies: 0.010517
540500 -- (-551.540) (-552.046) [-550.284] (-559.821) * (-553.413) [-553.168] (-552.896) (-553.952) -- 0:00:28
541000 -- (-552.362) (-549.366) (-551.672) [-560.197] * [-554.868] (-552.906) (-551.129) (-553.660) -- 0:00:27
541500 -- (-552.416) (-551.068) [-550.197] (-556.080) * (-550.208) (-555.901) [-550.542] (-551.362) -- 0:00:27
542000 -- (-550.667) (-549.809) [-550.729] (-553.404) * [-550.127] (-552.676) (-551.082) (-555.041) -- 0:00:27
542500 -- (-553.996) [-550.049] (-550.912) (-549.953) * (-551.632) (-552.843) (-552.489) [-549.557] -- 0:00:27
543000 -- (-550.691) (-552.247) (-553.125) [-549.646] * [-553.352] (-551.100) (-550.744) (-552.315) -- 0:00:27
543500 -- [-550.749] (-550.676) (-552.001) (-553.262) * (-552.335) (-554.525) [-553.060] (-551.576) -- 0:00:27
544000 -- [-549.932] (-551.015) (-554.283) (-551.294) * (-557.435) (-550.531) [-552.606] (-554.269) -- 0:00:27
544500 -- (-551.961) [-549.862] (-557.089) (-554.549) * (-551.526) [-550.588] (-553.221) (-552.539) -- 0:00:27
545000 -- (-553.084) (-554.579) [-552.640] (-555.936) * (-549.457) (-549.506) [-550.826] (-556.354) -- 0:00:27
Average standard deviation of split frequencies: 0.011122
545500 -- (-553.051) (-552.350) (-551.017) [-558.287] * (-551.973) (-551.302) (-550.368) [-551.929] -- 0:00:27
546000 -- [-549.895] (-550.834) (-550.713) (-550.895) * (-550.226) (-550.412) [-554.148] (-550.339) -- 0:00:27
546500 -- (-555.941) (-553.495) (-550.665) [-551.832] * (-549.858) (-553.071) [-553.037] (-554.089) -- 0:00:27
547000 -- (-553.419) (-551.743) (-550.081) [-554.717] * (-549.524) [-550.901] (-551.835) (-554.337) -- 0:00:27
547500 -- (-553.438) [-553.067] (-550.474) (-554.924) * (-551.439) [-550.789] (-551.313) (-554.356) -- 0:00:27
548000 -- (-552.775) (-553.093) [-550.343] (-550.653) * [-550.838] (-552.078) (-552.815) (-550.492) -- 0:00:27
548500 -- [-552.894] (-550.576) (-550.133) (-552.331) * (-550.928) [-551.620] (-551.807) (-551.616) -- 0:00:27
549000 -- (-552.806) (-549.967) (-551.356) [-551.692] * (-552.017) [-553.337] (-554.982) (-553.686) -- 0:00:27
549500 -- [-550.806] (-550.406) (-550.041) (-550.298) * (-552.135) (-553.349) (-551.411) [-549.892] -- 0:00:27
550000 -- [-551.992] (-551.016) (-553.764) (-549.382) * [-551.562] (-551.914) (-551.571) (-549.665) -- 0:00:27
Average standard deviation of split frequencies: 0.010166
550500 -- [-550.311] (-550.478) (-549.281) (-553.142) * (-553.791) [-550.670] (-551.626) (-551.122) -- 0:00:26
551000 -- (-556.244) (-552.130) (-552.458) [-554.108] * (-550.562) [-551.627] (-552.844) (-551.229) -- 0:00:26
551500 -- (-553.250) (-556.128) (-552.116) [-553.348] * (-552.215) (-553.107) (-553.530) [-550.983] -- 0:00:26
552000 -- (-550.827) [-551.285] (-550.675) (-553.125) * (-549.563) [-553.697] (-552.561) (-551.647) -- 0:00:26
552500 -- (-552.821) (-552.170) (-551.115) [-549.903] * [-550.500] (-551.406) (-553.295) (-550.666) -- 0:00:27
553000 -- (-551.106) (-552.333) (-552.834) [-551.966] * [-549.954] (-550.832) (-551.691) (-550.428) -- 0:00:27
553500 -- (-549.429) (-550.501) [-551.956] (-553.633) * (-551.492) (-550.055) (-553.399) [-550.500] -- 0:00:27
554000 -- (-553.455) (-553.936) (-557.425) [-554.700] * (-550.667) (-549.297) [-551.204] (-552.997) -- 0:00:27
554500 -- [-553.832] (-550.732) (-552.945) (-552.185) * (-551.702) (-552.994) (-551.064) [-551.141] -- 0:00:27
555000 -- (-552.846) [-550.921] (-551.444) (-551.404) * (-555.473) [-550.469] (-553.773) (-552.270) -- 0:00:27
Average standard deviation of split frequencies: 0.010231
555500 -- (-553.257) (-549.910) (-552.348) [-552.856] * (-551.544) [-549.603] (-555.748) (-555.851) -- 0:00:27
556000 -- (-555.105) (-553.233) [-550.395] (-550.810) * [-550.286] (-550.229) (-553.047) (-552.319) -- 0:00:27
556500 -- (-551.727) [-554.904] (-550.929) (-551.154) * (-551.700) [-549.537] (-551.779) (-552.933) -- 0:00:27
557000 -- (-554.734) (-550.434) (-552.281) [-551.053] * (-552.475) (-550.359) [-551.754] (-552.119) -- 0:00:27
557500 -- (-554.294) (-554.470) [-552.129] (-552.650) * [-552.277] (-550.578) (-552.451) (-552.094) -- 0:00:26
558000 -- (-551.870) (-552.120) (-554.210) [-549.399] * (-551.508) (-550.479) [-550.544] (-552.278) -- 0:00:26
558500 -- (-551.654) (-549.552) [-553.832] (-551.163) * [-554.943] (-550.179) (-550.295) (-551.236) -- 0:00:26
559000 -- [-551.094] (-553.775) (-549.965) (-551.630) * [-550.123] (-551.984) (-550.021) (-549.771) -- 0:00:26
559500 -- [-549.186] (-554.159) (-551.257) (-550.240) * (-552.401) (-550.565) (-554.074) [-550.919] -- 0:00:26
560000 -- (-549.389) (-551.548) (-550.801) [-550.078] * (-553.826) [-550.458] (-550.807) (-550.131) -- 0:00:26
Average standard deviation of split frequencies: 0.010146
560500 -- (-554.993) (-550.817) (-552.671) [-550.906] * [-552.350] (-553.753) (-550.085) (-550.815) -- 0:00:26
561000 -- (-556.482) [-551.666] (-554.173) (-549.555) * (-558.197) [-552.002] (-550.270) (-550.232) -- 0:00:26
561500 -- (-555.903) [-550.673] (-550.765) (-549.487) * (-554.001) (-552.800) [-551.022] (-555.120) -- 0:00:26
562000 -- (-553.757) (-551.134) (-551.072) [-550.669] * (-555.598) [-551.878] (-551.022) (-551.308) -- 0:00:26
562500 -- (-551.678) (-552.255) (-550.759) [-550.670] * (-552.088) [-552.346] (-549.863) (-552.008) -- 0:00:26
563000 -- (-552.185) (-549.783) (-555.206) [-550.459] * (-551.636) (-554.265) (-549.558) [-551.012] -- 0:00:26
563500 -- (-551.579) (-549.561) (-551.111) [-549.676] * [-552.165] (-550.081) (-551.551) (-551.008) -- 0:00:26
564000 -- (-550.579) (-549.913) [-549.311] (-549.741) * (-554.278) (-552.719) (-549.807) [-551.130] -- 0:00:26
564500 -- (-558.223) [-552.516] (-549.818) (-550.152) * (-551.559) (-554.020) (-552.016) [-552.223] -- 0:00:26
565000 -- (-553.381) [-549.808] (-549.738) (-549.760) * (-551.739) [-555.053] (-550.613) (-553.961) -- 0:00:26
Average standard deviation of split frequencies: 0.010307
565500 -- [-551.097] (-549.221) (-550.984) (-551.359) * (-553.014) (-550.100) [-551.589] (-552.729) -- 0:00:26
566000 -- (-550.326) [-550.307] (-551.694) (-552.413) * (-551.841) (-550.633) (-551.838) [-554.901] -- 0:00:26
566500 -- (-550.364) [-550.059] (-550.602) (-551.312) * (-549.165) (-554.162) (-553.507) [-551.696] -- 0:00:26
567000 -- (-549.740) [-549.840] (-550.737) (-552.951) * [-552.950] (-555.633) (-551.725) (-549.605) -- 0:00:25
567500 -- (-550.150) (-551.986) (-553.428) [-556.071] * (-552.906) [-553.612] (-550.071) (-552.249) -- 0:00:25
568000 -- (-551.017) (-552.029) [-552.317] (-554.184) * [-550.333] (-551.931) (-551.883) (-550.838) -- 0:00:25
568500 -- (-556.435) (-554.329) (-553.341) [-551.719] * (-551.660) [-550.851] (-552.801) (-555.012) -- 0:00:25
569000 -- [-554.011] (-556.857) (-553.925) (-551.832) * (-550.600) [-549.922] (-551.246) (-550.829) -- 0:00:25
569500 -- (-550.487) [-553.666] (-553.582) (-550.942) * (-553.839) [-550.535] (-549.516) (-553.816) -- 0:00:26
570000 -- (-557.629) (-551.458) [-552.618] (-553.132) * [-550.639] (-553.094) (-549.936) (-549.246) -- 0:00:26
Average standard deviation of split frequencies: 0.010188
570500 -- (-551.800) (-551.302) [-554.001] (-550.777) * (-552.385) [-550.560] (-554.377) (-550.262) -- 0:00:26
571000 -- (-551.312) (-553.954) [-551.948] (-551.714) * [-551.067] (-549.715) (-551.260) (-551.398) -- 0:00:26
571500 -- [-552.363] (-552.522) (-549.793) (-554.032) * [-552.582] (-551.873) (-552.269) (-550.386) -- 0:00:26
572000 -- (-553.232) [-550.634] (-552.461) (-553.851) * (-553.505) [-552.565] (-551.850) (-550.914) -- 0:00:26
572500 -- [-555.691] (-551.549) (-552.749) (-555.430) * (-554.507) [-553.112] (-549.976) (-551.839) -- 0:00:26
573000 -- (-549.727) (-553.225) (-550.471) [-551.691] * (-552.224) [-550.268] (-549.506) (-549.646) -- 0:00:26
573500 -- (-549.835) (-549.442) [-550.211] (-550.903) * (-554.679) (-550.065) [-551.429] (-550.504) -- 0:00:26
574000 -- [-552.743] (-552.737) (-549.472) (-549.879) * (-556.062) (-549.708) [-550.625] (-549.501) -- 0:00:25
574500 -- [-552.810] (-552.452) (-551.648) (-549.924) * (-550.057) (-551.001) [-551.238] (-551.709) -- 0:00:25
575000 -- (-553.751) (-554.492) [-550.095] (-550.790) * (-551.672) (-550.336) (-551.710) [-553.052] -- 0:00:25
Average standard deviation of split frequencies: 0.010128
575500 -- (-556.480) [-551.341] (-552.825) (-554.560) * (-552.203) [-549.488] (-551.609) (-552.139) -- 0:00:25
576000 -- (-553.536) [-551.427] (-550.776) (-552.062) * (-551.558) [-553.286] (-551.747) (-552.412) -- 0:00:25
576500 -- (-550.507) (-551.986) (-551.166) [-551.836] * (-550.540) [-551.340] (-550.956) (-551.626) -- 0:00:25
577000 -- [-552.829] (-549.809) (-551.077) (-555.677) * [-549.867] (-552.523) (-553.791) (-550.865) -- 0:00:25
577500 -- (-553.471) (-550.633) (-550.617) [-552.986] * (-553.857) (-552.547) [-551.375] (-552.852) -- 0:00:25
578000 -- (-550.677) [-551.452] (-551.380) (-550.310) * (-554.405) [-551.774] (-552.129) (-554.584) -- 0:00:25
578500 -- [-558.669] (-554.863) (-552.558) (-551.206) * [-550.033] (-552.138) (-550.447) (-555.403) -- 0:00:25
579000 -- [-554.277] (-553.605) (-552.601) (-554.640) * [-552.822] (-552.734) (-550.893) (-552.205) -- 0:00:25
579500 -- [-551.262] (-550.915) (-553.900) (-555.633) * (-556.598) [-550.524] (-556.029) (-553.119) -- 0:00:25
580000 -- (-552.236) (-549.802) (-552.499) [-550.004] * [-550.989] (-550.832) (-550.223) (-553.608) -- 0:00:25
Average standard deviation of split frequencies: 0.009526
580500 -- (-552.621) (-552.139) [-549.655] (-553.480) * (-549.621) (-552.838) [-551.077] (-553.054) -- 0:00:25
581000 -- (-551.541) (-551.078) (-550.115) [-549.983] * (-551.573) [-549.997] (-553.938) (-550.862) -- 0:00:25
581500 -- (-551.338) (-555.360) (-549.994) [-549.410] * (-552.670) (-549.638) [-551.751] (-550.356) -- 0:00:25
582000 -- (-555.246) [-552.768] (-549.585) (-552.804) * (-552.186) (-549.446) [-550.195] (-550.520) -- 0:00:25
582500 -- (-552.128) (-554.929) [-549.650] (-551.479) * (-550.608) (-550.803) (-551.551) [-550.473] -- 0:00:25
583000 -- (-549.726) (-556.015) (-551.156) [-551.765] * (-553.630) (-551.286) [-549.684] (-554.388) -- 0:00:25
583500 -- (-550.549) (-554.153) (-553.675) [-551.805] * (-552.746) [-549.883] (-556.575) (-552.173) -- 0:00:24
584000 -- (-554.832) (-550.785) [-552.661] (-550.458) * [-552.717] (-552.367) (-551.224) (-552.342) -- 0:00:24
584500 -- (-549.431) (-552.387) [-550.617] (-550.542) * (-552.641) (-558.058) (-551.404) [-552.034] -- 0:00:24
585000 -- (-549.507) [-550.546] (-551.530) (-553.551) * (-556.484) (-552.616) (-552.998) [-549.716] -- 0:00:24
Average standard deviation of split frequencies: 0.009492
585500 -- (-553.827) [-553.569] (-551.232) (-551.936) * (-556.309) (-550.348) [-550.882] (-551.229) -- 0:00:24
586000 -- (-552.479) (-550.882) (-553.113) [-551.918] * [-552.307] (-550.477) (-549.924) (-549.785) -- 0:00:24
586500 -- (-552.718) [-550.352] (-553.862) (-551.213) * (-558.146) [-551.052] (-550.291) (-549.773) -- 0:00:25
587000 -- (-554.757) (-552.986) (-554.360) [-550.884] * (-549.253) (-550.558) (-552.555) [-549.918] -- 0:00:25
587500 -- (-551.363) [-549.841] (-552.538) (-556.385) * (-551.323) (-550.062) (-559.256) [-552.962] -- 0:00:25
588000 -- (-550.128) (-551.825) (-549.844) [-552.779] * [-549.899] (-551.291) (-550.121) (-553.605) -- 0:00:25
588500 -- [-550.794] (-557.241) (-554.348) (-554.679) * (-554.086) (-553.135) [-552.168] (-552.197) -- 0:00:25
589000 -- (-554.572) (-556.290) [-552.636] (-554.438) * (-549.681) (-553.069) (-550.963) [-550.120] -- 0:00:25
589500 -- (-556.453) [-555.853] (-551.009) (-552.877) * (-556.581) (-551.070) (-549.632) [-549.704] -- 0:00:25
590000 -- [-551.428] (-551.388) (-549.283) (-551.121) * [-555.782] (-551.221) (-549.510) (-552.604) -- 0:00:25
Average standard deviation of split frequencies: 0.009950
590500 -- (-551.957) (-554.512) [-550.398] (-550.438) * (-551.871) (-554.671) (-550.615) [-550.801] -- 0:00:24
591000 -- [-551.351] (-549.910) (-551.364) (-553.696) * (-549.895) (-549.733) (-552.103) [-553.597] -- 0:00:24
591500 -- (-551.864) [-553.753] (-553.737) (-551.809) * (-550.304) [-550.659] (-552.859) (-552.831) -- 0:00:24
592000 -- [-550.064] (-554.109) (-550.245) (-549.739) * (-556.965) [-553.773] (-553.871) (-550.362) -- 0:00:24
592500 -- (-551.742) (-552.681) (-555.164) [-551.431] * (-552.123) (-550.524) [-550.510] (-549.752) -- 0:00:24
593000 -- (-549.333) (-551.282) [-551.500] (-551.601) * (-551.193) (-551.355) [-550.490] (-555.396) -- 0:00:24
593500 -- (-551.230) (-552.556) (-550.275) [-549.619] * (-554.496) [-553.041] (-550.647) (-555.463) -- 0:00:24
594000 -- (-556.361) [-554.162] (-549.503) (-552.207) * (-551.232) (-552.090) [-551.927] (-551.705) -- 0:00:24
594500 -- (-555.542) (-549.588) (-549.282) [-549.493] * (-553.431) (-550.292) (-553.712) [-553.135] -- 0:00:24
595000 -- [-556.225] (-551.456) (-549.615) (-549.873) * (-551.766) (-551.024) (-551.427) [-551.590] -- 0:00:24
Average standard deviation of split frequencies: 0.009333
595500 -- [-553.009] (-552.280) (-550.346) (-551.946) * [-554.054] (-551.093) (-549.835) (-553.553) -- 0:00:24
596000 -- (-551.515) [-551.977] (-549.445) (-550.665) * (-552.324) [-554.585] (-549.765) (-552.989) -- 0:00:24
596500 -- (-551.292) [-551.574] (-551.799) (-551.591) * (-552.078) [-549.307] (-550.625) (-553.540) -- 0:00:24
597000 -- [-549.603] (-550.558) (-550.844) (-554.793) * (-558.244) (-551.786) (-550.283) [-550.942] -- 0:00:24
597500 -- [-552.225] (-550.860) (-549.349) (-551.425) * (-553.393) (-551.559) [-550.651] (-549.978) -- 0:00:24
598000 -- (-551.515) (-550.357) (-549.477) [-551.810] * [-549.658] (-553.478) (-553.347) (-551.485) -- 0:00:24
598500 -- (-551.982) [-552.970] (-550.403) (-553.133) * (-549.697) (-553.471) [-550.997] (-550.163) -- 0:00:24
599000 -- (-551.438) (-550.953) [-552.760] (-549.753) * [-549.458] (-550.404) (-554.148) (-550.908) -- 0:00:24
599500 -- [-550.034] (-551.580) (-551.621) (-550.529) * (-550.673) (-550.068) (-550.541) [-550.720] -- 0:00:24
600000 -- [-549.310] (-552.886) (-549.404) (-551.192) * (-549.886) (-552.240) (-553.033) [-549.527] -- 0:00:24
Average standard deviation of split frequencies: 0.008947
600500 -- (-550.959) (-555.327) (-553.464) [-549.543] * [-552.225] (-551.506) (-551.334) (-553.996) -- 0:00:23
601000 -- (-551.688) [-552.528] (-551.526) (-549.940) * (-549.959) [-552.121] (-552.925) (-549.751) -- 0:00:23
601500 -- (-551.803) (-551.427) (-553.437) [-550.755] * [-551.017] (-550.417) (-552.639) (-549.485) -- 0:00:23
602000 -- (-552.364) (-552.537) [-551.275] (-551.155) * (-549.359) [-551.214] (-551.773) (-553.451) -- 0:00:23
602500 -- [-552.554] (-550.390) (-549.429) (-550.145) * (-549.701) [-549.113] (-550.401) (-552.821) -- 0:00:23
603000 -- [-552.673] (-551.415) (-551.174) (-554.776) * (-550.284) (-549.659) [-550.023] (-552.922) -- 0:00:24
603500 -- (-553.982) [-550.801] (-550.581) (-550.664) * (-553.023) (-551.217) (-549.692) [-551.467] -- 0:00:24
604000 -- (-554.977) (-551.920) [-550.728] (-549.414) * (-552.023) [-549.475] (-551.710) (-551.346) -- 0:00:24
604500 -- [-553.715] (-551.926) (-550.576) (-550.409) * (-549.095) (-550.455) [-549.750] (-549.917) -- 0:00:24
605000 -- (-554.055) (-551.799) (-549.898) [-549.202] * (-551.465) [-551.816] (-552.365) (-551.801) -- 0:00:24
Average standard deviation of split frequencies: 0.008712
605500 -- (-551.849) [-551.603] (-551.322) (-551.269) * [-553.803] (-551.462) (-553.026) (-551.243) -- 0:00:24
606000 -- (-556.869) (-551.203) (-550.739) [-550.270] * (-550.885) (-552.002) [-551.236] (-552.623) -- 0:00:24
606500 -- (-550.307) (-552.059) (-550.794) [-549.353] * (-550.495) [-550.708] (-555.408) (-553.525) -- 0:00:24
607000 -- (-551.250) [-549.711] (-553.787) (-550.595) * (-550.699) (-551.048) (-552.423) [-550.142] -- 0:00:23
607500 -- (-553.201) [-551.985] (-550.633) (-552.841) * [-551.409] (-549.237) (-551.425) (-550.673) -- 0:00:23
608000 -- (-552.255) [-552.822] (-552.903) (-557.954) * (-553.605) (-549.252) (-550.196) [-550.195] -- 0:00:23
608500 -- [-549.301] (-549.757) (-551.531) (-553.500) * (-557.126) [-549.790] (-552.252) (-551.342) -- 0:00:23
609000 -- [-551.181] (-549.528) (-553.203) (-552.194) * (-551.124) (-552.818) [-550.934] (-551.356) -- 0:00:23
609500 -- [-551.103] (-550.833) (-551.107) (-552.829) * (-554.327) [-551.924] (-551.606) (-550.648) -- 0:00:23
610000 -- (-554.444) (-553.318) (-552.794) [-551.880] * (-549.799) (-550.279) [-552.294] (-552.942) -- 0:00:23
Average standard deviation of split frequencies: 0.009006
610500 -- (-553.206) (-550.672) (-551.705) [-552.352] * (-552.152) (-549.263) (-552.464) [-550.961] -- 0:00:23
611000 -- [-550.993] (-549.927) (-551.358) (-551.362) * (-555.138) (-551.147) [-550.896] (-550.164) -- 0:00:23
611500 -- (-550.535) (-551.094) (-552.092) [-550.582] * (-550.404) (-550.354) (-549.683) [-553.664] -- 0:00:23
612000 -- (-550.517) [-554.132] (-550.519) (-552.166) * (-552.757) (-553.796) (-551.378) [-553.233] -- 0:00:23
612500 -- (-554.321) (-550.483) [-550.948] (-550.214) * [-556.232] (-554.205) (-552.107) (-551.332) -- 0:00:23
613000 -- (-552.672) (-553.270) (-552.437) [-549.733] * (-553.855) (-554.995) (-551.345) [-551.735] -- 0:00:23
613500 -- (-555.148) (-554.088) (-553.924) [-551.868] * (-553.146) (-552.626) [-550.637] (-550.522) -- 0:00:23
614000 -- (-553.310) (-551.840) [-550.993] (-549.921) * [-551.113] (-551.811) (-550.610) (-549.695) -- 0:00:23
614500 -- (-551.570) (-551.564) [-550.717] (-550.680) * (-551.315) (-555.221) (-554.510) [-551.761] -- 0:00:23
615000 -- [-554.568] (-553.767) (-551.393) (-551.328) * [-551.376] (-556.359) (-555.137) (-551.425) -- 0:00:23
Average standard deviation of split frequencies: 0.009438
615500 -- (-556.216) [-552.499] (-550.803) (-554.824) * [-550.572] (-551.473) (-554.367) (-551.456) -- 0:00:23
616000 -- [-550.209] (-550.249) (-553.797) (-553.138) * (-553.165) (-550.701) [-554.024] (-551.674) -- 0:00:23
616500 -- (-549.607) (-551.076) (-557.025) [-553.863] * (-552.981) (-550.969) (-551.698) [-553.967] -- 0:00:23
617000 -- (-557.343) [-550.172] (-551.837) (-550.348) * (-555.274) [-554.970] (-551.797) (-553.547) -- 0:00:22
617500 -- (-554.291) (-555.136) (-560.907) [-550.783] * (-551.877) (-553.890) (-550.940) [-550.564] -- 0:00:22
618000 -- [-551.081] (-555.472) (-556.378) (-555.549) * (-549.582) [-550.494] (-553.835) (-552.086) -- 0:00:22
618500 -- (-549.685) (-551.482) [-552.562] (-555.090) * (-549.371) (-550.555) [-551.000] (-554.240) -- 0:00:22
619000 -- (-551.924) (-554.876) [-556.810] (-553.229) * [-551.865] (-552.801) (-552.887) (-550.827) -- 0:00:22
619500 -- (-552.647) (-552.501) (-556.780) [-549.775] * (-553.031) (-550.215) (-549.494) [-550.391] -- 0:00:22
620000 -- (-553.282) (-550.367) (-556.089) [-550.763] * (-552.243) (-550.197) [-550.235] (-550.509) -- 0:00:23
Average standard deviation of split frequencies: 0.008861
620500 -- (-552.853) (-551.327) [-551.333] (-551.773) * (-554.407) [-551.991] (-552.445) (-554.042) -- 0:00:23
621000 -- [-552.796] (-550.057) (-550.232) (-550.909) * (-550.707) [-555.094] (-552.009) (-552.188) -- 0:00:23
621500 -- (-552.481) (-553.878) (-551.118) [-550.583] * [-551.544] (-552.312) (-556.188) (-550.620) -- 0:00:23
622000 -- (-553.955) (-551.325) [-549.226] (-550.165) * (-555.610) (-551.772) (-550.172) [-550.898] -- 0:00:23
622500 -- (-552.452) [-550.979] (-551.238) (-552.890) * [-551.140] (-551.367) (-551.670) (-551.582) -- 0:00:23
623000 -- (-553.908) [-556.061] (-551.291) (-550.317) * [-550.343] (-556.263) (-552.369) (-551.570) -- 0:00:22
623500 -- (-553.053) (-550.933) (-549.703) [-550.088] * (-552.036) [-552.433] (-556.097) (-549.859) -- 0:00:22
624000 -- [-553.639] (-550.289) (-549.317) (-550.203) * [-552.472] (-552.408) (-551.794) (-556.464) -- 0:00:22
624500 -- (-553.555) [-552.858] (-553.175) (-554.302) * (-551.822) (-555.420) [-551.064] (-554.913) -- 0:00:22
625000 -- (-553.121) (-558.799) (-551.848) [-550.385] * [-555.863] (-553.654) (-553.171) (-554.059) -- 0:00:22
Average standard deviation of split frequencies: 0.008233
625500 -- (-551.792) (-555.661) [-550.310] (-550.350) * (-552.131) [-553.338] (-557.968) (-553.356) -- 0:00:22
626000 -- (-550.940) [-552.232] (-552.238) (-550.084) * [-550.894] (-552.242) (-550.187) (-549.519) -- 0:00:22
626500 -- (-557.101) [-552.644] (-553.519) (-551.718) * (-551.258) (-550.152) (-551.687) [-550.975] -- 0:00:22
627000 -- [-551.818] (-550.937) (-549.641) (-550.306) * [-554.722] (-552.087) (-553.390) (-550.703) -- 0:00:22
627500 -- (-555.219) (-555.640) (-551.102) [-552.005] * (-553.354) (-552.399) (-552.852) [-551.379] -- 0:00:22
628000 -- (-550.083) (-553.924) (-553.858) [-550.844] * (-553.628) (-551.038) [-550.011] (-550.350) -- 0:00:22
628500 -- (-551.124) [-550.508] (-550.559) (-550.331) * (-554.425) (-551.555) (-549.818) [-551.865] -- 0:00:22
629000 -- (-549.535) [-550.461] (-550.507) (-551.123) * [-549.767] (-552.180) (-550.696) (-551.732) -- 0:00:22
629500 -- (-550.132) (-551.504) (-550.360) [-551.655] * [-550.543] (-552.381) (-550.642) (-555.213) -- 0:00:22
630000 -- (-549.455) (-552.796) [-551.395] (-554.450) * (-549.671) (-550.854) [-550.500] (-550.679) -- 0:00:22
Average standard deviation of split frequencies: 0.008571
630500 -- (-552.826) [-553.080] (-550.410) (-552.851) * (-549.392) (-550.294) [-550.580] (-550.907) -- 0:00:22
631000 -- [-551.162] (-553.388) (-554.070) (-553.321) * [-549.992] (-549.673) (-552.602) (-550.529) -- 0:00:22
631500 -- (-557.864) (-550.431) [-550.755] (-550.056) * (-549.530) (-551.474) (-551.430) [-552.659] -- 0:00:22
632000 -- (-556.162) (-551.460) (-552.873) [-552.746] * (-549.613) (-555.321) [-551.799] (-551.370) -- 0:00:22
632500 -- [-554.780] (-550.860) (-553.359) (-553.553) * (-551.483) (-553.611) (-552.101) [-550.395] -- 0:00:22
633000 -- (-551.346) [-551.202] (-551.678) (-553.041) * [-550.963] (-550.275) (-551.441) (-552.359) -- 0:00:22
633500 -- (-552.400) (-550.060) [-551.743] (-553.386) * (-549.532) (-550.864) [-551.069] (-549.715) -- 0:00:21
634000 -- (-552.324) [-551.420] (-551.129) (-553.295) * (-550.014) (-553.964) [-554.825] (-556.992) -- 0:00:21
634500 -- [-550.387] (-551.114) (-551.972) (-550.304) * (-551.417) (-553.164) [-551.798] (-552.206) -- 0:00:21
635000 -- [-549.501] (-552.221) (-554.473) (-550.181) * (-553.518) (-553.792) (-552.159) [-553.673] -- 0:00:21
Average standard deviation of split frequencies: 0.008549
635500 -- (-551.630) (-552.819) (-550.475) [-550.394] * [-552.678] (-552.345) (-551.310) (-554.352) -- 0:00:21
636000 -- (-550.884) (-551.852) [-550.685] (-551.299) * [-549.932] (-550.208) (-553.536) (-551.868) -- 0:00:21
636500 -- (-551.050) (-551.586) [-551.895] (-551.838) * [-549.867] (-550.551) (-553.343) (-551.051) -- 0:00:21
637000 -- (-553.560) [-552.977] (-550.198) (-553.709) * (-551.501) [-551.291] (-559.152) (-551.758) -- 0:00:22
637500 -- (-550.459) [-553.286] (-549.848) (-551.001) * [-550.758] (-550.892) (-553.660) (-552.335) -- 0:00:22
638000 -- (-553.353) [-551.006] (-550.168) (-553.953) * [-552.934] (-550.479) (-552.750) (-551.008) -- 0:00:22
638500 -- (-553.884) [-552.013] (-549.495) (-553.146) * (-551.931) (-549.716) [-553.995] (-550.913) -- 0:00:22
639000 -- (-551.871) [-551.276] (-549.935) (-551.629) * (-552.404) (-549.936) (-552.575) [-550.765] -- 0:00:22
639500 -- (-550.258) (-553.625) (-552.973) [-551.607] * (-550.559) [-549.887] (-554.869) (-551.731) -- 0:00:21
640000 -- [-550.162] (-551.500) (-552.769) (-550.518) * (-551.854) (-550.356) [-552.063] (-551.749) -- 0:00:21
Average standard deviation of split frequencies: 0.008682
640500 -- [-552.779] (-550.236) (-550.878) (-552.437) * (-550.938) [-554.767] (-550.666) (-551.536) -- 0:00:21
641000 -- (-550.080) [-551.204] (-551.732) (-552.512) * (-553.736) (-552.746) [-550.155] (-552.231) -- 0:00:21
641500 -- (-553.109) (-551.689) (-550.211) [-550.237] * [-554.264] (-550.793) (-550.203) (-552.675) -- 0:00:21
642000 -- (-550.375) [-553.293] (-553.747) (-552.642) * [-551.628] (-552.376) (-549.908) (-557.205) -- 0:00:21
642500 -- (-550.164) [-551.163] (-552.136) (-556.989) * (-550.511) [-552.560] (-550.091) (-555.213) -- 0:00:21
643000 -- (-556.297) (-549.774) [-550.417] (-551.387) * [-557.659] (-557.659) (-550.762) (-552.491) -- 0:00:21
643500 -- [-550.846] (-549.606) (-550.977) (-553.672) * (-551.319) (-551.869) [-551.234] (-550.791) -- 0:00:21
644000 -- (-550.700) [-549.987] (-549.574) (-550.743) * (-550.012) (-553.762) (-550.475) [-550.380] -- 0:00:21
644500 -- (-551.468) (-553.514) [-550.185] (-551.435) * (-554.910) [-551.471] (-551.888) (-551.021) -- 0:00:21
645000 -- (-552.598) [-550.543] (-549.801) (-551.871) * (-553.940) (-560.215) (-551.974) [-550.979] -- 0:00:21
Average standard deviation of split frequencies: 0.008076
645500 -- (-552.802) (-551.365) (-551.160) [-550.326] * (-554.052) [-552.827] (-554.194) (-553.436) -- 0:00:21
646000 -- [-552.488] (-552.655) (-550.292) (-552.694) * (-550.396) (-551.668) (-554.542) [-553.406] -- 0:00:21
646500 -- (-553.369) (-551.122) (-552.439) [-553.579] * (-550.710) (-551.785) (-552.178) [-550.549] -- 0:00:21
647000 -- (-551.690) [-550.262] (-554.013) (-551.370) * [-550.459] (-550.806) (-553.515) (-551.869) -- 0:00:21
647500 -- [-549.765] (-550.643) (-550.342) (-552.272) * (-549.912) (-553.513) (-549.939) [-549.789] -- 0:00:21
648000 -- (-551.137) (-551.028) (-550.496) [-552.916] * (-559.105) [-559.056] (-550.227) (-553.753) -- 0:00:21
648500 -- (-550.571) (-551.972) [-550.538] (-558.402) * (-557.622) (-552.332) (-553.878) [-550.716] -- 0:00:21
649000 -- (-551.361) [-553.014] (-550.429) (-551.383) * (-556.576) (-553.736) (-549.871) [-550.372] -- 0:00:21
649500 -- [-550.512] (-552.984) (-551.731) (-554.954) * (-549.869) (-552.078) (-552.033) [-551.603] -- 0:00:21
650000 -- (-550.224) (-550.213) [-551.592] (-550.201) * (-552.034) (-552.221) (-551.276) [-550.030] -- 0:00:21
Average standard deviation of split frequencies: 0.008308
650500 -- (-551.008) (-552.400) [-550.469] (-553.784) * (-550.583) [-550.886] (-551.766) (-553.779) -- 0:00:20
651000 -- (-551.046) [-552.370] (-550.399) (-553.093) * [-552.081] (-555.328) (-552.855) (-554.501) -- 0:00:20
651500 -- (-549.932) [-551.407] (-550.877) (-553.115) * (-552.217) (-551.564) [-552.363] (-551.533) -- 0:00:20
652000 -- (-555.213) (-551.247) [-553.247] (-551.946) * [-551.551] (-552.124) (-552.188) (-550.390) -- 0:00:20
652500 -- (-551.941) [-551.252] (-555.453) (-550.121) * (-554.225) (-553.790) (-555.294) [-549.764] -- 0:00:20
653000 -- [-551.300] (-550.019) (-556.350) (-549.462) * (-555.521) [-552.641] (-553.436) (-550.629) -- 0:00:20
653500 -- (-551.111) (-549.518) (-552.876) [-549.633] * (-552.565) (-555.137) [-551.656] (-550.112) -- 0:00:21
654000 -- (-549.472) (-551.382) [-555.114] (-550.550) * (-550.746) (-554.517) (-551.023) [-552.067] -- 0:00:21
654500 -- [-551.196] (-552.435) (-551.874) (-550.995) * (-551.692) [-552.749] (-554.504) (-552.134) -- 0:00:21
655000 -- [-549.971] (-552.408) (-552.959) (-549.876) * (-551.293) (-550.706) [-554.016] (-553.255) -- 0:00:21
Average standard deviation of split frequencies: 0.008384
655500 -- (-556.046) (-552.933) [-550.989] (-551.686) * (-552.077) [-549.774] (-551.814) (-554.376) -- 0:00:21
656000 -- (-551.445) [-550.882] (-552.945) (-549.405) * (-550.999) (-553.736) (-550.242) [-550.811] -- 0:00:20
656500 -- [-550.946] (-549.861) (-550.318) (-550.522) * (-553.960) (-550.638) [-555.060] (-551.786) -- 0:00:20
657000 -- (-552.943) [-552.833] (-549.510) (-551.812) * (-550.538) (-549.914) (-551.984) [-551.867] -- 0:00:20
657500 -- (-553.043) (-552.085) [-550.021] (-551.716) * (-552.467) [-549.208] (-551.848) (-552.546) -- 0:00:20
658000 -- (-555.890) (-551.992) [-549.778] (-551.254) * (-550.895) (-552.155) (-550.458) [-554.345] -- 0:00:20
658500 -- [-551.307] (-552.784) (-551.047) (-551.002) * (-550.746) (-550.127) [-552.630] (-555.393) -- 0:00:20
659000 -- (-549.602) (-554.301) (-551.510) [-550.829] * (-551.446) (-550.742) [-550.233] (-549.377) -- 0:00:20
659500 -- (-551.673) (-550.240) (-550.253) [-550.986] * (-554.623) (-549.699) [-550.779] (-553.433) -- 0:00:20
660000 -- [-554.198] (-551.864) (-551.622) (-550.284) * (-552.294) (-550.530) [-553.151] (-555.689) -- 0:00:20
Average standard deviation of split frequencies: 0.008324
660500 -- (-556.837) (-553.472) [-551.780] (-551.186) * (-549.847) [-551.489] (-550.972) (-554.946) -- 0:00:20
661000 -- (-559.384) (-551.834) [-550.374] (-549.936) * (-550.606) (-550.993) (-551.586) [-550.940] -- 0:00:20
661500 -- (-552.932) (-551.548) (-549.929) [-551.195] * [-551.439] (-550.330) (-550.959) (-551.237) -- 0:00:20
662000 -- (-552.193) [-549.809] (-550.346) (-558.601) * (-552.322) [-552.842] (-550.647) (-550.899) -- 0:00:20
662500 -- [-550.800] (-549.769) (-550.905) (-555.478) * [-551.060] (-550.693) (-555.137) (-552.007) -- 0:00:20
663000 -- (-553.714) [-550.493] (-550.424) (-551.047) * (-550.983) (-549.679) (-554.635) [-549.145] -- 0:00:20
663500 -- (-554.981) [-552.998] (-550.259) (-556.412) * [-551.794] (-552.741) (-550.762) (-549.121) -- 0:00:20
664000 -- (-552.151) [-554.946] (-551.889) (-551.683) * (-554.970) (-550.633) (-551.344) [-549.864] -- 0:00:20
664500 -- [-555.304] (-552.196) (-552.050) (-550.936) * (-558.869) [-550.047] (-551.471) (-550.670) -- 0:00:20
665000 -- [-550.358] (-556.941) (-552.020) (-552.032) * (-550.921) [-551.141] (-551.444) (-552.879) -- 0:00:20
Average standard deviation of split frequencies: 0.007928
665500 -- [-551.989] (-551.196) (-551.031) (-560.155) * [-549.924] (-551.321) (-552.181) (-549.747) -- 0:00:20
666000 -- [-549.561] (-551.692) (-549.952) (-556.762) * [-550.550] (-551.116) (-557.183) (-554.378) -- 0:00:20
666500 -- (-550.453) [-550.815] (-554.846) (-553.485) * (-549.108) (-558.508) [-553.591] (-557.268) -- 0:00:20
667000 -- [-549.639] (-554.779) (-550.850) (-553.080) * [-551.660] (-554.953) (-550.576) (-551.481) -- 0:00:19
667500 -- (-550.973) [-552.869] (-551.007) (-552.310) * [-551.348] (-552.642) (-557.533) (-550.117) -- 0:00:19
668000 -- [-552.473] (-550.443) (-551.589) (-551.621) * (-549.885) (-552.542) [-550.329] (-551.695) -- 0:00:19
668500 -- (-551.495) [-551.434] (-550.200) (-552.668) * (-552.777) (-552.294) (-553.398) [-552.239] -- 0:00:19
669000 -- [-553.510] (-550.542) (-552.924) (-551.004) * [-551.230] (-549.832) (-550.248) (-550.320) -- 0:00:19
669500 -- [-551.030] (-550.766) (-550.503) (-552.759) * (-551.384) (-550.107) [-551.202] (-551.175) -- 0:00:19
670000 -- [-553.490] (-555.331) (-552.475) (-552.753) * (-553.750) (-550.163) (-551.055) [-551.425] -- 0:00:19
Average standard deviation of split frequencies: 0.008013
670500 -- (-552.918) [-550.766] (-551.353) (-551.563) * (-550.784) [-550.161] (-552.768) (-551.036) -- 0:00:20
671000 -- (-552.219) [-550.742] (-551.207) (-551.184) * (-551.747) (-551.419) [-550.390] (-550.773) -- 0:00:20
671500 -- (-554.000) (-552.504) (-549.444) [-550.202] * (-551.299) (-550.442) (-551.165) [-550.265] -- 0:00:20
672000 -- [-549.822] (-549.698) (-552.073) (-551.068) * (-550.201) (-553.663) [-552.926] (-557.752) -- 0:00:20
672500 -- (-551.486) (-551.122) [-551.767] (-552.358) * [-550.618] (-552.178) (-553.463) (-552.531) -- 0:00:19
673000 -- (-551.348) [-550.195] (-549.463) (-551.317) * (-552.850) (-549.624) [-556.881] (-552.601) -- 0:00:19
673500 -- [-551.099] (-551.564) (-550.950) (-556.352) * (-551.583) [-551.247] (-555.065) (-554.108) -- 0:00:19
674000 -- (-553.827) (-549.812) (-550.477) [-550.181] * (-552.874) [-552.635] (-554.890) (-553.831) -- 0:00:19
674500 -- [-554.099] (-552.170) (-550.511) (-551.235) * (-552.653) [-551.583] (-554.517) (-554.816) -- 0:00:19
675000 -- (-550.072) (-552.181) (-550.872) [-551.479] * (-556.705) [-553.724] (-549.714) (-551.887) -- 0:00:19
Average standard deviation of split frequencies: 0.008630
675500 -- (-553.680) (-551.516) (-550.908) [-552.102] * (-551.552) (-550.028) [-549.630] (-550.713) -- 0:00:19
676000 -- [-552.908] (-551.816) (-549.979) (-553.505) * (-549.474) (-550.423) [-550.793] (-552.293) -- 0:00:19
676500 -- (-552.521) (-551.529) [-549.941] (-560.260) * (-553.241) [-549.831] (-551.381) (-553.435) -- 0:00:19
677000 -- (-550.649) (-550.464) (-550.940) [-554.202] * (-556.271) (-555.569) [-549.966] (-550.544) -- 0:00:19
677500 -- [-549.762] (-550.578) (-549.912) (-551.613) * (-553.809) [-554.354] (-550.764) (-549.695) -- 0:00:19
678000 -- (-552.548) (-550.641) [-551.285] (-550.768) * (-552.522) (-555.942) [-553.355] (-550.870) -- 0:00:19
678500 -- (-550.748) (-551.360) [-551.397] (-550.858) * (-550.529) (-549.732) [-551.132] (-550.095) -- 0:00:19
679000 -- (-549.788) (-550.247) (-553.277) [-551.347] * (-555.085) (-552.642) [-551.205] (-550.281) -- 0:00:19
679500 -- (-553.284) (-551.325) (-549.593) [-551.361] * (-553.065) (-552.729) [-550.833] (-552.254) -- 0:00:19
680000 -- (-550.798) (-549.896) [-549.625] (-550.210) * [-554.215] (-550.680) (-552.278) (-556.555) -- 0:00:19
Average standard deviation of split frequencies: 0.008830
680500 -- (-552.804) (-550.770) (-551.344) [-554.238] * (-553.978) [-551.286] (-552.245) (-550.713) -- 0:00:19
681000 -- (-550.758) [-549.359] (-555.082) (-553.126) * (-549.606) (-553.139) [-550.937] (-550.843) -- 0:00:19
681500 -- (-551.312) (-549.460) (-551.358) [-551.035] * (-549.720) (-555.574) (-549.443) [-550.530] -- 0:00:19
682000 -- (-553.560) [-549.723] (-554.553) (-549.995) * [-550.554] (-555.308) (-553.234) (-551.460) -- 0:00:19
682500 -- (-550.249) [-550.461] (-552.223) (-550.535) * (-553.226) (-550.350) (-551.470) [-550.745] -- 0:00:19
683000 -- (-550.264) (-550.282) (-550.087) [-550.936] * (-552.314) (-552.728) [-550.837] (-552.636) -- 0:00:19
683500 -- (-553.602) (-551.260) [-549.382] (-553.757) * (-549.954) (-554.581) (-550.726) [-552.368] -- 0:00:18
684000 -- (-551.248) (-550.540) (-551.329) [-551.060] * [-552.535] (-551.288) (-552.660) (-551.900) -- 0:00:18
684500 -- (-555.875) (-554.281) (-551.294) [-552.296] * [-549.629] (-551.019) (-551.152) (-553.194) -- 0:00:18
685000 -- (-553.923) [-550.542] (-554.854) (-552.672) * (-550.134) [-553.694] (-549.632) (-550.284) -- 0:00:18
Average standard deviation of split frequencies: 0.009062
685500 -- [-550.971] (-550.910) (-554.783) (-549.883) * [-550.818] (-552.201) (-550.146) (-550.244) -- 0:00:18
686000 -- (-550.582) [-551.236] (-552.862) (-552.148) * [-551.051] (-554.053) (-549.608) (-550.632) -- 0:00:18
686500 -- (-550.948) [-550.392] (-550.846) (-551.009) * [-553.359] (-556.226) (-549.836) (-550.332) -- 0:00:18
687000 -- (-553.244) [-555.976] (-549.811) (-552.338) * [-551.208] (-551.802) (-551.831) (-549.554) -- 0:00:19
687500 -- [-554.836] (-550.822) (-549.747) (-554.014) * (-550.473) [-551.958] (-550.288) (-549.747) -- 0:00:19
688000 -- (-552.066) (-558.259) [-551.170] (-554.638) * (-551.625) (-552.667) [-551.141] (-550.878) -- 0:00:19
688500 -- [-551.184] (-550.756) (-551.447) (-554.202) * (-551.351) (-554.818) (-555.419) [-551.126] -- 0:00:19
689000 -- [-549.755] (-549.664) (-551.606) (-553.246) * (-551.708) [-553.826] (-551.025) (-549.252) -- 0:00:18
689500 -- (-552.392) [-550.571] (-551.569) (-552.717) * (-549.464) (-550.129) (-552.564) [-549.700] -- 0:00:18
690000 -- (-555.047) [-553.979] (-550.680) (-552.350) * (-553.851) [-549.688] (-552.817) (-549.137) -- 0:00:18
Average standard deviation of split frequencies: 0.009129
690500 -- (-551.712) (-552.368) (-551.583) [-553.494] * [-551.161] (-550.580) (-553.072) (-552.946) -- 0:00:18
691000 -- (-555.532) (-554.502) (-552.077) [-551.383] * (-551.449) (-551.759) [-550.321] (-551.631) -- 0:00:18
691500 -- [-552.753] (-552.620) (-554.344) (-552.773) * (-552.031) [-550.364] (-550.510) (-551.356) -- 0:00:18
692000 -- (-557.249) (-552.075) [-551.985] (-553.800) * (-550.730) [-551.480] (-551.308) (-552.836) -- 0:00:18
692500 -- (-550.463) [-550.217] (-553.971) (-553.587) * (-551.975) (-551.158) [-549.179] (-556.916) -- 0:00:18
693000 -- (-552.171) (-550.645) [-553.017] (-553.519) * [-550.530] (-549.630) (-553.563) (-553.903) -- 0:00:18
693500 -- (-554.091) (-551.493) [-551.813] (-551.611) * (-551.218) (-550.004) (-553.067) [-550.623] -- 0:00:18
694000 -- (-553.966) (-550.436) (-552.497) [-551.366] * (-551.517) (-550.874) (-553.437) [-556.082] -- 0:00:18
694500 -- (-552.441) [-549.794] (-551.612) (-551.109) * [-551.038] (-551.181) (-551.076) (-550.895) -- 0:00:18
695000 -- (-550.093) (-552.175) (-552.021) [-551.130] * (-551.224) [-550.076] (-553.024) (-551.897) -- 0:00:18
Average standard deviation of split frequencies: 0.008974
695500 -- (-550.249) (-550.845) (-551.182) [-551.688] * (-550.496) [-549.670] (-550.989) (-551.675) -- 0:00:18
696000 -- [-549.595] (-551.868) (-551.607) (-550.136) * (-549.508) [-551.107] (-549.821) (-552.105) -- 0:00:18
696500 -- (-550.652) [-550.899] (-551.993) (-551.258) * (-551.037) (-551.121) [-550.606] (-553.656) -- 0:00:18
697000 -- [-551.174] (-553.964) (-551.113) (-549.970) * (-550.768) (-553.189) (-550.745) [-550.376] -- 0:00:18
697500 -- (-550.458) (-552.511) [-550.642] (-552.230) * [-550.551] (-551.149) (-552.331) (-549.502) -- 0:00:18
698000 -- (-553.107) (-550.182) (-557.189) [-550.597] * (-550.763) (-551.139) (-550.241) [-551.433] -- 0:00:18
698500 -- [-550.442] (-551.563) (-553.433) (-550.420) * (-552.209) (-550.941) [-551.986] (-553.676) -- 0:00:18
699000 -- [-551.373] (-551.984) (-551.436) (-552.515) * (-550.488) (-552.869) (-553.959) [-550.105] -- 0:00:18
699500 -- (-552.529) [-549.610] (-550.868) (-550.328) * (-551.656) (-550.885) [-552.232] (-552.499) -- 0:00:18
700000 -- (-556.488) [-550.382] (-555.371) (-551.067) * (-553.139) (-550.032) (-551.663) [-549.502] -- 0:00:18
Average standard deviation of split frequencies: 0.009419
700500 -- [-550.575] (-550.205) (-554.510) (-550.858) * (-552.917) [-551.025] (-551.268) (-550.532) -- 0:00:17
701000 -- (-551.171) (-553.145) (-552.421) [-552.112] * (-551.946) (-550.602) (-551.818) [-550.761] -- 0:00:17
701500 -- (-551.957) (-561.519) [-553.516] (-551.417) * [-550.542] (-550.540) (-551.699) (-554.631) -- 0:00:17
702000 -- (-554.213) (-549.902) (-551.476) [-552.292] * (-552.348) (-556.164) [-550.786] (-552.934) -- 0:00:17
702500 -- (-550.473) (-551.859) [-551.624] (-556.678) * (-552.393) (-552.000) [-551.197] (-550.843) -- 0:00:17
703000 -- (-553.122) [-552.699] (-551.132) (-550.517) * (-550.524) (-552.370) [-550.813] (-551.510) -- 0:00:17
703500 -- (-554.142) (-550.795) (-555.947) [-549.379] * [-549.753] (-549.991) (-552.065) (-550.384) -- 0:00:17
704000 -- [-549.274] (-551.066) (-552.100) (-550.673) * (-553.022) (-552.632) [-550.656] (-552.814) -- 0:00:18
704500 -- [-549.579] (-550.942) (-550.408) (-552.045) * (-552.403) (-549.810) [-549.778] (-557.085) -- 0:00:18
705000 -- (-550.274) [-550.470] (-551.680) (-550.208) * (-551.432) (-549.729) [-550.102] (-557.337) -- 0:00:17
Average standard deviation of split frequencies: 0.009515
705500 -- (-549.988) (-551.143) (-550.369) [-549.613] * [-549.650] (-550.626) (-551.781) (-556.537) -- 0:00:17
706000 -- [-550.995] (-551.602) (-555.051) (-550.449) * (-549.770) (-550.236) (-550.294) [-552.061] -- 0:00:17
706500 -- (-550.475) (-551.179) [-550.503] (-551.024) * (-550.588) (-552.291) [-551.355] (-551.259) -- 0:00:17
707000 -- (-555.015) (-550.568) (-549.511) [-553.918] * (-549.720) (-551.219) (-550.267) [-551.718] -- 0:00:17
707500 -- (-550.324) (-550.109) (-549.860) [-555.301] * (-552.111) (-551.337) [-552.047] (-553.401) -- 0:00:17
708000 -- (-550.384) (-550.797) (-556.204) [-549.361] * (-553.330) [-550.748] (-553.432) (-553.269) -- 0:00:17
708500 -- (-553.716) [-551.913] (-551.590) (-552.899) * (-552.141) (-552.162) (-549.740) [-551.976] -- 0:00:17
709000 -- (-555.174) [-550.104] (-549.974) (-551.963) * (-551.926) (-550.510) (-549.857) [-552.109] -- 0:00:17
709500 -- (-551.838) [-553.483] (-553.129) (-550.079) * [-551.379] (-552.135) (-551.982) (-550.952) -- 0:00:17
710000 -- [-551.103] (-551.446) (-552.135) (-550.831) * (-550.681) [-550.371] (-552.865) (-551.956) -- 0:00:17
Average standard deviation of split frequencies: 0.009577
710500 -- (-551.658) [-551.192] (-552.325) (-551.400) * [-551.244] (-550.105) (-551.313) (-555.223) -- 0:00:17
711000 -- (-552.312) [-555.023] (-551.950) (-553.998) * (-553.734) (-555.456) [-551.280] (-555.465) -- 0:00:17
711500 -- (-556.448) (-550.828) [-550.351] (-551.617) * (-550.817) [-551.270] (-554.295) (-552.802) -- 0:00:17
712000 -- (-556.197) (-549.725) (-551.824) [-552.341] * (-552.869) (-551.214) [-557.104] (-553.913) -- 0:00:17
712500 -- (-552.172) (-551.719) (-554.673) [-551.262] * (-551.508) (-552.026) (-550.517) [-551.554] -- 0:00:17
713000 -- (-550.901) (-552.868) (-551.031) [-550.429] * (-549.953) (-552.689) [-550.279] (-553.526) -- 0:00:17
713500 -- (-551.911) (-551.620) (-551.422) [-549.895] * (-552.037) (-552.980) (-552.361) [-551.717] -- 0:00:17
714000 -- (-552.907) (-553.291) (-552.399) [-550.973] * (-551.229) (-553.712) [-551.549] (-552.683) -- 0:00:17
714500 -- (-553.169) (-549.765) [-554.175] (-549.670) * [-551.397] (-552.438) (-553.131) (-551.999) -- 0:00:17
715000 -- (-553.552) (-550.822) (-554.928) [-549.971] * (-551.974) (-554.856) [-551.783] (-551.788) -- 0:00:17
Average standard deviation of split frequencies: 0.009464
715500 -- (-550.967) (-551.378) (-556.179) [-552.517] * (-554.834) (-553.494) [-550.197] (-551.906) -- 0:00:17
716000 -- (-551.491) (-556.547) (-552.084) [-553.056] * [-554.680] (-550.983) (-556.455) (-553.767) -- 0:00:17
716500 -- [-551.586] (-551.196) (-551.813) (-549.994) * (-550.433) [-551.961] (-551.512) (-549.836) -- 0:00:17
717000 -- [-549.989] (-550.723) (-556.408) (-554.019) * [-551.275] (-550.366) (-550.168) (-551.571) -- 0:00:16
717500 -- (-550.228) [-553.140] (-553.728) (-551.998) * (-553.432) (-550.999) [-549.894] (-551.013) -- 0:00:16
718000 -- (-552.102) [-555.054] (-550.123) (-549.847) * (-553.322) (-555.029) (-552.400) [-551.304] -- 0:00:16
718500 -- [-550.968] (-553.870) (-553.715) (-550.314) * (-553.759) [-551.186] (-551.850) (-553.290) -- 0:00:16
719000 -- (-550.432) [-550.630] (-555.682) (-553.236) * (-553.775) (-551.403) [-554.140] (-553.158) -- 0:00:16
719500 -- (-553.096) (-549.278) [-551.014] (-552.211) * (-550.921) (-550.975) [-550.244] (-552.102) -- 0:00:16
720000 -- (-555.219) (-550.085) [-549.559] (-550.812) * (-552.528) (-553.758) [-550.279] (-553.750) -- 0:00:16
Average standard deviation of split frequencies: 0.009689
720500 -- (-555.034) (-557.522) (-551.851) [-551.016] * [-552.558] (-550.505) (-550.090) (-553.543) -- 0:00:17
721000 -- (-551.887) (-556.318) [-551.359] (-550.771) * (-552.067) (-552.773) [-550.016] (-553.696) -- 0:00:17
721500 -- [-550.881] (-557.465) (-552.384) (-551.117) * [-553.232] (-552.519) (-551.000) (-550.569) -- 0:00:16
722000 -- [-552.804] (-553.678) (-550.740) (-557.231) * (-552.929) (-551.585) [-549.832] (-551.371) -- 0:00:16
722500 -- (-554.695) (-556.987) (-549.962) [-551.181] * (-552.526) [-550.163] (-550.767) (-555.238) -- 0:00:16
723000 -- (-555.368) (-549.437) (-555.375) [-551.173] * (-555.940) [-550.512] (-549.791) (-556.336) -- 0:00:16
723500 -- (-552.043) (-549.987) (-552.572) [-556.617] * (-554.689) [-551.939] (-549.903) (-550.054) -- 0:00:16
724000 -- (-553.411) (-553.894) (-551.483) [-555.865] * (-552.224) (-552.538) (-549.522) [-549.613] -- 0:00:16
724500 -- (-558.384) [-550.405] (-551.218) (-550.728) * [-550.035] (-552.058) (-550.485) (-554.247) -- 0:00:16
725000 -- (-552.782) (-553.658) [-551.405] (-549.963) * [-549.742] (-550.080) (-554.390) (-552.880) -- 0:00:16
Average standard deviation of split frequencies: 0.009009
725500 -- (-550.480) (-555.199) [-550.181] (-555.415) * (-551.359) [-554.097] (-552.988) (-555.950) -- 0:00:16
726000 -- [-552.889] (-551.570) (-550.926) (-551.143) * (-551.534) (-553.384) [-550.467] (-557.305) -- 0:00:16
726500 -- (-551.623) (-551.825) (-551.862) [-551.378] * (-552.891) [-553.759] (-552.997) (-553.999) -- 0:00:16
727000 -- [-550.104] (-554.042) (-551.799) (-552.147) * (-556.115) (-553.995) (-555.113) [-555.490] -- 0:00:16
727500 -- (-550.192) (-551.261) (-554.840) [-550.951] * (-556.366) [-559.876] (-550.598) (-551.113) -- 0:00:16
728000 -- (-553.392) (-552.084) (-550.205) [-553.714] * (-552.087) (-550.105) [-552.149] (-554.135) -- 0:00:16
728500 -- [-553.228] (-552.417) (-551.748) (-551.834) * (-550.956) [-549.667] (-554.330) (-552.602) -- 0:00:16
729000 -- (-551.246) [-551.934] (-552.172) (-550.700) * (-550.107) [-551.239] (-561.003) (-550.212) -- 0:00:16
729500 -- [-550.715] (-554.202) (-550.812) (-551.873) * [-554.462] (-550.844) (-550.707) (-549.610) -- 0:00:16
730000 -- (-549.359) (-552.962) (-551.868) [-553.044] * (-551.083) (-552.628) (-550.803) [-550.242] -- 0:00:16
Average standard deviation of split frequencies: 0.008911
730500 -- (-555.011) (-552.386) (-552.074) [-550.252] * (-552.086) (-553.062) [-550.898] (-550.158) -- 0:00:16
731000 -- [-550.183] (-551.536) (-552.221) (-550.603) * (-550.098) (-552.190) (-551.239) [-552.215] -- 0:00:16
731500 -- (-552.361) [-553.511] (-550.718) (-551.228) * (-557.603) (-551.465) [-549.969] (-549.725) -- 0:00:16
732000 -- [-550.455] (-551.612) (-550.164) (-551.441) * (-561.195) [-551.437] (-551.878) (-554.570) -- 0:00:16
732500 -- (-551.207) (-553.984) [-551.838] (-551.457) * [-551.842] (-550.407) (-550.085) (-552.693) -- 0:00:16
733000 -- [-552.702] (-556.661) (-550.530) (-552.844) * (-551.425) (-552.931) [-550.788] (-551.962) -- 0:00:16
733500 -- (-554.350) (-550.312) (-554.678) [-550.707] * (-553.037) [-554.573] (-553.820) (-561.450) -- 0:00:15
734000 -- (-553.115) (-549.905) (-553.310) [-550.919] * [-551.675] (-554.142) (-553.902) (-550.598) -- 0:00:15
734500 -- [-549.438] (-550.836) (-552.342) (-551.923) * (-549.260) (-551.591) (-560.176) [-551.058] -- 0:00:15
735000 -- [-549.837] (-552.084) (-552.790) (-552.063) * (-550.134) (-552.908) (-550.406) [-551.212] -- 0:00:15
Average standard deviation of split frequencies: 0.008687
735500 -- (-550.103) (-551.505) [-550.943] (-551.271) * (-552.323) (-553.471) [-552.499] (-551.663) -- 0:00:15
736000 -- (-552.269) [-552.163] (-550.639) (-551.532) * (-550.474) [-551.703] (-549.686) (-549.883) -- 0:00:15
736500 -- (-552.805) [-549.826] (-553.399) (-554.543) * (-553.081) (-550.777) [-550.326] (-549.455) -- 0:00:15
737000 -- (-552.948) [-550.357] (-554.440) (-553.512) * [-551.289] (-555.094) (-550.971) (-553.766) -- 0:00:15
737500 -- (-556.850) [-552.356] (-551.998) (-549.471) * (-552.133) [-551.849] (-550.201) (-550.328) -- 0:00:16
738000 -- (-553.882) (-550.641) [-550.499] (-549.494) * (-551.843) [-553.263] (-551.706) (-550.883) -- 0:00:15
738500 -- [-550.510] (-553.351) (-551.559) (-552.536) * [-554.682] (-550.945) (-549.288) (-551.931) -- 0:00:15
739000 -- (-551.027) (-555.946) [-550.293] (-550.998) * (-552.721) (-553.964) (-553.739) [-552.888] -- 0:00:15
739500 -- (-550.118) [-552.631] (-556.603) (-551.123) * (-551.844) (-552.583) [-553.518] (-549.674) -- 0:00:15
740000 -- [-550.947] (-553.286) (-550.815) (-552.473) * [-550.396] (-550.025) (-551.876) (-551.902) -- 0:00:15
Average standard deviation of split frequencies: 0.008019
740500 -- [-549.646] (-550.784) (-554.475) (-551.755) * (-562.381) (-551.207) [-552.263] (-551.952) -- 0:00:15
741000 -- (-552.848) (-552.523) [-550.294] (-552.760) * [-549.886] (-555.606) (-550.365) (-552.531) -- 0:00:15
741500 -- (-550.837) (-553.094) [-550.263] (-552.364) * (-553.437) [-552.018] (-551.268) (-549.913) -- 0:00:15
742000 -- (-551.448) [-553.017] (-550.293) (-555.454) * (-550.255) [-552.352] (-551.295) (-549.495) -- 0:00:15
742500 -- [-553.475] (-554.879) (-550.025) (-554.538) * [-552.124] (-554.842) (-552.544) (-550.100) -- 0:00:15
743000 -- (-554.085) (-550.347) [-553.863] (-553.496) * [-550.449] (-555.750) (-549.544) (-550.315) -- 0:00:15
743500 -- [-551.755] (-551.967) (-553.008) (-550.687) * (-549.909) (-554.301) (-552.673) [-549.674] -- 0:00:15
744000 -- (-551.934) (-552.711) [-550.301] (-551.859) * (-550.540) (-551.363) (-551.306) [-549.722] -- 0:00:15
744500 -- (-556.662) (-550.331) (-552.265) [-550.577] * (-553.024) (-551.916) (-551.232) [-549.704] -- 0:00:15
745000 -- (-551.275) (-551.271) (-550.105) [-550.343] * [-551.356] (-550.808) (-550.173) (-550.644) -- 0:00:15
Average standard deviation of split frequencies: 0.007794
745500 -- [-552.890] (-553.662) (-549.524) (-551.439) * [-552.353] (-551.074) (-549.776) (-549.720) -- 0:00:15
746000 -- (-553.883) [-551.541] (-553.576) (-554.086) * (-552.690) (-550.496) [-552.429] (-551.502) -- 0:00:15
746500 -- (-556.835) (-552.299) (-552.803) [-551.746] * [-556.703] (-553.359) (-552.097) (-551.584) -- 0:00:15
747000 -- (-552.794) [-550.838] (-551.603) (-549.786) * [-550.695] (-550.638) (-550.707) (-550.179) -- 0:00:15
747500 -- [-550.743] (-555.656) (-550.659) (-551.223) * (-550.246) [-552.526] (-549.305) (-552.134) -- 0:00:15
748000 -- (-552.675) (-555.170) (-553.353) [-553.021] * [-549.931] (-551.062) (-551.932) (-552.256) -- 0:00:15
748500 -- (-551.348) (-552.467) (-554.446) [-549.705] * [-551.392] (-549.872) (-551.283) (-553.998) -- 0:00:15
749000 -- (-550.290) (-556.058) (-549.211) [-550.050] * (-549.092) [-551.156] (-553.655) (-551.329) -- 0:00:15
749500 -- (-550.474) (-550.324) (-550.532) [-551.740] * [-550.468] (-551.154) (-553.061) (-550.553) -- 0:00:15
750000 -- [-549.506] (-551.748) (-549.499) (-553.738) * (-551.348) [-550.304] (-550.872) (-551.230) -- 0:00:15
Average standard deviation of split frequencies: 0.007954
750500 -- (-549.506) (-554.059) [-551.952] (-556.723) * (-550.743) (-551.924) [-552.766] (-550.723) -- 0:00:14
751000 -- (-551.386) (-551.388) [-551.883] (-554.314) * (-550.592) [-550.230] (-555.645) (-551.048) -- 0:00:14
751500 -- (-550.870) [-550.234] (-551.886) (-551.781) * (-549.808) (-553.542) [-555.574] (-552.073) -- 0:00:14
752000 -- (-554.013) [-550.821] (-551.054) (-551.734) * (-549.703) (-553.520) (-552.475) [-551.432] -- 0:00:14
752500 -- (-550.927) (-549.677) [-551.271] (-550.557) * (-551.460) (-550.139) [-552.335] (-550.778) -- 0:00:14
753000 -- (-551.070) (-551.416) [-552.616] (-550.992) * (-549.946) [-551.515] (-553.210) (-550.601) -- 0:00:14
753500 -- [-550.842] (-553.273) (-553.734) (-552.279) * (-551.281) (-550.245) [-553.436] (-555.807) -- 0:00:14
754000 -- (-552.946) (-551.126) (-553.454) [-549.643] * (-551.775) [-549.781] (-551.140) (-552.864) -- 0:00:14
754500 -- [-552.774] (-549.879) (-552.373) (-550.876) * (-550.317) (-550.064) [-552.112] (-553.559) -- 0:00:14
755000 -- [-552.417] (-550.720) (-552.314) (-549.416) * (-553.574) (-553.465) [-550.831] (-553.620) -- 0:00:14
Average standard deviation of split frequencies: 0.008231
755500 -- (-554.748) (-551.589) [-552.521] (-552.806) * (-550.585) (-549.345) [-549.239] (-550.833) -- 0:00:14
756000 -- (-551.316) (-553.190) (-551.817) [-552.174] * (-550.610) (-550.498) [-550.996] (-551.473) -- 0:00:14
756500 -- [-552.006] (-551.785) (-550.424) 