--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 10:14:17 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/ctaE/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -831.37 -834.58
2 -831.34 -834.55
--------------------------------------
TOTAL -831.36 -834.56
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894737 0.090907 0.359434 1.486877 0.855089 1501.00 1501.00 1.000
r(A<->C){all} 0.158784 0.018702 0.000017 0.432122 0.119919 186.93 199.78 1.002
r(A<->G){all} 0.169091 0.020599 0.000178 0.459985 0.131237 264.74 314.22 1.001
r(A<->T){all} 0.167864 0.020464 0.000078 0.452147 0.133045 235.69 246.44 1.009
r(C<->G){all} 0.179966 0.021489 0.000342 0.471465 0.147842 191.44 221.03 1.006
r(C<->T){all} 0.161659 0.019631 0.000100 0.446266 0.121258 175.92 308.65 1.000
r(G<->T){all} 0.162636 0.018678 0.000022 0.434377 0.129714 231.27 281.26 1.000
pi(A){all} 0.177473 0.000240 0.147874 0.206943 0.177257 1254.08 1305.53 1.001
pi(C){all} 0.300475 0.000339 0.263032 0.335370 0.300134 1150.57 1325.79 1.000
pi(G){all} 0.262467 0.000315 0.231193 0.300797 0.262454 1380.54 1440.77 1.000
pi(T){all} 0.259586 0.000322 0.224438 0.294559 0.259494 1311.53 1357.10 1.000
alpha{1,2} 0.411282 0.228454 0.000279 1.374108 0.241753 1092.03 1180.43 1.001
alpha{3} 0.466446 0.244042 0.000121 1.511736 0.308377 1080.01 1280.04 1.000
pinvar{all} 0.997431 0.000010 0.991718 0.999997 0.998400 1169.14 1232.47 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -796.248917
Model 2: PositiveSelection -796.24889
Model 0: one-ratio -796.248934
Model 7: beta -796.248926
Model 8: beta&w>1 -796.248843
Model 0 vs 1 3.399999991415825E-5
Model 2 vs 1 5.400000009103678E-5
Model 8 vs 7 1.6600000003563764E-4
>C1
VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
IR
>C2
VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
IR
>C3
VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
IR
>C4
VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
IR
>C5
VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
IR
>C6
VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
IR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=202
C1 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
C2 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
C3 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
C4 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
C5 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
C6 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
**************************************************
C1 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
C2 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
C3 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
C4 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
C5 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
C6 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
**************************************************
C1 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
C2 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
C3 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
C4 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
C5 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
C6 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
**************************************************
C1 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
C2 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
C3 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
C4 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
C5 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
C6 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
**************************************************
C1 IR
C2 IR
C3 IR
C4 IR
C5 IR
C6 IR
**
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6060]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6060]--->[6060]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.481 Mb, Max= 30.746 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
C2 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
C3 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
C4 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
C5 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
C6 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
**************************************************
C1 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
C2 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
C3 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
C4 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
C5 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
C6 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
**************************************************
C1 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
C2 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
C3 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
C4 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
C5 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
C6 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
**************************************************
C1 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
C2 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
C3 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
C4 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
C5 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
C6 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
**************************************************
C1 IR
C2 IR
C3 IR
C4 IR
C5 IR
C6 IR
**
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA
C2 GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA
C3 GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA
C4 GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA
C5 GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA
C6 GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA
**************************************************
C1 TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT
C2 TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT
C3 TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT
C4 TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT
C5 TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT
C6 TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT
**************************************************
C1 CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG
C2 CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG
C3 CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG
C4 CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG
C5 CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG
C6 CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG
**************************************************
C1 CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA
C2 CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA
C3 CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA
C4 CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA
C5 CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA
C6 CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA
**************************************************
C1 CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC
C2 CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC
C3 CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC
C4 CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC
C5 CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC
C6 CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC
**************************************************
C1 AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC
C2 AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC
C3 AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC
C4 AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC
C5 AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC
C6 AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC
**************************************************
C1 TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG
C2 TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG
C3 TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG
C4 TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG
C5 TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG
C6 TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG
**************************************************
C1 CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG
C2 CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG
C3 CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG
C4 CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG
C5 CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG
C6 CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG
**************************************************
C1 CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC
C2 CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC
C3 CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC
C4 CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC
C5 CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC
C6 CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC
**************************************************
C1 ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG
C2 ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG
C3 ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG
C4 ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG
C5 ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG
C6 ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG
**************************************************
C1 CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT
C2 CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT
C3 CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT
C4 CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT
C5 CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT
C6 CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT
**************************************************
C1 GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC
C2 GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC
C3 GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC
C4 GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC
C5 GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC
C6 GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC
**************************************************
C1 ATCCGA
C2 ATCCGA
C3 ATCCGA
C4 ATCCGA
C5 ATCCGA
C6 ATCCGA
******
>C1
GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA
TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT
CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG
CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA
CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC
AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC
TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG
CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG
CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC
ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG
CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT
GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC
ATCCGA
>C2
GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA
TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT
CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG
CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA
CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC
AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC
TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG
CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG
CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC
ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG
CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT
GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC
ATCCGA
>C3
GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA
TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT
CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG
CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA
CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC
AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC
TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG
CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG
CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC
ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG
CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT
GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC
ATCCGA
>C4
GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA
TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT
CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG
CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA
CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC
AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC
TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG
CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG
CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC
ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG
CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT
GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC
ATCCGA
>C5
GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA
TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT
CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG
CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA
CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC
AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC
TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG
CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG
CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC
ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG
CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT
GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC
ATCCGA
>C6
GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA
TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT
CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG
CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA
CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC
AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC
TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG
CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG
CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC
ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG
CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT
GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC
ATCCGA
>C1
VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
IR
>C2
VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
IR
>C3
VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
IR
>C4
VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
IR
>C5
VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
IR
>C6
VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
IR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 606 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579774380
Setting output file names to "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1262760468
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8737184131
Seed = 1319360962
Swapseed = 1579774380
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1356.256844 -- -24.965149
Chain 2 -- -1356.256844 -- -24.965149
Chain 3 -- -1356.257051 -- -24.965149
Chain 4 -- -1356.257051 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1356.257051 -- -24.965149
Chain 2 -- -1356.257051 -- -24.965149
Chain 3 -- -1356.257051 -- -24.965149
Chain 4 -- -1356.257051 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1356.257] (-1356.257) (-1356.257) (-1356.257) * [-1356.257] (-1356.257) (-1356.257) (-1356.257)
500 -- (-846.835) [-838.408] (-837.606) (-842.267) * (-838.720) (-832.310) [-847.253] (-845.356) -- 0:00:00
1000 -- [-840.036] (-843.560) (-837.966) (-841.169) * (-839.378) [-837.227] (-844.129) (-843.808) -- 0:00:00
1500 -- [-836.665] (-846.654) (-840.388) (-849.633) * (-840.230) [-838.438] (-845.272) (-842.424) -- 0:00:00
2000 -- (-845.715) (-850.614) (-852.281) [-836.915] * (-846.814) (-842.994) [-834.592] (-839.033) -- 0:00:00
2500 -- [-837.348] (-844.453) (-841.695) (-838.804) * (-846.205) [-838.696] (-847.521) (-841.785) -- 0:00:00
3000 -- (-841.207) [-836.576] (-842.883) (-843.602) * (-834.814) [-847.302] (-839.058) (-840.716) -- 0:00:00
3500 -- (-841.952) (-847.238) [-844.267] (-839.197) * (-841.126) [-838.071] (-845.797) (-846.191) -- 0:00:00
4000 -- [-843.294] (-841.355) (-839.169) (-840.948) * (-848.937) (-837.019) (-834.128) [-835.008] -- 0:00:00
4500 -- (-841.946) [-845.364] (-840.976) (-846.421) * (-839.255) (-839.627) (-836.551) [-843.059] -- 0:00:00
5000 -- (-840.766) (-838.455) (-855.706) [-839.136] * (-847.225) (-842.661) (-837.571) [-836.067] -- 0:00:00
Average standard deviation of split frequencies: 0.102138
5500 -- (-843.004) (-838.145) [-839.863] (-842.877) * (-841.828) [-845.585] (-836.987) (-839.694) -- 0:03:00
6000 -- [-839.704] (-840.534) (-838.051) (-840.441) * [-839.772] (-843.855) (-840.074) (-843.804) -- 0:02:45
6500 -- [-843.636] (-839.615) (-836.689) (-848.552) * [-839.617] (-839.224) (-842.194) (-838.863) -- 0:02:32
7000 -- (-843.511) (-846.883) (-840.110) [-837.414] * (-843.439) (-842.109) [-840.386] (-837.611) -- 0:02:21
7500 -- (-840.653) (-838.794) [-844.697] (-841.701) * (-848.780) (-842.264) (-838.710) [-842.869] -- 0:02:12
8000 -- (-847.607) (-841.986) [-840.487] (-843.455) * (-844.319) (-843.843) [-841.363] (-843.140) -- 0:02:04
8500 -- (-840.793) [-836.865] (-838.978) (-838.963) * (-840.725) (-837.095) (-840.041) [-837.606] -- 0:01:56
9000 -- (-841.235) [-838.958] (-845.058) (-844.562) * (-840.640) [-842.080] (-842.548) (-841.468) -- 0:01:50
9500 -- (-840.895) [-836.102] (-840.067) (-852.098) * [-846.525] (-835.414) (-847.690) (-850.427) -- 0:01:44
10000 -- (-848.873) (-842.519) [-836.688] (-838.440) * (-846.280) (-845.456) (-847.613) [-838.198] -- 0:01:39
Average standard deviation of split frequencies: 0.067344
10500 -- [-846.017] (-840.714) (-839.524) (-842.752) * (-853.093) (-840.193) (-841.553) [-847.314] -- 0:01:34
11000 -- (-840.887) (-841.995) (-837.868) [-840.480] * (-841.671) (-842.587) (-839.869) [-839.533] -- 0:01:29
11500 -- (-843.073) (-839.980) (-848.752) [-840.087] * [-841.126] (-842.660) (-852.046) (-837.872) -- 0:01:25
12000 -- (-841.765) (-842.711) [-836.863] (-840.698) * (-839.990) (-843.224) [-841.803] (-842.217) -- 0:01:22
12500 -- (-842.842) [-835.801] (-842.944) (-843.380) * (-832.657) (-844.373) [-837.170] (-835.736) -- 0:01:19
13000 -- (-848.018) (-842.620) (-849.224) [-841.815] * (-833.112) (-841.659) (-843.346) [-832.079] -- 0:01:15
13500 -- [-835.367] (-844.900) (-837.622) (-840.249) * (-833.895) [-835.950] (-842.611) (-831.546) -- 0:01:13
14000 -- (-839.457) (-843.146) [-834.401] (-838.135) * (-833.409) (-841.563) (-840.351) [-830.633] -- 0:01:10
14500 -- (-840.313) (-840.325) (-841.300) [-842.427] * (-832.575) (-840.818) [-837.433] (-830.607) -- 0:01:07
15000 -- [-838.201] (-840.930) (-836.689) (-839.460) * (-841.622) [-842.630] (-840.097) (-830.753) -- 0:01:05
Average standard deviation of split frequencies: 0.034115
15500 -- [-839.441] (-839.123) (-845.871) (-839.269) * [-832.855] (-844.254) (-845.538) (-830.724) -- 0:01:03
16000 -- (-838.876) [-837.283] (-841.111) (-847.818) * (-833.139) [-836.248] (-840.057) (-832.698) -- 0:01:01
16500 -- [-836.218] (-840.877) (-838.991) (-838.409) * [-834.095] (-847.731) (-842.957) (-832.218) -- 0:00:59
17000 -- (-838.872) (-831.474) [-838.456] (-836.572) * (-832.247) (-848.018) [-845.944] (-833.622) -- 0:00:57
17500 -- (-848.460) (-831.500) [-843.238] (-840.734) * (-831.584) [-835.709] (-844.695) (-837.706) -- 0:00:56
18000 -- [-834.102] (-835.861) (-837.667) (-839.614) * (-830.791) (-839.988) [-840.392] (-840.418) -- 0:00:54
18500 -- (-839.040) [-832.528] (-840.875) (-846.802) * [-830.875] (-837.902) (-842.670) (-834.769) -- 0:00:53
19000 -- [-839.890] (-834.654) (-837.688) (-840.321) * [-832.017] (-844.181) (-846.224) (-833.163) -- 0:00:51
19500 -- [-845.196] (-833.048) (-837.820) (-848.773) * (-831.016) (-845.126) [-844.233] (-830.700) -- 0:00:50
20000 -- (-837.464) [-833.090] (-838.323) (-839.507) * (-830.668) (-846.312) [-838.391] (-832.208) -- 0:00:49
Average standard deviation of split frequencies: 0.048154
20500 -- [-842.153] (-831.915) (-843.919) (-845.346) * [-829.799] (-843.812) (-840.738) (-830.154) -- 0:00:47
21000 -- (-842.108) (-831.807) (-843.629) [-835.314] * (-833.942) [-838.696] (-846.571) (-835.614) -- 0:00:46
21500 -- (-847.159) [-830.916] (-848.031) (-844.227) * (-835.973) [-845.421] (-849.243) (-831.379) -- 0:01:31
22000 -- (-845.117) (-831.904) (-845.921) [-842.829] * (-833.890) [-837.617] (-836.127) (-832.155) -- 0:01:28
22500 -- (-845.007) (-832.719) [-843.837] (-843.602) * (-830.917) (-844.597) [-841.019] (-832.906) -- 0:01:26
23000 -- [-836.436] (-836.315) (-842.244) (-836.959) * (-831.834) (-849.644) [-839.487] (-834.613) -- 0:01:24
23500 -- (-840.871) [-831.681] (-840.166) (-842.884) * (-831.192) (-839.394) [-841.893] (-834.434) -- 0:01:23
24000 -- [-841.275] (-834.193) (-842.057) (-838.210) * (-830.275) [-841.231] (-850.400) (-836.075) -- 0:01:21
24500 -- (-837.475) (-833.096) [-837.358] (-847.501) * [-830.911] (-849.087) (-841.188) (-834.990) -- 0:01:19
25000 -- [-841.573] (-831.376) (-840.885) (-841.497) * (-831.841) [-838.079] (-832.561) (-832.579) -- 0:01:18
Average standard deviation of split frequencies: 0.036262
25500 -- (-839.427) (-831.391) [-836.829] (-847.941) * (-833.336) (-839.749) [-832.357] (-831.867) -- 0:01:16
26000 -- [-841.939] (-832.032) (-836.033) (-844.942) * (-831.077) [-840.881] (-832.164) (-832.521) -- 0:01:14
26500 -- [-839.152] (-830.904) (-842.979) (-843.155) * (-833.654) (-844.486) (-831.051) [-832.516] -- 0:01:13
27000 -- (-840.317) [-832.071] (-845.839) (-848.687) * (-834.757) (-840.722) (-832.024) [-832.291] -- 0:01:12
27500 -- (-840.543) [-833.295] (-835.915) (-837.505) * (-832.008) (-843.561) (-832.866) [-833.469] -- 0:01:10
28000 -- (-839.496) [-834.553] (-844.527) (-854.867) * (-834.134) [-839.501] (-833.296) (-831.689) -- 0:01:09
28500 -- (-838.697) [-830.969] (-843.450) (-840.649) * (-831.195) (-849.673) (-830.546) [-831.001] -- 0:01:08
29000 -- (-840.534) (-834.661) [-838.366] (-841.695) * (-831.864) (-837.971) [-830.668] (-832.670) -- 0:01:06
29500 -- [-840.152] (-832.694) (-843.841) (-845.595) * (-830.557) [-838.011] (-832.348) (-832.641) -- 0:01:05
30000 -- (-838.927) (-835.668) (-838.994) [-841.008] * (-832.391) (-847.864) [-834.620] (-832.162) -- 0:01:04
Average standard deviation of split frequencies: 0.038025
30500 -- (-845.093) (-833.773) [-839.979] (-851.985) * [-834.930] (-840.096) (-832.356) (-831.860) -- 0:01:03
31000 -- (-842.663) (-836.420) [-838.966] (-837.382) * (-833.281) (-843.817) (-833.440) [-831.950] -- 0:01:02
31500 -- [-842.400] (-833.612) (-844.517) (-845.388) * (-831.819) [-840.688] (-830.324) (-830.854) -- 0:01:01
32000 -- (-834.409) [-833.619] (-844.854) (-838.352) * (-832.338) (-837.313) (-835.389) [-830.841] -- 0:01:00
32500 -- [-839.926] (-830.572) (-840.229) (-843.229) * (-833.958) (-836.545) [-831.655] (-830.276) -- 0:00:59
33000 -- [-835.521] (-834.281) (-840.609) (-845.544) * (-834.396) [-842.829] (-831.577) (-832.421) -- 0:00:58
33500 -- (-841.447) (-834.496) (-845.837) [-835.250] * (-833.441) (-838.407) (-837.647) [-832.515] -- 0:00:57
34000 -- (-840.335) [-830.474] (-838.243) (-843.456) * (-830.622) (-844.522) [-833.851] (-829.938) -- 0:00:56
34500 -- (-846.958) [-831.330] (-846.659) (-833.090) * (-834.827) (-837.160) (-834.195) [-830.335] -- 0:00:55
35000 -- (-844.084) [-833.668] (-848.396) (-840.864) * (-832.705) [-837.623] (-834.273) (-832.066) -- 0:00:55
Average standard deviation of split frequencies: 0.045176
35500 -- (-852.377) (-831.575) [-837.838] (-840.754) * (-832.608) (-840.243) (-830.710) [-833.421] -- 0:00:54
36000 -- (-849.107) (-831.145) (-835.500) [-841.045] * (-832.303) (-845.107) (-833.063) [-831.736] -- 0:00:53
36500 -- (-843.943) (-832.400) [-838.442] (-840.280) * [-831.405] (-849.334) (-831.392) (-830.959) -- 0:00:52
37000 -- (-840.572) [-832.669] (-841.882) (-848.663) * (-831.777) [-839.556] (-837.530) (-834.062) -- 0:00:52
37500 -- (-835.163) [-831.797] (-840.157) (-840.017) * [-831.705] (-841.631) (-830.408) (-829.821) -- 0:00:51
38000 -- [-836.012] (-833.208) (-840.158) (-843.759) * (-837.077) (-835.669) (-832.278) [-831.392] -- 0:01:15
38500 -- [-837.968] (-834.183) (-846.743) (-842.431) * (-832.266) (-843.466) (-831.543) [-830.432] -- 0:01:14
39000 -- [-838.860] (-833.341) (-841.788) (-850.141) * [-830.243] (-837.414) (-831.085) (-830.564) -- 0:01:13
39500 -- (-838.508) [-830.332] (-846.713) (-840.252) * (-829.945) (-846.754) [-831.991] (-831.825) -- 0:01:12
40000 -- (-846.567) (-832.300) (-847.488) [-839.142] * (-832.552) [-844.704] (-831.350) (-833.368) -- 0:01:12
Average standard deviation of split frequencies: 0.038640
40500 -- (-837.985) (-834.267) [-841.114] (-844.076) * (-835.331) (-839.697) [-831.853] (-832.437) -- 0:01:11
41000 -- (-841.925) [-835.010] (-846.822) (-842.906) * (-830.939) (-839.331) (-832.535) [-836.467] -- 0:01:10
41500 -- [-846.350] (-832.756) (-835.413) (-848.990) * (-830.530) (-840.043) [-831.916] (-835.317) -- 0:01:09
42000 -- (-838.893) (-832.691) (-842.739) [-840.507] * (-831.053) (-839.365) (-830.433) [-834.840] -- 0:01:08
42500 -- (-841.308) [-831.527] (-851.600) (-843.280) * (-833.477) (-840.251) (-831.169) [-831.975] -- 0:01:07
43000 -- (-843.379) (-832.044) (-845.241) [-839.553] * (-834.793) [-837.395] (-830.152) (-834.788) -- 0:01:06
43500 -- [-840.510] (-832.596) (-846.732) (-839.639) * (-831.694) [-841.441] (-831.172) (-833.037) -- 0:01:05
44000 -- (-835.928) [-831.875] (-844.769) (-843.837) * (-830.450) [-846.570] (-831.081) (-830.488) -- 0:01:05
44500 -- (-846.262) (-832.579) (-844.659) [-836.643] * (-831.252) [-842.522] (-830.361) (-832.032) -- 0:01:04
45000 -- (-841.458) [-831.641] (-843.482) (-849.073) * [-834.451] (-851.285) (-830.585) (-832.379) -- 0:01:03
Average standard deviation of split frequencies: 0.038430
45500 -- (-839.673) [-830.862] (-835.706) (-837.680) * (-832.874) (-833.980) [-830.021] (-835.091) -- 0:01:02
46000 -- [-839.405] (-831.048) (-843.345) (-844.814) * [-831.761] (-832.119) (-831.994) (-836.149) -- 0:01:02
46500 -- [-842.381] (-831.955) (-844.079) (-847.886) * (-830.852) [-830.879] (-830.478) (-831.573) -- 0:01:01
47000 -- (-842.403) (-831.674) (-847.353) [-840.710] * (-838.819) (-831.302) [-832.541] (-834.052) -- 0:01:00
47500 -- [-836.745] (-832.175) (-842.907) (-843.853) * (-836.206) [-832.045] (-835.624) (-831.934) -- 0:01:00
48000 -- (-842.750) [-831.119] (-846.588) (-846.378) * (-836.803) (-836.034) (-835.103) [-831.778] -- 0:00:59
48500 -- (-845.992) (-833.681) (-848.662) [-841.283] * (-838.591) (-833.232) [-831.279] (-832.295) -- 0:00:58
49000 -- [-839.288] (-833.182) (-846.974) (-843.364) * (-830.509) [-831.275] (-833.751) (-833.293) -- 0:00:58
49500 -- (-843.286) (-830.849) [-838.774] (-843.305) * [-830.361] (-832.709) (-831.276) (-830.292) -- 0:00:57
50000 -- (-845.114) (-831.459) [-837.921] (-838.115) * (-832.703) [-831.436] (-832.001) (-829.889) -- 0:00:57
Average standard deviation of split frequencies: 0.036286
50500 -- (-840.760) [-831.337] (-838.892) (-846.601) * (-832.821) (-831.366) (-830.979) [-830.847] -- 0:00:56
51000 -- (-838.314) [-831.187] (-835.718) (-844.555) * (-830.220) (-831.642) (-833.064) [-830.872] -- 0:00:55
51500 -- (-845.456) [-832.475] (-847.569) (-846.231) * (-831.012) (-830.497) [-835.494] (-831.112) -- 0:00:55
52000 -- (-846.532) [-831.980] (-853.104) (-840.558) * [-830.416] (-831.583) (-837.716) (-832.865) -- 0:00:54
52500 -- [-835.139] (-832.442) (-845.825) (-839.141) * (-830.513) (-833.094) [-833.652] (-836.820) -- 0:00:54
53000 -- (-839.669) (-833.531) (-851.364) [-840.659] * (-831.856) (-835.851) [-832.396] (-834.554) -- 0:00:53
53500 -- [-844.291] (-832.536) (-837.721) (-841.280) * [-831.459] (-833.303) (-832.890) (-839.134) -- 0:00:53
54000 -- (-841.626) (-832.677) [-832.199] (-849.293) * (-833.567) (-833.874) [-833.383] (-832.029) -- 0:00:52
54500 -- [-841.995] (-832.950) (-830.454) (-841.215) * (-834.261) (-832.324) (-834.066) [-832.449] -- 0:01:09
55000 -- (-845.460) [-831.134] (-830.594) (-848.167) * (-837.056) [-830.123] (-835.675) (-837.215) -- 0:01:08
Average standard deviation of split frequencies: 0.029042
55500 -- (-842.526) (-831.346) [-834.417] (-838.049) * (-830.306) (-830.860) (-832.000) [-831.395] -- 0:01:08
56000 -- (-844.948) (-831.121) [-834.298] (-848.133) * (-832.906) [-832.626] (-830.206) (-830.631) -- 0:01:07
56500 -- [-836.405] (-831.919) (-831.435) (-841.323) * (-834.771) (-835.028) [-831.316] (-833.430) -- 0:01:06
57000 -- (-839.911) (-831.968) [-834.488] (-841.639) * [-832.429] (-833.127) (-830.652) (-835.917) -- 0:01:06
57500 -- (-846.047) (-831.320) [-832.458] (-841.717) * (-834.245) [-832.747] (-832.682) (-834.197) -- 0:01:05
58000 -- [-836.587] (-831.763) (-832.611) (-838.044) * (-830.554) (-832.221) [-831.850] (-830.749) -- 0:01:04
58500 -- (-839.863) (-832.708) (-831.652) [-840.395] * (-831.148) [-835.218] (-831.270) (-832.350) -- 0:01:04
59000 -- (-840.887) (-831.476) (-830.935) [-839.088] * [-830.486] (-831.332) (-833.097) (-834.533) -- 0:01:03
59500 -- [-841.715] (-830.925) (-830.409) (-838.027) * (-830.697) (-829.906) (-835.733) [-830.026] -- 0:01:03
60000 -- (-848.102) (-831.165) (-834.038) [-837.023] * (-831.085) [-830.280] (-832.863) (-831.881) -- 0:01:02
Average standard deviation of split frequencies: 0.028219
60500 -- (-840.782) (-829.986) (-834.142) [-847.907] * (-831.756) (-830.345) [-832.160] (-830.756) -- 0:01:02
61000 -- (-842.975) (-831.561) (-835.267) [-844.337] * (-830.740) (-834.242) (-833.087) [-829.925] -- 0:01:01
61500 -- [-836.328] (-833.045) (-833.107) (-857.788) * (-834.076) [-833.085] (-835.271) (-830.101) -- 0:01:01
62000 -- [-847.230] (-832.049) (-832.713) (-842.056) * (-834.699) (-833.273) (-832.947) [-832.502] -- 0:01:00
62500 -- (-844.450) [-831.933] (-832.429) (-844.334) * (-830.008) [-830.654] (-830.868) (-834.335) -- 0:01:00
63000 -- [-840.556] (-834.080) (-831.703) (-836.380) * [-832.042] (-832.824) (-830.192) (-833.943) -- 0:00:59
63500 -- (-842.715) [-832.045] (-832.257) (-833.164) * [-831.253] (-832.474) (-831.451) (-832.024) -- 0:00:58
64000 -- [-836.163] (-831.690) (-832.470) (-832.675) * (-831.856) (-831.510) (-832.192) [-834.147] -- 0:00:58
64500 -- [-837.323] (-830.434) (-831.395) (-832.012) * (-833.530) [-832.009] (-830.221) (-831.592) -- 0:00:58
65000 -- (-840.839) (-830.562) (-832.569) [-831.675] * (-833.162) (-832.798) (-831.251) [-832.191] -- 0:00:57
Average standard deviation of split frequencies: 0.028570
65500 -- (-844.977) [-831.486] (-834.061) (-830.349) * (-834.053) (-830.514) [-830.765] (-832.568) -- 0:00:57
66000 -- (-841.945) [-831.042] (-834.539) (-831.746) * (-832.939) (-832.477) [-831.284] (-830.674) -- 0:00:56
66500 -- [-836.460] (-831.983) (-840.881) (-830.468) * [-831.993] (-830.910) (-830.296) (-831.993) -- 0:00:56
67000 -- (-839.010) (-835.033) (-834.511) [-833.006] * (-832.400) (-832.031) (-837.573) [-833.159] -- 0:00:55
67500 -- (-843.261) (-834.572) (-834.885) [-834.209] * [-832.960] (-831.321) (-830.267) (-833.929) -- 0:00:55
68000 -- (-841.955) [-834.566] (-833.150) (-832.760) * (-835.478) [-830.760] (-833.099) (-834.770) -- 0:00:54
68500 -- (-835.864) [-832.283] (-833.130) (-835.102) * (-835.257) (-830.706) [-831.978] (-835.363) -- 0:00:54
69000 -- (-836.179) (-833.302) (-838.369) [-830.241] * (-831.501) (-830.308) [-831.840] (-831.493) -- 0:00:53
69500 -- (-842.520) [-831.172] (-835.932) (-831.703) * (-835.370) (-833.417) (-835.748) [-830.859] -- 0:00:53
70000 -- (-842.352) [-831.786] (-831.992) (-831.826) * (-834.650) [-830.875] (-832.929) (-829.887) -- 0:00:53
Average standard deviation of split frequencies: 0.024142
70500 -- (-843.264) (-834.886) [-831.692] (-831.131) * [-830.021] (-834.227) (-833.790) (-834.052) -- 0:00:52
71000 -- [-844.995] (-832.683) (-830.067) (-832.246) * (-830.002) (-831.292) (-831.597) [-833.154] -- 0:01:05
71500 -- (-836.540) (-830.193) (-830.318) [-833.970] * [-832.054] (-835.034) (-829.825) (-832.307) -- 0:01:04
72000 -- (-846.091) [-831.112] (-832.237) (-830.106) * (-830.895) (-834.539) [-832.434] (-832.261) -- 0:01:04
72500 -- (-853.894) [-831.335] (-831.864) (-832.159) * (-835.415) (-831.830) (-832.229) [-832.914] -- 0:01:03
73000 -- (-842.236) (-833.336) [-832.994] (-833.566) * [-832.801] (-833.082) (-831.533) (-831.553) -- 0:01:03
73500 -- (-843.684) [-834.307] (-831.771) (-834.691) * (-832.280) (-835.272) (-832.309) [-832.005] -- 0:01:03
74000 -- [-841.469] (-833.457) (-832.176) (-831.026) * (-831.584) (-830.612) (-831.357) [-831.811] -- 0:01:02
74500 -- (-847.583) [-833.780] (-830.675) (-832.460) * (-831.439) (-831.968) [-831.309] (-831.013) -- 0:01:02
75000 -- (-837.074) (-833.453) (-833.713) [-831.626] * (-832.837) (-830.936) [-830.828] (-832.254) -- 0:01:01
Average standard deviation of split frequencies: 0.022743
75500 -- [-837.816] (-831.487) (-835.005) (-831.208) * (-834.459) [-832.602] (-833.403) (-831.782) -- 0:01:01
76000 -- [-838.456] (-831.471) (-833.923) (-832.774) * (-831.481) (-833.850) [-831.585] (-832.347) -- 0:01:00
76500 -- [-843.274] (-831.139) (-839.342) (-832.564) * (-832.233) (-830.235) [-830.518] (-834.128) -- 0:01:00
77000 -- [-842.364] (-832.160) (-836.047) (-830.575) * (-831.555) [-830.268] (-835.176) (-841.552) -- 0:00:59
77500 -- [-836.934] (-830.616) (-831.175) (-830.705) * (-832.306) (-832.429) (-832.078) [-831.776] -- 0:00:59
78000 -- [-841.938] (-833.748) (-832.646) (-833.423) * (-830.514) (-831.553) (-833.171) [-832.632] -- 0:00:59
78500 -- (-848.819) (-830.590) [-834.137] (-834.168) * (-832.216) (-830.328) (-833.470) [-832.001] -- 0:00:58
79000 -- (-843.893) (-832.243) (-835.712) [-830.652] * (-830.827) (-832.241) (-832.086) [-831.012] -- 0:00:58
79500 -- [-842.335] (-832.787) (-833.227) (-832.574) * (-832.016) (-832.477) [-831.564] (-834.076) -- 0:00:57
80000 -- [-840.480] (-830.764) (-833.166) (-831.222) * (-831.011) (-830.375) (-833.679) [-831.996] -- 0:00:57
Average standard deviation of split frequencies: 0.020871
80500 -- [-839.977] (-829.910) (-835.322) (-830.499) * (-830.648) (-831.124) (-830.849) [-830.686] -- 0:00:57
81000 -- (-841.883) (-831.065) (-833.413) [-830.390] * [-831.273] (-832.056) (-832.249) (-834.108) -- 0:00:56
81500 -- (-841.430) (-831.486) (-831.633) [-830.775] * (-832.118) (-832.677) [-830.085] (-832.849) -- 0:00:56
82000 -- (-847.489) (-830.747) (-830.959) [-830.938] * (-831.035) (-833.429) [-830.005] (-832.137) -- 0:00:55
82500 -- (-846.991) (-831.632) [-830.618] (-833.324) * [-830.802] (-831.569) (-829.679) (-833.100) -- 0:00:55
83000 -- (-846.693) (-830.032) (-830.009) [-830.814] * (-831.066) (-832.095) [-832.659] (-833.268) -- 0:00:55
83500 -- (-864.521) [-835.787] (-830.218) (-831.917) * [-831.464] (-831.782) (-832.597) (-832.711) -- 0:00:54
84000 -- (-831.519) [-834.141] (-835.031) (-832.293) * (-832.788) (-830.954) (-833.630) [-830.304] -- 0:00:54
84500 -- (-834.198) (-832.833) [-834.560] (-833.710) * (-833.005) (-830.627) (-838.492) [-830.660] -- 0:00:54
85000 -- (-831.017) [-835.953] (-835.240) (-834.112) * (-833.513) [-831.241] (-832.246) (-836.548) -- 0:00:53
Average standard deviation of split frequencies: 0.022175
85500 -- (-830.565) [-833.542] (-835.164) (-835.479) * (-831.434) (-832.066) [-832.915] (-835.062) -- 0:00:53
86000 -- [-830.754] (-835.077) (-835.713) (-835.015) * [-831.752] (-831.382) (-834.929) (-832.190) -- 0:00:53
86500 -- (-830.758) (-833.752) (-832.116) [-830.022] * (-831.155) (-835.454) (-830.505) [-831.137] -- 0:00:52
87000 -- (-833.460) (-832.098) [-833.455] (-830.811) * (-832.270) (-832.904) [-830.357] (-831.136) -- 0:00:52
87500 -- (-838.612) (-831.208) [-833.513] (-831.926) * (-835.098) (-831.454) (-831.594) [-830.869] -- 0:01:02
88000 -- [-832.099] (-832.430) (-830.916) (-835.031) * [-833.159] (-830.730) (-832.453) (-833.765) -- 0:01:02
88500 -- (-832.414) (-831.195) [-830.366] (-832.769) * (-835.373) (-831.244) (-835.179) [-835.228] -- 0:01:01
89000 -- (-831.973) [-832.667] (-831.283) (-833.262) * (-832.085) (-832.764) [-832.901] (-832.510) -- 0:01:01
89500 -- [-833.270] (-834.507) (-831.818) (-833.598) * [-830.819] (-832.498) (-831.451) (-834.851) -- 0:01:01
90000 -- [-831.811] (-831.010) (-834.043) (-833.569) * (-830.033) [-835.236] (-833.453) (-834.233) -- 0:01:00
Average standard deviation of split frequencies: 0.021577
90500 -- (-832.696) [-831.374] (-833.058) (-834.721) * (-830.200) [-834.162] (-831.433) (-833.860) -- 0:01:00
91000 -- (-832.260) (-836.195) (-833.486) [-832.648] * [-830.776] (-831.501) (-831.958) (-835.494) -- 0:00:59
91500 -- [-833.885] (-830.618) (-832.853) (-830.758) * (-832.018) (-831.490) (-833.199) [-833.281] -- 0:00:59
92000 -- (-831.191) (-832.142) (-837.543) [-833.568] * (-835.052) (-833.992) [-833.202] (-840.239) -- 0:00:59
92500 -- (-836.457) (-832.527) [-830.490] (-832.752) * [-833.110] (-834.077) (-834.120) (-836.699) -- 0:00:58
93000 -- (-833.067) (-833.154) [-832.461] (-835.152) * (-832.056) (-830.290) [-834.281] (-829.995) -- 0:00:58
93500 -- (-831.778) [-832.167] (-833.998) (-831.282) * (-832.433) (-831.951) (-833.066) [-831.681] -- 0:00:58
94000 -- (-831.978) (-834.065) [-830.161] (-834.113) * (-833.572) (-832.531) (-831.518) [-830.466] -- 0:00:57
94500 -- (-837.574) (-832.893) (-831.685) [-834.099] * (-832.113) [-830.010] (-831.598) (-830.847) -- 0:00:57
95000 -- [-833.557] (-834.958) (-833.815) (-832.488) * [-831.925] (-830.203) (-831.373) (-831.000) -- 0:00:57
Average standard deviation of split frequencies: 0.023816
95500 -- (-832.365) [-831.638] (-832.851) (-832.127) * (-833.195) [-832.736] (-831.444) (-832.458) -- 0:00:56
96000 -- (-834.587) [-837.371] (-831.363) (-833.831) * (-833.042) [-831.729] (-832.535) (-831.384) -- 0:00:56
96500 -- (-832.015) (-831.002) (-830.774) [-831.481] * (-835.848) (-829.838) (-831.462) [-831.399] -- 0:00:56
97000 -- (-831.216) (-831.479) [-832.078] (-831.123) * [-830.555] (-831.686) (-834.085) (-831.458) -- 0:00:55
97500 -- (-830.402) (-831.158) [-830.715] (-830.897) * [-832.253] (-832.700) (-832.625) (-831.713) -- 0:00:55
98000 -- (-833.068) (-834.169) [-831.523] (-830.624) * (-833.181) [-831.431] (-832.010) (-829.864) -- 0:00:55
98500 -- (-830.777) (-832.045) [-831.698] (-831.631) * (-833.259) [-830.115] (-832.172) (-829.777) -- 0:00:54
99000 -- (-832.509) (-831.156) [-832.003] (-830.012) * (-833.712) (-831.783) (-833.549) [-830.616] -- 0:00:54
99500 -- [-832.384] (-830.788) (-832.088) (-832.549) * (-830.975) [-833.766] (-834.672) (-833.665) -- 0:00:54
100000 -- (-830.916) (-835.337) (-834.752) [-830.730] * (-830.466) (-832.614) [-831.410] (-832.032) -- 0:00:54
Average standard deviation of split frequencies: 0.019964
100500 -- (-830.240) (-831.379) (-831.553) [-830.187] * (-830.781) (-834.589) [-831.765] (-832.032) -- 0:00:53
101000 -- (-833.139) (-830.513) (-834.653) [-830.309] * (-831.396) (-832.610) [-831.326] (-832.293) -- 0:00:53
101500 -- [-830.303] (-831.424) (-831.309) (-833.105) * (-831.237) (-832.399) (-834.395) [-830.442] -- 0:00:53
102000 -- (-830.714) (-829.842) (-832.724) [-831.520] * [-831.089] (-833.342) (-831.863) (-832.136) -- 0:00:52
102500 -- (-835.275) [-830.374] (-833.834) (-832.773) * (-831.881) (-832.878) [-834.091] (-834.857) -- 0:00:52
103000 -- (-834.305) [-830.055] (-832.517) (-830.546) * (-831.927) (-836.269) [-832.441] (-836.823) -- 0:00:52
103500 -- (-837.533) [-830.875] (-830.577) (-830.306) * (-831.482) (-831.877) [-833.611] (-831.437) -- 0:00:51
104000 -- (-833.131) (-830.079) [-831.727] (-831.077) * (-833.175) [-833.341] (-831.114) (-831.027) -- 0:00:51
104500 -- (-835.268) [-831.127] (-830.022) (-832.150) * (-829.823) (-833.877) (-832.660) [-831.212] -- 0:00:59
105000 -- (-832.647) [-832.270] (-831.505) (-831.849) * (-829.828) (-833.993) (-831.357) [-833.531] -- 0:00:59
Average standard deviation of split frequencies: 0.020012
105500 -- [-831.753] (-831.482) (-832.085) (-832.829) * (-830.041) (-831.643) (-831.054) [-830.645] -- 0:00:59
106000 -- [-830.090] (-832.584) (-830.616) (-830.499) * (-835.042) (-832.308) [-831.012] (-830.426) -- 0:00:59
106500 -- (-832.810) [-830.745] (-835.562) (-836.937) * (-833.390) (-831.797) [-833.093] (-832.073) -- 0:00:58
107000 -- (-831.240) [-831.830] (-831.346) (-836.219) * (-833.842) [-831.357] (-832.734) (-831.147) -- 0:00:58
107500 -- (-833.134) [-832.636] (-831.105) (-831.879) * (-831.136) [-831.468] (-831.757) (-833.008) -- 0:00:58
108000 -- (-832.060) [-830.487] (-830.148) (-831.776) * [-832.898] (-831.314) (-833.335) (-833.105) -- 0:00:57
108500 -- (-831.391) [-833.698] (-831.625) (-832.095) * (-832.081) [-835.097] (-831.125) (-835.045) -- 0:00:57
109000 -- (-837.486) (-832.763) [-829.905] (-834.081) * (-835.672) (-833.901) [-831.161] (-839.945) -- 0:00:57
109500 -- (-835.797) [-836.136] (-836.860) (-831.489) * (-840.352) (-831.939) (-832.921) [-831.231] -- 0:00:56
110000 -- (-833.899) (-831.795) (-831.475) [-831.713] * (-831.503) (-830.682) (-830.436) [-831.513] -- 0:00:56
Average standard deviation of split frequencies: 0.021937
110500 -- (-833.978) (-831.339) (-833.690) [-832.360] * (-831.035) (-830.750) (-831.451) [-833.041] -- 0:00:56
111000 -- (-836.711) (-830.850) [-833.927] (-831.648) * (-829.971) [-833.330] (-833.873) (-833.605) -- 0:00:56
111500 -- (-836.769) (-830.982) [-832.818] (-833.591) * [-831.114] (-831.559) (-832.180) (-838.251) -- 0:00:55
112000 -- (-831.973) [-831.044] (-831.147) (-831.732) * [-831.366] (-834.087) (-831.153) (-838.702) -- 0:00:55
112500 -- (-830.519) (-832.295) [-831.940] (-831.407) * (-830.118) [-834.038] (-830.892) (-838.586) -- 0:00:55
113000 -- (-830.878) [-830.660] (-835.906) (-831.860) * (-831.519) [-835.190] (-831.137) (-834.439) -- 0:00:54
113500 -- (-836.789) [-831.108] (-832.161) (-835.907) * [-829.785] (-832.590) (-834.873) (-832.245) -- 0:00:54
114000 -- (-834.643) (-831.391) [-830.372] (-832.163) * (-829.835) (-833.124) (-830.755) [-831.596] -- 0:00:54
114500 -- (-833.196) (-831.278) (-830.111) [-832.785] * (-832.631) (-833.655) [-831.993] (-832.790) -- 0:00:54
115000 -- (-831.300) (-830.448) [-830.159] (-830.886) * (-830.513) (-830.367) [-829.994] (-833.351) -- 0:00:53
Average standard deviation of split frequencies: 0.020726
115500 -- [-833.652] (-830.901) (-837.541) (-833.030) * (-832.111) [-833.055] (-833.712) (-833.723) -- 0:00:53
116000 -- [-830.552] (-831.238) (-831.299) (-830.312) * (-832.798) (-831.257) (-831.187) [-834.106] -- 0:00:53
116500 -- (-831.868) (-835.192) (-833.560) [-836.964] * (-830.411) (-833.188) (-832.063) [-831.824] -- 0:00:53
117000 -- (-830.852) (-833.312) [-832.427] (-832.653) * (-830.331) [-830.391] (-833.169) (-833.672) -- 0:00:52
117500 -- (-836.588) (-834.192) (-831.984) [-831.160] * (-833.296) (-830.660) [-830.580] (-832.231) -- 0:00:52
118000 -- [-830.481] (-835.111) (-832.990) (-833.536) * (-832.913) (-831.811) [-831.553] (-831.931) -- 0:00:52
118500 -- (-830.481) (-832.781) (-831.800) [-830.190] * (-833.518) (-832.504) [-830.371] (-832.088) -- 0:00:52
119000 -- (-830.464) (-832.470) (-831.316) [-830.382] * [-832.404] (-831.220) (-831.096) (-832.753) -- 0:00:51
119500 -- [-830.191] (-833.584) (-832.684) (-830.875) * (-834.260) (-830.359) [-830.692] (-831.117) -- 0:00:51
120000 -- (-830.082) (-837.395) (-831.451) [-830.199] * (-839.616) (-830.334) (-834.162) [-832.757] -- 0:00:51
Average standard deviation of split frequencies: 0.020973
120500 -- (-832.543) (-830.419) [-830.302] (-831.543) * (-829.770) (-830.494) (-832.232) [-833.809] -- 0:00:58
121000 -- (-833.247) (-831.787) (-833.760) [-831.531] * [-829.781] (-833.858) (-831.930) (-831.760) -- 0:00:58
121500 -- (-831.212) (-830.626) [-834.280] (-831.490) * [-830.851] (-831.705) (-834.029) (-830.172) -- 0:00:57
122000 -- [-834.680] (-829.893) (-831.614) (-831.013) * (-831.107) [-830.457] (-835.056) (-832.450) -- 0:00:57
122500 -- (-832.650) [-831.930] (-830.878) (-835.129) * (-831.325) [-831.658] (-830.546) (-833.454) -- 0:00:57
123000 -- (-831.332) (-832.090) (-830.493) [-830.176] * (-831.285) [-835.420] (-830.295) (-836.031) -- 0:00:57
123500 -- (-832.968) (-836.925) (-830.386) [-831.883] * (-833.296) (-832.273) (-831.306) [-831.313] -- 0:00:56
124000 -- (-835.581) (-831.316) [-830.858] (-835.112) * (-830.800) (-831.051) (-830.891) [-836.358] -- 0:00:56
124500 -- (-830.007) (-831.479) (-830.920) [-830.853] * (-831.806) (-832.862) (-833.345) [-834.005] -- 0:00:56
125000 -- (-829.998) (-831.920) [-830.237] (-831.756) * (-832.615) (-833.484) (-838.842) [-832.432] -- 0:00:56
Average standard deviation of split frequencies: 0.020203
125500 -- (-830.944) [-831.918] (-834.829) (-831.774) * [-833.548] (-832.736) (-837.678) (-838.833) -- 0:00:55
126000 -- (-833.202) [-830.671] (-831.303) (-833.382) * (-834.102) (-833.264) [-836.982] (-840.023) -- 0:00:55
126500 -- [-831.529] (-830.783) (-830.436) (-830.815) * (-836.158) [-831.875] (-831.837) (-835.770) -- 0:00:55
127000 -- (-832.979) (-833.017) (-832.686) [-831.492] * (-835.983) [-831.243] (-830.767) (-836.135) -- 0:00:54
127500 -- (-831.932) [-832.998] (-830.114) (-831.650) * (-834.083) (-832.265) [-832.568] (-831.383) -- 0:00:54
128000 -- (-831.246) [-831.040] (-833.899) (-834.685) * (-836.102) (-832.058) (-833.491) [-831.090] -- 0:00:54
128500 -- (-831.648) [-832.279] (-829.824) (-839.371) * [-831.610] (-835.176) (-830.945) (-835.250) -- 0:00:54
129000 -- [-830.948] (-830.539) (-830.144) (-835.803) * (-830.963) (-835.071) [-832.104] (-833.641) -- 0:00:54
129500 -- (-830.348) (-833.312) [-832.129] (-833.075) * [-831.496] (-833.754) (-832.429) (-831.755) -- 0:00:53
130000 -- [-831.613] (-831.586) (-830.635) (-831.364) * [-832.627] (-832.472) (-831.099) (-830.197) -- 0:00:53
Average standard deviation of split frequencies: 0.018988
130500 -- (-831.313) [-830.833] (-831.846) (-831.448) * (-833.247) [-832.088] (-833.347) (-830.389) -- 0:00:53
131000 -- (-834.847) (-830.998) (-834.096) [-830.740] * (-834.210) [-832.021] (-830.039) (-830.692) -- 0:00:53
131500 -- (-836.171) [-832.550] (-831.789) (-832.256) * [-830.370] (-831.784) (-830.721) (-831.252) -- 0:00:52
132000 -- (-831.116) (-833.986) [-832.844] (-832.201) * [-830.146] (-830.694) (-831.582) (-833.583) -- 0:00:52
132500 -- (-830.935) (-841.514) (-833.340) [-830.985] * (-834.324) (-831.510) [-830.891] (-836.571) -- 0:00:52
133000 -- [-830.344] (-833.055) (-832.997) (-831.220) * (-835.312) [-834.219] (-832.316) (-831.623) -- 0:00:52
133500 -- (-830.538) (-831.982) (-838.092) [-833.092] * [-832.332] (-834.375) (-830.375) (-830.609) -- 0:00:51
134000 -- (-832.824) (-831.050) (-834.769) [-831.119] * (-832.072) (-830.909) (-830.542) [-831.141] -- 0:00:51
134500 -- [-835.803] (-830.921) (-832.389) (-831.458) * (-836.017) [-831.966] (-831.890) (-830.798) -- 0:00:51
135000 -- (-834.895) (-832.525) [-831.221] (-831.545) * (-830.900) (-831.609) [-831.512] (-830.534) -- 0:00:51
Average standard deviation of split frequencies: 0.019885
135500 -- (-831.637) (-831.397) [-832.008] (-831.255) * (-830.713) [-831.922] (-831.759) (-830.064) -- 0:00:51
136000 -- (-831.573) (-833.958) (-832.585) [-831.521] * (-830.209) [-831.375] (-832.498) (-831.810) -- 0:00:50
136500 -- [-830.580] (-832.651) (-830.936) (-832.402) * (-835.071) (-832.548) (-834.342) [-833.225] -- 0:00:50
137000 -- (-830.806) (-831.309) (-830.429) [-829.997] * (-834.901) (-832.449) (-832.973) [-832.288] -- 0:00:50
137500 -- (-833.567) [-834.761] (-831.849) (-832.151) * (-830.429) [-830.496] (-830.615) (-831.600) -- 0:00:56
138000 -- (-835.848) (-833.291) (-833.455) [-834.639] * (-832.516) (-836.173) [-830.029] (-830.505) -- 0:00:56
138500 -- (-832.782) [-832.378] (-831.795) (-831.776) * [-832.752] (-831.772) (-830.042) (-831.668) -- 0:00:55
139000 -- [-831.241] (-833.190) (-831.718) (-835.829) * (-834.191) [-831.472] (-833.920) (-831.982) -- 0:00:55
139500 -- [-830.324] (-832.113) (-829.993) (-831.324) * (-833.748) (-833.252) [-834.956] (-832.409) -- 0:00:55
140000 -- (-832.143) (-830.750) (-832.056) [-832.413] * (-833.448) [-833.606] (-831.100) (-832.968) -- 0:00:55
Average standard deviation of split frequencies: 0.020284
140500 -- (-832.251) (-833.908) (-836.094) [-832.828] * (-830.426) (-832.770) [-829.831] (-831.416) -- 0:00:55
141000 -- [-834.340] (-836.382) (-832.098) (-832.893) * (-832.770) (-832.762) (-830.309) [-835.375] -- 0:00:54
141500 -- (-835.185) (-833.171) (-835.277) [-830.541] * (-831.856) (-833.632) (-829.962) [-831.877] -- 0:00:54
142000 -- (-836.546) (-833.137) (-833.153) [-831.168] * (-834.555) (-834.878) [-833.734] (-835.840) -- 0:00:54
142500 -- (-842.581) (-830.566) [-832.685] (-831.292) * (-834.434) (-834.100) [-831.430] (-833.765) -- 0:00:54
143000 -- (-839.185) [-832.157] (-834.737) (-833.771) * [-831.597] (-835.440) (-837.322) (-830.570) -- 0:00:53
143500 -- (-832.746) (-832.606) [-837.650] (-835.557) * [-831.437] (-834.432) (-832.256) (-831.243) -- 0:00:53
144000 -- (-833.324) [-833.466] (-832.620) (-832.445) * (-831.045) (-831.980) [-830.996] (-831.753) -- 0:00:53
144500 -- (-832.409) (-830.878) (-833.131) [-832.216] * [-830.267] (-832.528) (-831.855) (-830.323) -- 0:00:53
145000 -- [-831.550] (-831.963) (-830.883) (-831.755) * [-831.857] (-833.764) (-836.024) (-830.767) -- 0:00:53
Average standard deviation of split frequencies: 0.017274
145500 -- (-831.119) (-834.533) [-831.698] (-833.777) * (-832.149) (-837.786) (-833.263) [-830.801] -- 0:00:52
146000 -- (-830.834) (-832.073) (-831.695) [-832.163] * (-834.189) (-839.148) (-831.255) [-833.125] -- 0:00:52
146500 -- [-834.501] (-832.785) (-832.311) (-833.930) * (-831.200) (-841.151) [-832.651] (-831.917) -- 0:00:52
147000 -- [-831.699] (-831.122) (-833.472) (-831.185) * (-831.607) (-836.857) (-830.088) [-830.748] -- 0:00:52
147500 -- (-830.701) [-831.339] (-830.532) (-831.662) * [-831.881] (-831.680) (-833.698) (-830.390) -- 0:00:52
148000 -- (-831.721) (-831.063) (-830.465) [-830.029] * (-830.771) (-831.415) (-840.455) [-830.378] -- 0:00:51
148500 -- (-831.169) (-833.758) [-830.934] (-830.887) * (-836.117) [-835.495] (-832.719) (-836.207) -- 0:00:51
149000 -- (-831.473) (-837.519) (-831.635) [-831.445] * (-832.081) (-837.160) (-831.553) [-833.122] -- 0:00:51
149500 -- (-837.316) (-832.243) [-830.825] (-831.678) * (-832.596) [-831.760] (-830.607) (-830.779) -- 0:00:51
150000 -- (-840.097) (-831.919) [-831.223] (-831.136) * [-831.512] (-837.827) (-830.720) (-831.249) -- 0:00:51
Average standard deviation of split frequencies: 0.018114
150500 -- (-832.593) [-832.181] (-834.013) (-830.196) * (-833.985) [-834.560] (-831.844) (-833.466) -- 0:00:50
151000 -- (-831.406) (-831.212) [-834.534] (-831.213) * (-837.346) (-832.822) [-831.697] (-834.403) -- 0:00:50
151500 -- (-830.293) (-833.833) (-830.424) [-831.833] * (-835.983) [-834.007] (-831.108) (-831.163) -- 0:00:50
152000 -- (-830.607) (-833.824) [-830.155] (-833.440) * [-833.660] (-830.917) (-831.725) (-832.227) -- 0:00:50
152500 -- (-831.525) (-831.129) [-832.520] (-834.698) * [-831.559] (-832.155) (-832.843) (-833.719) -- 0:00:50
153000 -- (-834.978) [-831.404] (-830.314) (-831.279) * (-832.287) (-831.758) (-834.116) [-832.318] -- 0:00:49
153500 -- (-830.530) (-831.096) [-831.376] (-832.712) * (-834.936) (-831.956) (-830.605) [-831.217] -- 0:00:49
154000 -- (-831.373) (-830.402) (-831.379) [-832.770] * (-831.933) (-833.346) [-832.938] (-833.390) -- 0:00:49
154500 -- [-831.112] (-831.008) (-832.181) (-831.279) * (-831.695) (-830.525) (-831.858) [-830.495] -- 0:00:54
155000 -- (-830.781) [-830.528] (-832.113) (-832.689) * [-832.628] (-832.065) (-831.669) (-830.511) -- 0:00:54
Average standard deviation of split frequencies: 0.018290
155500 -- (-832.455) (-833.273) (-830.043) [-833.175] * (-835.490) [-834.543] (-833.769) (-831.135) -- 0:00:54
156000 -- (-830.688) (-831.765) [-830.472] (-833.138) * [-837.238] (-833.154) (-830.623) (-832.911) -- 0:00:54
156500 -- (-830.689) (-831.039) (-832.490) [-831.495] * (-830.989) (-832.707) [-834.288] (-838.985) -- 0:00:53
157000 -- [-837.472] (-830.000) (-838.189) (-833.089) * (-832.455) (-831.420) (-833.048) [-835.513] -- 0:00:53
157500 -- (-829.963) [-830.825] (-836.749) (-830.107) * (-831.261) [-830.711] (-832.589) (-833.188) -- 0:00:53
158000 -- (-832.012) (-830.884) (-831.889) [-829.678] * (-831.570) (-831.928) (-835.495) [-833.525] -- 0:00:53
158500 -- (-833.464) (-834.371) [-835.575] (-832.766) * (-832.354) [-831.008] (-836.381) (-831.546) -- 0:00:53
159000 -- [-833.506] (-835.221) (-833.697) (-829.887) * (-832.078) [-831.651] (-835.917) (-830.564) -- 0:00:52
159500 -- (-830.323) (-831.002) [-833.000] (-832.856) * [-832.110] (-830.695) (-831.961) (-833.235) -- 0:00:52
160000 -- (-829.892) (-832.382) (-837.967) [-830.198] * [-832.893] (-832.172) (-834.163) (-830.925) -- 0:00:52
Average standard deviation of split frequencies: 0.018908
160500 -- (-831.776) [-830.897] (-832.869) (-832.953) * (-834.834) [-833.510] (-830.343) (-830.394) -- 0:00:52
161000 -- (-829.944) (-830.175) (-831.007) [-831.253] * (-833.366) (-834.942) [-830.341] (-830.199) -- 0:00:52
161500 -- (-830.231) (-835.606) (-831.807) [-830.891] * (-831.478) [-833.541] (-830.922) (-831.716) -- 0:00:51
162000 -- [-832.147] (-835.424) (-830.562) (-832.224) * (-832.484) (-832.533) [-832.032] (-830.887) -- 0:00:51
162500 -- (-836.536) (-832.845) (-833.257) [-832.099] * (-830.142) (-831.721) [-832.796] (-834.689) -- 0:00:51
163000 -- [-835.299] (-832.226) (-831.705) (-833.062) * (-831.297) (-831.802) [-831.517] (-832.085) -- 0:00:51
163500 -- (-833.232) (-835.801) (-831.559) [-832.017] * (-834.848) (-832.701) (-833.016) [-831.782] -- 0:00:51
164000 -- [-833.056] (-831.916) (-831.353) (-831.001) * (-834.606) (-837.244) [-831.576] (-831.148) -- 0:00:50
164500 -- (-830.592) (-834.468) (-834.102) [-833.774] * (-830.848) (-831.432) (-833.759) [-831.140] -- 0:00:50
165000 -- (-831.539) [-833.747] (-833.548) (-834.395) * (-833.059) [-832.521] (-830.177) (-832.180) -- 0:00:50
Average standard deviation of split frequencies: 0.017607
165500 -- (-832.201) (-831.233) (-833.006) [-832.474] * (-830.368) (-831.449) [-832.970] (-830.455) -- 0:00:50
166000 -- (-833.231) [-831.851] (-837.312) (-833.997) * (-830.716) (-832.613) [-831.085] (-831.676) -- 0:00:50
166500 -- (-834.623) (-832.073) [-831.441] (-833.679) * (-832.348) (-832.551) (-830.139) [-833.481] -- 0:00:50
167000 -- (-833.788) (-831.728) [-833.368] (-845.270) * (-833.054) [-833.587] (-831.306) (-831.998) -- 0:00:49
167500 -- (-831.402) (-830.554) [-831.602] (-837.284) * [-836.019] (-840.228) (-831.475) (-834.520) -- 0:00:49
168000 -- (-831.302) [-830.697] (-836.381) (-836.010) * [-830.786] (-831.822) (-831.837) (-838.020) -- 0:00:49
168500 -- [-832.673] (-830.761) (-832.453) (-834.943) * (-832.109) (-831.684) (-831.211) [-834.034] -- 0:00:49
169000 -- (-833.499) (-830.741) (-831.525) [-834.568] * (-832.726) (-835.533) (-831.052) [-831.217] -- 0:00:49
169500 -- (-833.106) [-831.531] (-833.112) (-832.534) * [-830.849] (-831.448) (-832.309) (-831.169) -- 0:00:48
170000 -- (-833.206) [-830.490] (-834.615) (-829.807) * (-833.648) (-830.984) (-832.172) [-831.503] -- 0:00:48
Average standard deviation of split frequencies: 0.018783
170500 -- (-832.612) (-831.832) (-834.941) [-830.509] * (-833.200) [-831.131] (-832.493) (-834.093) -- 0:00:48
171000 -- (-830.976) (-832.949) (-833.523) [-831.991] * [-832.654] (-831.359) (-830.976) (-834.196) -- 0:00:53
171500 -- [-833.931] (-830.980) (-830.928) (-830.962) * (-832.573) [-831.412] (-832.399) (-831.388) -- 0:00:53
172000 -- (-835.222) (-830.870) [-831.330] (-835.127) * [-831.759] (-831.136) (-833.553) (-831.413) -- 0:00:52
172500 -- (-836.419) [-831.635] (-831.678) (-831.406) * (-836.565) [-831.751] (-833.333) (-833.660) -- 0:00:52
173000 -- (-832.060) [-831.604] (-833.337) (-830.754) * (-836.981) (-831.109) (-831.393) [-834.665] -- 0:00:52
173500 -- (-831.085) [-830.843] (-832.176) (-832.033) * [-833.133] (-830.364) (-832.347) (-833.578) -- 0:00:52
174000 -- (-830.715) (-832.701) (-831.654) [-830.547] * (-837.904) [-832.753] (-835.278) (-834.841) -- 0:00:52
174500 -- (-830.218) [-832.162] (-834.566) (-831.064) * [-833.537] (-832.004) (-831.221) (-832.557) -- 0:00:52
175000 -- (-830.884) [-832.957] (-834.159) (-830.823) * (-831.723) (-832.677) (-834.333) [-834.164] -- 0:00:51
Average standard deviation of split frequencies: 0.018347
175500 -- (-832.084) (-831.544) (-831.000) [-831.586] * (-834.027) [-830.061] (-836.922) (-830.754) -- 0:00:51
176000 -- (-831.830) (-832.326) (-830.901) [-831.087] * (-831.353) (-832.448) (-842.012) [-832.045] -- 0:00:51
176500 -- (-831.551) [-831.270] (-830.683) (-830.541) * (-831.695) [-832.448] (-830.575) (-831.741) -- 0:00:51
177000 -- (-831.750) (-830.593) [-830.854] (-831.804) * (-833.206) (-832.947) [-831.188] (-832.263) -- 0:00:51
177500 -- (-831.769) (-831.180) [-833.345] (-832.944) * [-831.028] (-837.827) (-834.926) (-833.047) -- 0:00:50
178000 -- (-835.251) [-831.179] (-833.778) (-833.112) * (-832.168) (-832.813) [-831.309] (-833.090) -- 0:00:50
178500 -- (-834.480) (-835.903) (-830.408) [-836.097] * (-836.128) [-832.653] (-832.190) (-834.044) -- 0:00:50
179000 -- [-832.126] (-839.827) (-830.253) (-831.706) * (-831.740) [-830.479] (-832.460) (-836.451) -- 0:00:50
179500 -- (-833.114) (-831.836) (-830.049) [-831.143] * [-831.511] (-829.874) (-835.610) (-831.540) -- 0:00:50
180000 -- (-834.560) (-830.370) [-833.975] (-832.564) * (-839.019) (-833.539) [-831.338] (-831.178) -- 0:00:50
Average standard deviation of split frequencies: 0.016617
180500 -- (-835.070) (-830.315) [-834.673] (-831.808) * (-833.575) (-833.068) [-833.927] (-833.153) -- 0:00:49
181000 -- (-834.362) (-833.201) (-832.346) [-832.063] * (-834.042) (-830.895) [-831.162] (-833.357) -- 0:00:49
181500 -- [-832.920] (-832.631) (-832.261) (-831.476) * (-832.819) [-830.323] (-832.201) (-835.427) -- 0:00:49
182000 -- [-832.502] (-830.694) (-834.607) (-830.951) * [-832.605] (-833.005) (-831.508) (-833.274) -- 0:00:49
182500 -- [-836.994] (-831.876) (-832.649) (-830.698) * (-830.692) [-833.391] (-832.918) (-832.103) -- 0:00:49
183000 -- (-833.590) (-832.749) (-831.336) [-830.719] * [-830.068] (-830.226) (-829.906) (-831.315) -- 0:00:49
183500 -- [-829.789] (-831.207) (-831.142) (-832.496) * (-835.736) (-830.196) (-830.475) [-831.637] -- 0:00:48
184000 -- [-831.049] (-830.432) (-835.168) (-830.802) * (-834.340) (-831.302) (-834.402) [-831.275] -- 0:00:48
184500 -- (-830.868) (-830.540) (-836.142) [-831.626] * (-831.034) (-834.199) (-833.059) [-832.209] -- 0:00:48
185000 -- (-832.313) (-830.086) (-832.128) [-830.817] * [-832.177] (-831.032) (-833.839) (-832.858) -- 0:00:48
Average standard deviation of split frequencies: 0.016807
185500 -- (-830.295) [-833.661] (-833.345) (-834.424) * (-833.421) [-830.268] (-830.780) (-832.428) -- 0:00:48
186000 -- (-833.007) (-830.549) [-833.875] (-834.526) * (-832.472) (-830.882) (-830.162) [-831.296] -- 0:00:48
186500 -- (-837.494) (-831.289) [-831.320] (-833.671) * (-832.251) (-831.307) [-831.746] (-831.822) -- 0:00:47
187000 -- (-831.516) (-833.395) (-835.133) [-830.937] * (-831.615) (-831.957) (-831.871) [-830.801] -- 0:00:47
187500 -- [-831.961] (-832.762) (-833.541) (-831.137) * [-832.078] (-831.876) (-833.504) (-832.330) -- 0:00:52
188000 -- [-832.423] (-830.667) (-831.520) (-832.350) * (-832.766) (-838.150) [-832.883] (-832.444) -- 0:00:51
188500 -- (-832.756) (-832.528) (-831.502) [-830.293] * (-836.451) (-833.052) (-831.796) [-830.917] -- 0:00:51
189000 -- (-831.495) (-834.749) (-831.824) [-831.340] * [-838.093] (-834.004) (-830.002) (-835.636) -- 0:00:51
189500 -- [-830.393] (-833.739) (-831.001) (-830.931) * [-830.073] (-831.380) (-829.919) (-836.108) -- 0:00:51
190000 -- [-832.147] (-833.131) (-834.828) (-832.341) * (-833.352) (-832.400) [-833.616] (-833.733) -- 0:00:51
Average standard deviation of split frequencies: 0.015125
190500 -- (-834.212) (-833.304) [-830.648] (-832.211) * (-830.916) (-831.650) (-830.978) [-833.661] -- 0:00:50
191000 -- [-833.866] (-833.877) (-830.330) (-830.878) * (-831.177) (-832.917) [-830.406] (-831.448) -- 0:00:50
191500 -- (-833.022) (-836.247) (-830.838) [-833.865] * (-831.465) (-830.382) (-830.624) [-830.657] -- 0:00:50
192000 -- (-833.939) [-830.350] (-830.472) (-831.995) * (-834.146) [-831.185] (-831.265) (-831.142) -- 0:00:50
192500 -- (-831.227) (-830.431) [-831.209] (-830.331) * (-831.649) [-831.899] (-832.715) (-830.344) -- 0:00:50
193000 -- [-831.590] (-832.621) (-830.188) (-833.095) * (-833.709) (-834.082) [-832.524] (-837.363) -- 0:00:50
193500 -- [-832.969] (-830.672) (-830.667) (-836.048) * [-830.186] (-831.690) (-832.770) (-834.809) -- 0:00:50
194000 -- (-833.040) (-830.959) [-833.765] (-834.293) * (-832.456) [-830.547] (-834.340) (-832.785) -- 0:00:49
194500 -- (-833.334) (-830.950) [-838.414] (-835.194) * (-838.664) (-834.699) [-832.280] (-832.356) -- 0:00:49
195000 -- (-830.579) (-831.676) [-831.012] (-833.709) * [-834.845] (-833.629) (-834.925) (-832.650) -- 0:00:49
Average standard deviation of split frequencies: 0.015633
195500 -- (-832.115) (-834.673) [-840.646] (-835.553) * (-833.793) (-830.816) (-837.763) [-830.992] -- 0:00:49
196000 -- (-831.579) (-835.288) (-832.164) [-835.719] * (-834.227) [-832.750] (-835.665) (-830.217) -- 0:00:49
196500 -- (-832.538) [-832.674] (-831.011) (-830.532) * [-831.690] (-831.994) (-831.438) (-832.149) -- 0:00:49
197000 -- (-830.740) (-836.616) (-830.398) [-831.118] * (-832.997) (-830.755) [-831.993] (-834.274) -- 0:00:48
197500 -- (-830.948) (-832.116) (-831.902) [-833.348] * (-834.308) (-832.296) (-831.591) [-834.496] -- 0:00:48
198000 -- (-832.610) (-831.675) (-831.594) [-831.626] * [-831.204] (-830.970) (-836.391) (-832.990) -- 0:00:48
198500 -- (-834.431) [-835.244] (-831.602) (-832.235) * (-834.174) [-830.037] (-831.720) (-832.217) -- 0:00:48
199000 -- (-832.574) [-830.876] (-831.451) (-831.109) * (-832.284) (-830.830) (-835.171) [-829.884] -- 0:00:48
199500 -- (-830.704) (-831.683) (-831.930) [-831.306] * (-834.088) [-829.916] (-832.330) (-831.609) -- 0:00:48
200000 -- (-832.298) [-831.108] (-832.168) (-830.719) * (-830.848) (-830.846) (-831.802) [-834.208] -- 0:00:48
Average standard deviation of split frequencies: 0.015123
200500 -- (-838.339) (-834.522) [-834.488] (-830.540) * (-834.103) (-832.008) [-831.578] (-830.814) -- 0:00:47
201000 -- (-832.403) [-835.530] (-834.984) (-830.670) * (-831.443) (-832.448) (-832.648) [-830.416] -- 0:00:47
201500 -- (-837.844) (-834.472) (-833.190) [-831.539] * (-830.827) (-833.317) (-831.430) [-831.256] -- 0:00:47
202000 -- [-837.320] (-832.534) (-831.323) (-832.952) * (-832.983) [-831.089] (-833.820) (-831.505) -- 0:00:47
202500 -- (-836.136) (-832.559) (-838.263) [-831.496] * (-835.391) (-831.088) (-830.739) [-831.715] -- 0:00:47
203000 -- (-835.257) (-832.006) [-832.809] (-831.577) * (-832.969) (-832.924) [-832.641] (-830.547) -- 0:00:47
203500 -- [-830.503] (-829.987) (-834.725) (-835.226) * (-832.794) (-835.191) [-831.223] (-832.540) -- 0:00:46
204000 -- [-830.714] (-830.797) (-834.264) (-833.272) * (-833.661) (-832.085) (-830.307) [-830.613] -- 0:00:46
204500 -- [-831.854] (-831.388) (-832.391) (-829.935) * (-832.374) (-831.593) [-830.460] (-830.632) -- 0:00:50
205000 -- (-830.988) [-830.186] (-832.256) (-831.565) * (-831.057) [-831.348] (-831.225) (-832.850) -- 0:00:50
Average standard deviation of split frequencies: 0.013730
205500 -- (-829.829) (-829.832) [-833.354] (-831.169) * (-831.060) [-830.945] (-831.925) (-831.315) -- 0:00:50
206000 -- [-831.212] (-831.074) (-832.675) (-831.661) * [-830.772] (-831.164) (-834.491) (-832.207) -- 0:00:50
206500 -- [-832.068] (-832.319) (-831.988) (-831.400) * [-833.481] (-830.659) (-831.534) (-833.944) -- 0:00:49
207000 -- (-833.622) (-832.082) (-831.699) [-831.385] * [-831.546] (-831.466) (-830.913) (-835.250) -- 0:00:49
207500 -- (-836.466) [-831.579] (-831.825) (-832.002) * [-831.112] (-831.108) (-830.342) (-835.421) -- 0:00:49
208000 -- [-830.988] (-831.899) (-835.005) (-830.871) * (-833.466) (-832.244) [-830.260] (-831.209) -- 0:00:49
208500 -- (-837.483) (-831.307) (-832.263) [-834.239] * (-834.040) (-830.868) (-831.591) [-831.124] -- 0:00:49
209000 -- (-829.981) (-831.601) [-831.666] (-831.497) * [-832.427] (-832.303) (-832.331) (-834.020) -- 0:00:49
209500 -- (-830.984) (-831.054) (-833.984) [-832.487] * (-830.604) [-832.594] (-831.241) (-830.716) -- 0:00:49
210000 -- (-830.943) [-831.493] (-834.437) (-833.798) * (-830.360) (-831.442) [-830.627] (-832.761) -- 0:00:48
Average standard deviation of split frequencies: 0.012900
210500 -- [-832.993] (-833.984) (-833.433) (-830.225) * (-831.981) (-831.298) [-830.658] (-834.275) -- 0:00:48
211000 -- (-831.578) (-832.548) [-829.779] (-830.752) * (-831.393) [-831.565] (-833.145) (-831.894) -- 0:00:48
211500 -- (-832.731) [-835.138] (-831.547) (-831.645) * [-831.483] (-831.831) (-830.299) (-833.214) -- 0:00:48
212000 -- (-832.494) (-830.308) [-831.959] (-831.765) * [-831.156] (-837.974) (-834.698) (-833.309) -- 0:00:48
212500 -- (-830.460) [-831.741] (-832.572) (-831.778) * (-830.280) (-832.152) [-832.850] (-832.299) -- 0:00:48
213000 -- (-830.820) [-831.343] (-832.319) (-832.620) * [-830.252] (-837.067) (-831.510) (-831.829) -- 0:00:48
213500 -- (-833.797) (-834.263) [-830.883] (-834.966) * (-831.211) (-839.496) [-833.035] (-830.987) -- 0:00:47
214000 -- (-832.732) [-841.867] (-830.522) (-833.066) * (-830.258) (-839.003) (-831.940) [-831.764] -- 0:00:47
214500 -- (-834.961) (-836.203) (-836.902) [-835.803] * (-830.062) (-834.304) [-830.955] (-831.764) -- 0:00:47
215000 -- (-834.787) (-831.840) (-832.155) [-833.854] * [-830.643] (-833.033) (-833.768) (-830.466) -- 0:00:47
Average standard deviation of split frequencies: 0.012966
215500 -- (-830.849) (-830.974) (-832.571) [-831.014] * (-832.136) (-836.049) [-830.569] (-830.637) -- 0:00:47
216000 -- (-832.079) (-832.277) (-832.048) [-831.030] * (-832.529) (-832.374) [-830.136] (-830.751) -- 0:00:47
216500 -- (-833.142) [-836.271] (-831.856) (-830.363) * (-831.514) (-834.090) [-830.708] (-831.814) -- 0:00:47
217000 -- (-833.908) (-834.722) (-832.159) [-830.761] * (-833.986) (-830.632) [-831.249] (-830.492) -- 0:00:46
217500 -- (-832.895) (-834.164) [-835.031] (-832.678) * (-836.437) (-834.771) [-836.791] (-831.276) -- 0:00:46
218000 -- (-833.380) (-836.611) [-831.248] (-834.340) * (-836.726) (-834.615) (-836.014) [-833.066] -- 0:00:46
218500 -- (-834.392) (-832.993) (-830.391) [-833.217] * [-831.231] (-832.944) (-833.394) (-834.485) -- 0:00:46
219000 -- (-831.427) (-833.121) (-835.544) [-831.748] * (-832.482) (-830.400) (-833.027) [-832.195] -- 0:00:46
219500 -- (-833.752) [-836.042] (-832.617) (-831.001) * [-830.759] (-832.742) (-832.604) (-831.243) -- 0:00:46
220000 -- (-832.807) (-837.991) [-836.703] (-830.984) * (-830.039) (-831.360) (-834.356) [-833.683] -- 0:00:46
Average standard deviation of split frequencies: 0.012951
220500 -- (-834.712) [-837.358] (-834.520) (-831.144) * (-834.324) (-830.545) [-831.792] (-832.376) -- 0:00:45
221000 -- (-833.133) (-833.495) (-830.775) [-833.016] * [-832.998] (-831.979) (-831.446) (-831.360) -- 0:00:49
221500 -- (-834.191) [-834.903] (-832.635) (-832.919) * [-832.707] (-831.860) (-831.216) (-831.474) -- 0:00:49
222000 -- (-834.110) (-832.247) [-832.633] (-830.944) * (-831.475) (-830.792) (-833.639) [-831.331] -- 0:00:49
222500 -- (-834.286) [-831.657] (-832.862) (-831.225) * [-834.488] (-831.794) (-831.560) (-831.069) -- 0:00:48
223000 -- (-832.246) (-834.694) (-831.542) [-832.100] * [-831.874] (-831.719) (-835.800) (-833.107) -- 0:00:48
223500 -- (-833.293) (-838.655) (-832.346) [-832.794] * (-831.391) (-834.702) (-833.035) [-832.010] -- 0:00:48
224000 -- (-834.642) [-835.221] (-831.059) (-831.195) * (-835.553) (-832.188) (-832.849) [-832.300] -- 0:00:48
224500 -- (-834.891) (-831.653) [-832.550] (-833.626) * (-833.649) (-831.451) (-831.428) [-830.284] -- 0:00:48
225000 -- [-832.788] (-833.489) (-831.174) (-831.293) * (-832.227) [-830.902] (-833.058) (-830.616) -- 0:00:48
Average standard deviation of split frequencies: 0.013006
225500 -- (-832.595) (-830.997) (-832.201) [-834.767] * [-834.141] (-836.106) (-830.995) (-830.620) -- 0:00:48
226000 -- (-833.579) [-831.385] (-830.998) (-833.896) * (-830.914) (-833.909) [-835.625] (-831.434) -- 0:00:47
226500 -- (-832.471) (-836.251) (-830.973) [-833.514] * [-835.813] (-832.917) (-832.343) (-830.592) -- 0:00:47
227000 -- (-833.682) (-834.204) (-830.953) [-834.320] * (-832.868) [-836.051] (-831.577) (-833.403) -- 0:00:47
227500 -- (-832.317) (-832.614) [-829.729] (-832.523) * (-832.301) [-832.985] (-835.232) (-834.934) -- 0:00:47
228000 -- [-832.690] (-830.472) (-831.795) (-833.639) * [-830.868] (-834.794) (-832.045) (-835.452) -- 0:00:47
228500 -- [-830.412] (-830.472) (-832.335) (-838.146) * (-832.347) [-830.764] (-831.978) (-834.430) -- 0:00:47
229000 -- (-832.096) (-831.758) [-832.213] (-838.058) * (-832.020) [-831.109] (-830.407) (-830.729) -- 0:00:47
229500 -- (-830.261) (-830.644) [-831.438] (-833.803) * (-831.603) [-830.808] (-830.407) (-831.134) -- 0:00:47
230000 -- (-830.659) (-831.410) (-832.376) [-837.728] * [-830.201] (-831.088) (-833.141) (-830.994) -- 0:00:46
Average standard deviation of split frequencies: 0.013851
230500 -- (-830.725) (-831.344) [-830.966] (-841.459) * (-832.993) [-832.221] (-831.179) (-839.048) -- 0:00:46
231000 -- [-831.518] (-830.944) (-834.014) (-832.337) * (-831.456) [-830.448] (-833.823) (-836.142) -- 0:00:46
231500 -- (-830.396) (-837.065) [-833.694] (-833.826) * (-831.676) [-831.616] (-832.527) (-831.203) -- 0:00:46
232000 -- (-838.482) (-839.724) (-834.739) [-831.262] * (-830.861) [-830.639] (-831.640) (-830.687) -- 0:00:46
232500 -- (-831.593) [-834.996] (-831.448) (-831.944) * (-831.799) (-832.993) (-832.847) [-831.817] -- 0:00:46
233000 -- [-834.319] (-832.469) (-832.967) (-832.236) * [-831.994] (-831.054) (-830.635) (-831.861) -- 0:00:46
233500 -- [-830.913] (-833.995) (-832.786) (-831.003) * [-831.716] (-833.334) (-831.689) (-831.915) -- 0:00:45
234000 -- (-830.965) (-832.040) [-832.553] (-830.699) * [-835.303] (-830.784) (-838.140) (-831.810) -- 0:00:45
234500 -- (-830.758) (-834.618) [-832.009] (-829.733) * (-835.871) [-831.419] (-835.776) (-834.664) -- 0:00:45
235000 -- [-833.623] (-832.892) (-833.326) (-833.369) * (-834.015) [-832.088] (-831.957) (-830.517) -- 0:00:45
Average standard deviation of split frequencies: 0.013317
235500 -- [-830.833] (-832.100) (-832.570) (-834.787) * (-833.506) (-833.003) [-832.169] (-831.983) -- 0:00:45
236000 -- (-832.010) (-831.818) [-833.344] (-830.424) * (-831.325) (-832.246) (-831.761) [-830.216] -- 0:00:45
236500 -- (-833.297) [-830.408] (-833.883) (-830.581) * (-830.461) (-833.484) (-832.977) [-830.306] -- 0:00:45
237000 -- (-834.395) (-830.522) (-833.117) [-830.396] * [-831.643] (-830.919) (-839.290) (-831.648) -- 0:00:45
237500 -- (-832.334) (-832.731) [-830.449] (-831.528) * (-836.792) (-830.607) [-834.098] (-832.068) -- 0:00:48
238000 -- [-832.163] (-832.129) (-831.274) (-832.030) * (-832.891) [-830.263] (-833.665) (-832.398) -- 0:00:48
238500 -- (-831.578) [-830.355] (-830.902) (-830.798) * (-831.049) (-834.016) (-832.500) [-830.535] -- 0:00:47
239000 -- (-831.050) [-830.066] (-832.626) (-833.412) * [-830.826] (-831.160) (-829.944) (-830.063) -- 0:00:47
239500 -- (-831.460) (-832.742) [-832.997] (-834.075) * (-832.508) (-831.595) (-830.257) [-830.308] -- 0:00:47
240000 -- (-831.796) (-838.188) [-832.002] (-831.964) * (-830.677) (-832.499) (-834.558) [-833.391] -- 0:00:47
Average standard deviation of split frequencies: 0.013494
240500 -- (-833.120) (-830.768) (-830.536) [-830.825] * (-831.913) (-833.104) (-834.405) [-833.606] -- 0:00:47
241000 -- (-832.253) (-830.436) [-830.460] (-832.951) * (-832.866) (-833.710) (-835.447) [-832.989] -- 0:00:47
241500 -- (-831.388) (-830.490) [-830.190] (-836.073) * (-830.597) [-832.970] (-831.873) (-832.208) -- 0:00:47
242000 -- (-830.531) [-831.768] (-833.506) (-833.814) * [-830.230] (-834.674) (-832.578) (-836.283) -- 0:00:46
242500 -- (-834.592) [-830.085] (-832.964) (-834.228) * (-832.655) (-832.469) (-832.125) [-832.531] -- 0:00:46
243000 -- (-830.189) (-836.569) (-833.955) [-831.137] * (-830.565) (-831.089) [-832.964] (-835.210) -- 0:00:46
243500 -- (-836.131) [-833.124] (-836.158) (-830.384) * (-833.792) (-836.192) [-830.890] (-835.390) -- 0:00:46
244000 -- [-831.917] (-831.462) (-833.575) (-831.554) * (-832.581) (-832.460) [-832.391] (-834.485) -- 0:00:46
244500 -- (-833.834) (-830.980) (-832.659) [-831.580] * (-836.024) [-831.470] (-831.606) (-831.476) -- 0:00:46
245000 -- (-838.414) (-831.068) [-831.343] (-834.557) * (-832.109) (-831.306) [-831.824] (-831.630) -- 0:00:46
Average standard deviation of split frequencies: 0.012775
245500 -- [-833.419] (-831.679) (-833.135) (-831.581) * [-833.781] (-832.950) (-831.917) (-831.573) -- 0:00:46
246000 -- (-832.222) [-832.348] (-831.296) (-830.875) * (-837.836) [-831.314] (-831.666) (-830.764) -- 0:00:45
246500 -- (-836.822) [-832.276] (-830.889) (-831.226) * [-833.217] (-832.098) (-829.923) (-836.893) -- 0:00:45
247000 -- (-832.828) (-830.727) (-834.687) [-829.893] * [-830.479] (-836.164) (-831.376) (-831.468) -- 0:00:45
247500 -- (-833.296) (-830.035) (-834.322) [-830.452] * (-831.536) [-833.921] (-834.074) (-834.396) -- 0:00:45
248000 -- (-833.640) (-832.872) [-831.036] (-833.789) * (-834.688) (-831.079) [-831.043] (-834.052) -- 0:00:45
248500 -- [-832.286] (-836.518) (-831.691) (-832.602) * (-835.961) [-830.949] (-831.044) (-834.883) -- 0:00:45
249000 -- (-837.604) (-832.025) [-832.608] (-837.544) * (-832.771) (-833.250) (-833.892) [-831.538] -- 0:00:45
249500 -- (-832.903) [-834.067] (-832.221) (-838.062) * [-831.607] (-834.354) (-832.925) (-833.795) -- 0:00:45
250000 -- [-831.799] (-830.575) (-830.333) (-831.989) * (-833.845) [-831.651] (-831.593) (-830.824) -- 0:00:45
Average standard deviation of split frequencies: 0.012943
250500 -- (-831.421) (-831.306) (-831.234) [-832.729] * (-831.665) (-832.580) (-830.136) [-830.347] -- 0:00:44
251000 -- (-832.062) (-833.707) (-831.228) [-831.955] * (-831.771) (-831.985) [-830.370] (-832.396) -- 0:00:44
251500 -- [-831.312] (-832.555) (-830.808) (-833.336) * [-831.460] (-834.303) (-830.623) (-836.153) -- 0:00:44
252000 -- (-831.703) (-831.890) (-834.398) [-831.501] * [-831.339] (-836.340) (-831.578) (-831.416) -- 0:00:44
252500 -- [-834.145] (-834.267) (-834.957) (-830.596) * (-834.257) (-831.308) (-832.454) [-830.131] -- 0:00:44
253000 -- (-831.893) (-838.255) [-832.140] (-831.178) * [-830.497] (-832.326) (-830.236) (-830.258) -- 0:00:44
253500 -- (-832.601) (-836.812) [-830.352] (-831.560) * (-832.293) [-832.387] (-830.403) (-832.424) -- 0:00:44
254000 -- (-831.594) (-831.607) (-831.312) [-832.895] * (-830.379) [-835.255] (-831.801) (-830.873) -- 0:00:44
254500 -- (-833.873) [-831.484] (-830.582) (-833.525) * (-830.720) (-833.572) (-835.123) [-832.924] -- 0:00:46
255000 -- (-831.120) [-832.366] (-830.408) (-832.681) * [-831.523] (-831.292) (-832.688) (-834.759) -- 0:00:46
Average standard deviation of split frequencies: 0.012545
255500 -- [-832.274] (-831.175) (-831.570) (-831.604) * (-831.371) (-831.394) (-830.745) [-830.210] -- 0:00:46
256000 -- (-833.597) [-832.532] (-831.167) (-837.718) * (-832.289) [-832.494] (-832.773) (-831.422) -- 0:00:46
256500 -- (-833.829) [-835.561] (-833.877) (-833.117) * [-838.264] (-831.164) (-833.798) (-832.586) -- 0:00:46
257000 -- (-834.059) (-833.038) (-830.320) [-832.383] * (-837.196) (-833.684) [-834.803] (-831.780) -- 0:00:46
257500 -- (-834.117) (-839.747) (-832.410) [-831.692] * [-831.844] (-835.188) (-833.213) (-833.906) -- 0:00:46
258000 -- (-834.562) [-834.663] (-833.785) (-832.087) * (-830.962) [-830.584] (-831.471) (-831.351) -- 0:00:46
258500 -- (-829.835) (-831.551) [-832.439] (-836.194) * (-831.044) (-833.902) (-831.549) [-831.616] -- 0:00:45
259000 -- (-830.553) (-832.463) [-830.811] (-833.652) * [-831.099] (-835.277) (-831.573) (-831.127) -- 0:00:45
259500 -- (-830.106) [-831.037] (-834.430) (-834.183) * (-831.596) [-831.875] (-832.270) (-830.764) -- 0:00:45
260000 -- [-829.857] (-830.183) (-834.583) (-831.620) * [-831.119] (-832.924) (-831.858) (-830.556) -- 0:00:45
Average standard deviation of split frequencies: 0.012546
260500 -- [-829.850] (-831.113) (-830.072) (-835.179) * (-832.510) [-831.613] (-832.419) (-831.649) -- 0:00:45
261000 -- (-830.799) (-834.716) (-833.843) [-830.078] * [-830.257] (-830.002) (-835.510) (-830.151) -- 0:00:45
261500 -- (-830.490) (-832.083) [-833.230] (-830.601) * (-830.931) (-830.767) (-834.070) [-830.060] -- 0:00:45
262000 -- (-830.896) (-832.076) [-830.646] (-832.342) * (-831.154) [-832.606] (-832.474) (-833.805) -- 0:00:45
262500 -- (-833.899) [-833.258] (-833.572) (-835.897) * (-832.705) [-830.619] (-834.294) (-832.549) -- 0:00:44
263000 -- [-832.386] (-835.825) (-833.671) (-831.904) * [-830.972] (-832.222) (-830.529) (-832.613) -- 0:00:44
263500 -- (-832.924) (-836.792) [-830.772] (-831.729) * (-830.513) [-831.872] (-829.989) (-832.751) -- 0:00:44
264000 -- (-830.681) (-834.405) (-830.895) [-832.713] * (-835.972) [-832.478] (-829.881) (-832.048) -- 0:00:44
264500 -- [-831.933] (-833.334) (-834.533) (-833.984) * (-832.915) (-834.457) [-831.035] (-832.181) -- 0:00:44
265000 -- [-832.300] (-830.613) (-832.861) (-832.313) * (-829.989) (-831.232) (-833.354) [-830.172] -- 0:00:44
Average standard deviation of split frequencies: 0.012012
265500 -- (-833.761) [-830.116] (-833.187) (-834.746) * (-830.186) (-832.385) [-837.613] (-836.404) -- 0:00:44
266000 -- (-833.133) (-830.906) [-833.145] (-831.501) * (-830.908) (-834.204) (-834.048) [-831.686] -- 0:00:44
266500 -- (-831.697) [-832.408] (-830.648) (-831.932) * [-833.705] (-831.011) (-832.236) (-832.032) -- 0:00:44
267000 -- (-832.173) [-833.288] (-830.747) (-833.800) * (-835.650) (-830.181) [-833.011] (-831.470) -- 0:00:43
267500 -- (-838.853) (-834.926) (-831.578) [-832.027] * (-831.245) (-832.540) (-830.141) [-831.352] -- 0:00:43
268000 -- (-832.878) [-831.527] (-832.676) (-833.432) * [-832.956] (-834.978) (-830.566) (-835.051) -- 0:00:43
268500 -- (-832.081) (-833.322) (-834.886) [-834.559] * (-831.654) (-835.434) (-831.828) [-832.486] -- 0:00:43
269000 -- (-832.950) (-833.474) (-831.115) [-834.875] * [-830.719] (-833.515) (-831.972) (-831.215) -- 0:00:43
269500 -- (-830.394) (-831.141) [-831.107] (-832.006) * [-830.598] (-829.987) (-834.837) (-831.377) -- 0:00:43
270000 -- (-830.823) [-834.598] (-832.865) (-833.001) * (-832.981) (-832.653) [-831.247] (-831.026) -- 0:00:43
Average standard deviation of split frequencies: 0.012191
270500 -- (-831.074) (-831.982) (-840.147) [-834.374] * [-831.181] (-832.488) (-831.510) (-831.076) -- 0:00:43
271000 -- (-832.812) (-832.361) (-838.988) [-830.786] * (-834.554) [-833.916] (-831.183) (-837.277) -- 0:00:45
271500 -- (-835.865) (-832.167) (-831.352) [-830.185] * [-830.792] (-834.382) (-830.338) (-834.873) -- 0:00:45
272000 -- (-835.778) (-832.600) (-831.101) [-833.343] * [-831.215] (-835.242) (-830.814) (-830.336) -- 0:00:45
272500 -- (-831.474) [-833.455] (-834.892) (-833.269) * (-831.637) [-831.578] (-831.116) (-836.520) -- 0:00:45
273000 -- [-832.964] (-831.876) (-837.545) (-835.189) * (-832.638) (-837.015) [-832.778] (-831.995) -- 0:00:45
273500 -- (-830.486) (-834.480) (-832.659) [-831.344] * (-832.361) (-833.995) [-831.484] (-831.881) -- 0:00:45
274000 -- (-829.946) (-831.889) [-833.018] (-837.692) * (-831.789) (-836.291) [-835.254] (-835.460) -- 0:00:45
274500 -- [-830.510] (-830.804) (-831.363) (-831.766) * (-834.657) (-830.755) (-832.164) [-830.994] -- 0:00:44
275000 -- (-831.317) (-832.458) (-830.485) [-833.709] * (-833.571) [-831.121] (-835.848) (-830.233) -- 0:00:44
Average standard deviation of split frequencies: 0.011855
275500 -- (-832.648) (-833.579) (-832.410) [-833.519] * [-834.471] (-830.097) (-834.316) (-834.013) -- 0:00:44
276000 -- (-833.417) (-831.212) [-832.196] (-831.867) * (-832.837) [-829.945] (-833.614) (-831.398) -- 0:00:44
276500 -- (-832.741) (-831.812) (-832.007) [-832.111] * (-832.316) (-830.200) (-831.460) [-831.319] -- 0:00:44
277000 -- (-832.305) (-832.031) [-832.412] (-835.964) * [-830.888] (-832.668) (-830.697) (-830.238) -- 0:00:44
277500 -- (-831.718) (-834.432) [-836.253] (-831.640) * (-833.840) [-833.243] (-830.087) (-831.339) -- 0:00:44
278000 -- [-839.853] (-831.051) (-831.925) (-836.416) * [-833.346] (-831.542) (-831.945) (-831.725) -- 0:00:44
278500 -- (-830.262) (-833.428) [-830.515] (-833.662) * (-832.739) (-831.283) [-833.252] (-832.305) -- 0:00:44
279000 -- (-831.723) [-832.432] (-831.521) (-829.886) * (-831.968) [-831.205] (-832.670) (-833.312) -- 0:00:43
279500 -- (-835.132) (-830.558) [-832.342] (-830.846) * (-832.956) (-831.154) (-833.417) [-830.990] -- 0:00:43
280000 -- (-833.777) (-833.020) [-831.179] (-832.449) * (-833.757) (-833.155) [-830.793] (-830.919) -- 0:00:43
Average standard deviation of split frequencies: 0.012152
280500 -- (-832.239) (-832.781) [-831.168] (-831.932) * (-831.171) (-833.259) (-830.023) [-832.007] -- 0:00:43
281000 -- (-832.039) (-832.912) (-830.115) [-833.630] * [-832.234] (-832.622) (-831.681) (-832.494) -- 0:00:43
281500 -- (-831.143) [-834.804] (-830.093) (-831.857) * (-838.289) (-830.630) [-834.858] (-831.604) -- 0:00:43
282000 -- (-834.807) [-833.130] (-829.933) (-833.090) * (-832.019) (-830.941) [-831.346] (-832.537) -- 0:00:43
282500 -- (-835.513) (-834.709) [-830.072] (-832.244) * [-834.004] (-831.648) (-830.866) (-832.186) -- 0:00:43
283000 -- [-832.786] (-834.163) (-832.553) (-832.864) * (-832.422) (-833.034) (-830.703) [-830.248] -- 0:00:43
283500 -- [-833.935] (-833.851) (-833.775) (-833.456) * [-832.443] (-830.880) (-830.788) (-830.238) -- 0:00:42
284000 -- [-836.212] (-830.973) (-832.408) (-838.116) * [-831.027] (-831.060) (-831.898) (-830.258) -- 0:00:42
284500 -- (-829.889) [-833.605] (-832.068) (-834.468) * (-835.298) [-831.489] (-834.207) (-830.571) -- 0:00:42
285000 -- (-831.605) (-834.122) [-830.438] (-830.944) * (-835.292) (-830.593) [-829.817] (-835.916) -- 0:00:42
Average standard deviation of split frequencies: 0.009890
285500 -- [-831.964] (-833.829) (-832.624) (-831.416) * [-830.366] (-831.547) (-830.623) (-835.382) -- 0:00:42
286000 -- (-838.082) (-830.216) (-832.307) [-831.644] * (-830.999) [-835.158] (-829.721) (-834.301) -- 0:00:42
286500 -- (-833.835) [-829.919] (-830.451) (-832.031) * (-831.299) (-834.183) (-832.764) [-832.487] -- 0:00:42
287000 -- (-831.136) [-836.619] (-830.834) (-832.841) * [-830.787] (-832.741) (-832.166) (-832.043) -- 0:00:42
287500 -- (-833.130) (-835.491) (-830.739) [-830.895] * [-832.693] (-833.613) (-831.080) (-837.602) -- 0:00:44
288000 -- (-832.320) [-831.853] (-834.240) (-831.062) * (-832.385) (-832.533) [-832.571] (-835.534) -- 0:00:44
288500 -- [-833.679] (-830.997) (-832.903) (-831.558) * (-835.041) (-830.819) [-837.445] (-836.338) -- 0:00:44
289000 -- (-832.457) (-830.851) (-831.910) [-832.054] * (-832.172) (-831.935) [-830.590] (-832.395) -- 0:00:44
289500 -- (-837.610) (-830.734) (-833.315) [-831.682] * (-834.897) [-830.437] (-832.565) (-832.702) -- 0:00:44
290000 -- (-835.884) (-835.990) (-833.000) [-831.181] * (-830.234) [-830.441] (-830.147) (-834.600) -- 0:00:44
Average standard deviation of split frequencies: 0.010017
290500 -- (-832.574) [-830.906] (-830.358) (-831.606) * (-832.636) (-830.711) (-830.967) [-833.563] -- 0:00:43
291000 -- [-833.543] (-833.372) (-839.750) (-833.075) * [-830.885] (-833.663) (-831.067) (-833.704) -- 0:00:43
291500 -- (-831.819) (-831.438) (-835.333) [-834.183] * (-830.432) (-833.736) [-832.410] (-832.340) -- 0:00:43
292000 -- (-839.265) (-830.448) (-829.702) [-833.183] * (-830.685) (-833.337) (-834.973) [-833.570] -- 0:00:43
292500 -- (-830.256) (-831.511) (-832.227) [-832.093] * (-831.937) (-834.038) (-837.102) [-831.494] -- 0:00:43
293000 -- [-830.178] (-832.516) (-832.489) (-833.043) * (-835.367) (-832.170) [-835.320] (-831.801) -- 0:00:43
293500 -- (-832.155) (-830.049) [-835.254] (-831.686) * [-832.759] (-832.504) (-833.521) (-831.054) -- 0:00:43
294000 -- [-830.274] (-830.991) (-838.554) (-832.796) * (-831.790) (-832.372) (-834.043) [-830.483] -- 0:00:43
294500 -- [-829.962] (-831.248) (-833.579) (-833.855) * [-830.169] (-831.610) (-832.966) (-833.986) -- 0:00:43
295000 -- [-829.964] (-831.851) (-833.249) (-836.222) * [-831.365] (-834.646) (-837.718) (-835.465) -- 0:00:43
Average standard deviation of split frequencies: 0.009368
295500 -- (-830.166) [-829.959] (-833.760) (-832.362) * (-832.984) (-831.936) (-831.622) [-831.965] -- 0:00:42
296000 -- (-830.159) (-833.033) (-833.454) [-831.727] * (-836.864) (-832.375) [-832.348] (-830.242) -- 0:00:42
296500 -- [-831.430] (-831.293) (-833.764) (-831.733) * (-831.698) (-831.225) (-832.352) [-830.624] -- 0:00:42
297000 -- (-834.028) (-830.411) [-830.506] (-831.525) * (-832.727) (-830.894) [-831.822] (-831.418) -- 0:00:42
297500 -- (-837.700) (-829.757) [-830.805] (-836.923) * (-833.364) [-832.300] (-833.473) (-832.637) -- 0:00:42
298000 -- (-830.775) (-832.282) [-833.493] (-836.509) * (-830.748) (-835.734) (-835.052) [-831.579] -- 0:00:42
298500 -- (-830.056) (-829.910) [-834.110] (-833.998) * (-833.041) [-832.811] (-836.194) (-833.549) -- 0:00:42
299000 -- (-831.032) [-831.134] (-832.008) (-833.601) * [-830.612] (-833.275) (-833.637) (-843.292) -- 0:00:42
299500 -- [-831.009] (-829.710) (-831.684) (-834.485) * [-830.909] (-835.519) (-832.623) (-836.138) -- 0:00:42
300000 -- [-830.412] (-831.592) (-832.586) (-832.881) * [-830.723] (-835.361) (-829.725) (-829.732) -- 0:00:42
Average standard deviation of split frequencies: 0.009776
300500 -- (-832.908) (-830.129) [-833.577] (-832.409) * (-834.205) (-834.589) (-832.681) [-829.910] -- 0:00:41
301000 -- (-834.882) (-835.506) [-837.571] (-832.294) * [-831.226] (-833.851) (-833.156) (-831.968) -- 0:00:41
301500 -- [-834.771] (-831.652) (-832.889) (-833.235) * (-830.921) (-835.729) (-834.572) [-830.501] -- 0:00:41
302000 -- [-831.274] (-830.910) (-835.938) (-833.542) * (-831.184) (-832.845) (-830.526) [-831.003] -- 0:00:41
302500 -- (-833.257) (-830.583) [-831.117] (-831.543) * (-832.358) (-831.409) (-830.572) [-830.751] -- 0:00:41
303000 -- (-836.523) (-833.947) [-833.283] (-831.584) * (-831.230) [-830.251] (-831.652) (-833.854) -- 0:00:41
303500 -- (-831.531) [-837.741] (-835.698) (-831.600) * [-830.419] (-832.956) (-834.716) (-831.712) -- 0:00:41
304000 -- (-830.935) (-832.486) (-839.049) [-830.930] * [-830.540] (-835.386) (-835.563) (-833.151) -- 0:00:43
304500 -- (-831.420) [-831.402] (-831.448) (-830.079) * (-830.873) [-831.904] (-831.627) (-832.961) -- 0:00:43
305000 -- (-831.862) (-831.954) (-832.975) [-831.140] * (-833.526) (-833.785) (-833.179) [-831.329] -- 0:00:43
Average standard deviation of split frequencies: 0.009334
305500 -- (-830.444) (-830.919) [-831.560] (-832.718) * (-832.049) [-832.391] (-831.180) (-834.610) -- 0:00:43
306000 -- (-836.178) (-833.210) (-834.354) [-831.772] * (-834.198) (-831.799) [-831.569] (-832.896) -- 0:00:43
306500 -- (-830.654) [-830.915] (-833.381) (-832.115) * [-831.180] (-830.610) (-830.947) (-831.549) -- 0:00:42
307000 -- (-835.101) (-832.109) (-833.525) [-831.340] * (-835.866) [-830.834] (-830.981) (-830.286) -- 0:00:42
307500 -- (-834.011) (-830.417) (-831.188) [-833.352] * (-832.846) (-830.429) [-830.863] (-830.412) -- 0:00:42
308000 -- (-832.109) (-830.457) [-831.595] (-835.353) * (-832.030) [-834.223] (-834.336) (-830.435) -- 0:00:42
308500 -- (-830.682) [-831.973] (-834.758) (-831.541) * (-830.701) (-831.992) [-832.081] (-830.205) -- 0:00:42
309000 -- (-831.502) (-831.283) [-837.631] (-833.990) * [-832.356] (-833.483) (-834.738) (-833.872) -- 0:00:42
309500 -- (-832.907) [-831.305] (-831.425) (-832.734) * (-832.578) (-832.514) [-830.366] (-831.212) -- 0:00:42
310000 -- (-835.795) (-832.457) (-830.543) [-833.368] * [-831.391] (-832.303) (-830.193) (-830.380) -- 0:00:42
Average standard deviation of split frequencies: 0.008820
310500 -- (-836.939) (-833.775) [-831.425] (-832.175) * (-831.470) (-831.646) (-832.023) [-831.546] -- 0:00:42
311000 -- [-834.410] (-832.964) (-834.042) (-837.778) * (-830.072) [-830.474] (-831.442) (-831.638) -- 0:00:42
311500 -- (-833.411) [-834.227] (-832.840) (-842.380) * [-834.399] (-832.337) (-831.223) (-830.656) -- 0:00:41
312000 -- (-833.172) (-830.466) (-834.771) [-839.692] * (-832.091) (-830.286) (-832.161) [-831.659] -- 0:00:41
312500 -- (-831.564) (-832.581) [-831.558] (-831.569) * (-835.130) [-831.833] (-830.701) (-833.526) -- 0:00:41
313000 -- (-833.827) [-830.199] (-835.486) (-830.921) * (-846.856) [-832.623] (-832.699) (-835.463) -- 0:00:41
313500 -- (-832.098) (-834.692) (-834.632) [-830.995] * (-833.415) (-833.945) [-834.633] (-832.182) -- 0:00:41
314000 -- [-831.765] (-833.164) (-833.057) (-832.684) * (-832.892) (-832.022) [-831.811] (-832.473) -- 0:00:41
314500 -- [-830.811] (-832.622) (-834.857) (-832.123) * [-833.753] (-833.608) (-831.814) (-830.061) -- 0:00:41
315000 -- (-831.794) (-833.909) (-837.121) [-832.953] * (-835.450) [-831.156] (-831.058) (-830.002) -- 0:00:41
Average standard deviation of split frequencies: 0.009324
315500 -- (-831.397) (-835.609) [-831.608] (-830.360) * (-831.788) (-833.625) [-832.287] (-832.155) -- 0:00:41
316000 -- (-832.643) [-833.071] (-832.357) (-830.807) * [-830.416] (-831.045) (-834.522) (-832.389) -- 0:00:41
316500 -- (-833.226) [-832.787] (-830.497) (-831.714) * [-831.129] (-831.714) (-834.091) (-831.507) -- 0:00:41
317000 -- (-831.451) [-834.400] (-831.833) (-833.404) * [-832.431] (-832.820) (-831.846) (-832.187) -- 0:00:40
317500 -- [-831.808] (-833.765) (-833.896) (-833.604) * (-830.412) (-833.414) (-836.501) [-830.718] -- 0:00:40
318000 -- (-830.095) (-831.167) [-830.699] (-831.472) * (-830.701) (-831.658) [-832.678] (-830.408) -- 0:00:40
318500 -- (-834.522) [-830.333] (-835.844) (-834.055) * [-830.450] (-831.367) (-833.564) (-833.827) -- 0:00:40
319000 -- (-831.227) (-830.340) [-831.099] (-832.836) * (-832.351) [-830.555] (-837.133) (-833.158) -- 0:00:40
319500 -- (-832.435) [-830.452] (-832.133) (-831.834) * [-833.729] (-830.339) (-830.675) (-832.541) -- 0:00:40
320000 -- (-830.008) (-830.452) (-831.867) [-832.185] * (-834.660) [-832.666] (-831.626) (-830.880) -- 0:00:40
Average standard deviation of split frequencies: 0.009004
320500 -- (-831.769) [-831.144] (-831.940) (-831.449) * (-832.438) (-834.204) (-832.487) [-830.195] -- 0:00:42
321000 -- (-832.249) (-831.541) (-840.832) [-831.922] * [-831.366] (-830.765) (-833.617) (-833.395) -- 0:00:42
321500 -- (-831.771) (-832.946) [-834.600] (-836.453) * (-833.900) (-833.833) (-832.496) [-832.932] -- 0:00:42
322000 -- [-831.325] (-835.224) (-833.188) (-834.605) * (-831.420) [-835.272] (-831.610) (-830.648) -- 0:00:42
322500 -- (-831.816) (-833.053) (-832.156) [-832.902] * (-830.018) (-833.098) [-832.943] (-830.651) -- 0:00:42
323000 -- [-831.765] (-833.982) (-831.296) (-832.073) * [-829.795] (-832.185) (-833.981) (-836.730) -- 0:00:41
323500 -- (-833.114) [-832.152] (-830.843) (-832.319) * (-829.795) (-831.518) (-831.080) [-832.223] -- 0:00:41
324000 -- [-831.621] (-831.445) (-832.336) (-833.311) * (-829.795) (-831.808) [-834.153] (-831.241) -- 0:00:41
324500 -- (-833.433) [-833.011] (-832.403) (-834.779) * (-829.964) (-832.607) [-834.095] (-832.154) -- 0:00:41
325000 -- (-838.652) (-833.317) [-830.201] (-837.680) * (-829.964) (-831.319) [-830.917] (-832.032) -- 0:00:41
Average standard deviation of split frequencies: 0.008495
325500 -- (-831.985) [-831.617] (-830.447) (-832.441) * [-833.800] (-832.190) (-832.838) (-837.982) -- 0:00:41
326000 -- [-832.367] (-832.660) (-831.986) (-832.791) * (-833.241) (-832.123) [-835.165] (-833.013) -- 0:00:41
326500 -- (-832.461) (-831.408) (-831.927) [-831.116] * (-831.355) (-831.620) (-829.945) [-832.416] -- 0:00:41
327000 -- (-835.096) (-835.114) (-830.747) [-832.056] * (-834.594) (-831.687) (-834.971) [-832.384] -- 0:00:41
327500 -- [-831.282] (-834.911) (-830.921) (-831.773) * (-832.463) (-830.854) [-831.535] (-835.724) -- 0:00:41
328000 -- (-830.953) (-835.690) (-830.116) [-834.432] * (-832.102) [-832.746] (-832.733) (-830.538) -- 0:00:40
328500 -- (-831.769) (-832.498) (-832.022) [-834.078] * (-831.921) (-831.509) (-832.208) [-833.073] -- 0:00:40
329000 -- [-832.554] (-837.814) (-831.951) (-830.759) * (-834.102) (-832.012) (-832.877) [-832.979] -- 0:00:40
329500 -- (-831.118) (-832.951) [-831.805] (-832.617) * (-833.223) (-831.451) (-832.072) [-831.057] -- 0:00:40
330000 -- (-832.168) (-833.030) [-830.532] (-835.239) * (-833.132) (-833.671) (-831.004) [-830.529] -- 0:00:40
Average standard deviation of split frequencies: 0.008197
330500 -- (-832.816) (-831.284) (-832.055) [-833.447] * (-831.255) [-833.019] (-835.687) (-830.863) -- 0:00:40
331000 -- (-834.100) (-832.550) [-832.074] (-832.487) * [-833.242] (-842.707) (-835.333) (-831.777) -- 0:00:40
331500 -- (-834.796) [-832.385] (-831.072) (-830.800) * (-830.173) (-838.297) (-835.665) [-830.778] -- 0:00:40
332000 -- [-834.309] (-840.369) (-832.135) (-832.194) * [-832.450] (-834.878) (-831.924) (-831.406) -- 0:00:40
332500 -- (-831.563) (-831.004) (-837.381) [-833.229] * (-830.957) (-831.444) [-834.300] (-831.512) -- 0:00:40
333000 -- (-831.483) (-830.804) (-830.798) [-832.162] * (-833.636) [-830.072] (-834.922) (-832.483) -- 0:00:40
333500 -- (-833.480) [-830.524] (-831.683) (-834.333) * (-831.276) (-830.847) (-831.491) [-831.592] -- 0:00:39
334000 -- [-831.450] (-832.012) (-830.290) (-833.577) * (-830.757) [-831.015] (-832.775) (-833.342) -- 0:00:39
334500 -- (-834.731) (-833.744) (-829.763) [-830.608] * (-830.693) (-832.467) [-838.315] (-835.569) -- 0:00:39
335000 -- (-835.851) (-831.016) (-830.562) [-830.930] * (-831.466) [-830.711] (-831.324) (-832.191) -- 0:00:39
Average standard deviation of split frequencies: 0.009032
335500 -- (-835.664) [-831.245] (-834.500) (-833.036) * (-834.980) (-830.751) [-833.169] (-834.548) -- 0:00:39
336000 -- [-831.184] (-832.772) (-830.005) (-831.306) * (-832.347) (-837.269) [-831.265] (-834.887) -- 0:00:39
336500 -- (-831.340) (-832.445) (-830.000) [-831.483] * [-830.951] (-833.600) (-832.949) (-831.729) -- 0:00:39
337000 -- (-831.464) (-835.495) (-830.007) [-832.161] * (-830.509) [-834.306] (-833.239) (-831.383) -- 0:00:39
337500 -- [-830.583] (-833.597) (-831.008) (-832.479) * (-834.934) (-832.013) [-831.388] (-833.133) -- 0:00:41
338000 -- (-832.332) (-833.129) [-831.892] (-832.583) * (-832.421) [-831.174] (-831.576) (-831.681) -- 0:00:41
338500 -- [-832.091] (-831.868) (-833.187) (-831.196) * (-831.257) (-831.663) [-838.286] (-831.407) -- 0:00:41
339000 -- [-831.881] (-830.159) (-834.833) (-830.820) * (-831.436) (-831.147) (-833.006) [-832.853] -- 0:00:40
339500 -- (-832.536) (-833.362) [-833.452] (-833.857) * [-834.745] (-830.014) (-831.354) (-831.203) -- 0:00:40
340000 -- (-832.130) (-831.065) (-834.496) [-834.636] * (-830.374) (-837.342) (-831.391) [-832.384] -- 0:00:40
Average standard deviation of split frequencies: 0.009513
340500 -- (-831.422) (-834.331) (-833.126) [-831.393] * [-831.216] (-834.425) (-831.291) (-831.867) -- 0:00:40
341000 -- [-830.620] (-832.802) (-833.614) (-831.747) * (-829.963) (-834.238) [-830.884] (-830.431) -- 0:00:40
341500 -- (-830.760) [-831.884] (-831.512) (-831.419) * [-831.474] (-832.526) (-832.743) (-830.119) -- 0:00:40
342000 -- [-832.328] (-830.460) (-833.698) (-832.704) * (-832.424) [-831.899] (-836.335) (-831.050) -- 0:00:40
342500 -- (-831.175) [-830.460] (-831.335) (-832.335) * (-831.664) [-831.456] (-838.845) (-831.219) -- 0:00:40
343000 -- [-833.571] (-832.314) (-832.566) (-831.360) * [-833.687] (-832.132) (-831.247) (-834.762) -- 0:00:40
343500 -- (-835.025) (-837.590) [-831.367] (-830.397) * [-830.930] (-830.676) (-838.152) (-831.283) -- 0:00:40
344000 -- (-831.994) (-831.445) (-835.377) [-830.244] * (-831.622) (-833.178) [-834.136] (-830.973) -- 0:00:40
344500 -- [-831.103] (-832.134) (-834.758) (-829.707) * (-831.266) (-830.376) [-831.333] (-832.133) -- 0:00:39
345000 -- (-830.600) [-831.430] (-830.607) (-836.756) * [-831.562] (-831.504) (-843.078) (-832.689) -- 0:00:39
Average standard deviation of split frequencies: 0.010048
345500 -- (-831.151) (-833.642) (-829.924) [-837.063] * (-832.107) [-833.321] (-831.937) (-833.067) -- 0:00:39
346000 -- (-831.918) [-830.840] (-830.944) (-833.673) * (-831.928) (-833.013) [-832.270] (-831.037) -- 0:00:39
346500 -- (-831.330) (-836.582) (-832.861) [-831.018] * (-833.018) [-832.986] (-833.133) (-831.731) -- 0:00:39
347000 -- [-830.323] (-835.928) (-834.790) (-833.014) * (-833.991) (-831.164) (-833.468) [-832.202] -- 0:00:39
347500 -- (-833.667) (-832.564) [-833.984] (-831.744) * (-833.897) (-831.910) (-832.623) [-830.943] -- 0:00:39
348000 -- (-831.596) [-830.816] (-831.546) (-833.859) * (-836.231) (-835.658) (-834.366) [-830.659] -- 0:00:39
348500 -- (-831.692) [-830.676] (-832.691) (-831.717) * (-833.101) (-831.752) [-830.710] (-834.096) -- 0:00:39
349000 -- [-832.557] (-834.277) (-835.772) (-831.780) * (-830.231) [-831.547] (-829.876) (-834.113) -- 0:00:39
349500 -- (-834.101) (-835.972) (-830.970) [-831.219] * (-830.837) [-832.979] (-830.687) (-831.592) -- 0:00:39
350000 -- (-830.290) (-835.844) (-830.757) [-832.820] * [-832.257] (-831.912) (-831.074) (-832.882) -- 0:00:39
Average standard deviation of split frequencies: 0.011091
350500 -- (-834.097) (-835.455) (-830.512) [-831.180] * (-832.474) (-830.854) [-831.216] (-830.447) -- 0:00:38
351000 -- (-831.000) (-833.348) (-830.656) [-832.408] * (-831.043) (-830.455) [-833.914] (-832.114) -- 0:00:38
351500 -- (-831.075) (-833.432) (-831.980) [-835.952] * (-835.005) (-830.844) (-830.959) [-832.008] -- 0:00:38
352000 -- (-836.126) (-832.036) [-831.028] (-831.976) * (-833.241) (-830.281) [-831.637] (-832.926) -- 0:00:38
352500 -- (-830.694) (-832.191) (-835.112) [-829.857] * [-832.048] (-836.883) (-834.834) (-831.738) -- 0:00:38
353000 -- (-831.893) [-831.830] (-832.470) (-830.060) * (-834.827) (-833.405) (-832.404) [-831.436] -- 0:00:38
353500 -- (-831.421) (-835.034) (-832.242) [-831.941] * (-834.515) (-834.747) [-831.040] (-831.133) -- 0:00:38
354000 -- [-830.342] (-833.623) (-833.416) (-831.521) * (-830.934) (-836.225) [-830.276] (-831.508) -- 0:00:40
354500 -- (-833.689) [-831.744] (-831.762) (-830.708) * (-832.446) [-835.329] (-834.937) (-832.247) -- 0:00:40
355000 -- (-832.672) [-833.728] (-833.209) (-832.008) * (-837.331) (-831.748) (-834.000) [-832.623] -- 0:00:39
Average standard deviation of split frequencies: 0.010749
355500 -- (-830.891) (-831.431) [-830.832] (-833.035) * (-832.726) (-831.150) [-833.189] (-833.517) -- 0:00:39
356000 -- [-830.714] (-832.165) (-835.763) (-831.286) * (-835.475) (-831.375) [-831.483] (-831.472) -- 0:00:39
356500 -- (-833.247) [-836.435] (-830.907) (-834.279) * (-831.427) [-833.874] (-830.944) (-833.452) -- 0:00:39
357000 -- (-832.851) [-833.999] (-832.964) (-837.464) * (-831.698) (-834.280) [-831.026] (-837.490) -- 0:00:39
357500 -- (-830.598) [-833.716] (-830.732) (-831.043) * (-830.219) (-831.913) [-832.576] (-831.274) -- 0:00:39
358000 -- (-832.908) (-834.542) [-829.934] (-832.800) * (-830.923) (-831.717) [-830.829] (-832.734) -- 0:00:39
358500 -- [-832.392] (-832.396) (-829.804) (-832.166) * (-833.394) (-835.766) [-833.674] (-838.076) -- 0:00:39
359000 -- (-835.166) (-832.076) [-830.770] (-830.298) * (-830.918) (-832.866) (-831.235) [-833.163] -- 0:00:39
359500 -- (-835.811) (-830.640) (-832.121) [-830.174] * (-831.488) (-831.228) (-832.872) [-831.170] -- 0:00:39
360000 -- (-834.231) [-831.798] (-833.927) (-834.332) * (-833.047) (-834.217) [-832.593] (-831.963) -- 0:00:39
Average standard deviation of split frequencies: 0.010918
360500 -- (-836.959) [-831.128] (-840.177) (-836.986) * (-829.864) (-831.138) (-836.517) [-830.710] -- 0:00:39
361000 -- [-835.153] (-831.073) (-830.437) (-834.923) * (-831.000) [-832.425] (-832.098) (-830.463) -- 0:00:38
361500 -- (-838.232) [-830.924] (-832.717) (-833.202) * (-830.833) (-832.443) [-832.115] (-830.714) -- 0:00:38
362000 -- (-834.976) (-836.442) (-833.427) [-831.137] * (-831.778) [-833.215] (-832.251) (-830.066) -- 0:00:38
362500 -- (-833.259) [-833.589] (-831.780) (-830.594) * (-831.073) (-833.675) [-832.043] (-832.284) -- 0:00:38
363000 -- [-833.828] (-833.578) (-830.985) (-830.121) * [-833.103] (-831.634) (-831.298) (-832.959) -- 0:00:38
363500 -- (-830.257) (-834.977) [-831.195] (-830.121) * (-837.123) (-831.071) (-830.503) [-837.041] -- 0:00:38
364000 -- [-833.184] (-835.810) (-831.039) (-830.154) * (-831.064) [-831.045] (-834.652) (-830.071) -- 0:00:38
364500 -- (-831.611) (-834.054) [-830.358] (-834.372) * (-833.225) (-840.068) [-835.217] (-831.712) -- 0:00:38
365000 -- [-830.271] (-832.099) (-830.723) (-830.141) * (-832.057) (-834.876) (-833.734) [-833.410] -- 0:00:38
Average standard deviation of split frequencies: 0.010001
365500 -- [-830.166] (-832.604) (-830.838) (-832.718) * (-831.119) (-834.767) [-831.740] (-835.718) -- 0:00:38
366000 -- (-832.819) [-832.926] (-836.359) (-834.025) * (-831.904) [-830.689] (-830.842) (-832.398) -- 0:00:38
366500 -- (-831.677) (-830.488) (-832.251) [-835.217] * (-830.894) (-830.612) (-834.180) [-831.118] -- 0:00:38
367000 -- [-831.337] (-831.531) (-831.192) (-831.897) * (-832.385) [-832.472] (-830.131) (-830.946) -- 0:00:37
367500 -- (-831.423) (-833.179) (-833.999) [-831.746] * (-831.822) (-832.329) (-833.954) [-830.181] -- 0:00:37
368000 -- [-834.284] (-831.527) (-832.418) (-834.221) * (-831.887) (-832.982) (-833.747) [-830.642] -- 0:00:37
368500 -- (-832.003) (-831.796) [-830.965] (-833.391) * (-834.861) [-830.690] (-832.278) (-833.116) -- 0:00:37
369000 -- (-831.369) (-832.346) (-831.453) [-831.877] * (-831.221) (-831.232) (-830.674) [-832.276] -- 0:00:37
369500 -- (-831.365) (-834.287) (-831.691) [-832.788] * (-837.171) (-830.770) (-830.850) [-831.006] -- 0:00:37
370000 -- (-832.500) [-830.571] (-835.349) (-832.881) * [-832.402] (-829.809) (-836.583) (-832.070) -- 0:00:37
Average standard deviation of split frequencies: 0.009351
370500 -- (-831.753) [-830.130] (-833.948) (-832.836) * (-831.545) (-833.222) (-830.657) [-832.693] -- 0:00:39
371000 -- (-833.447) (-836.622) (-836.270) [-832.117] * [-831.990] (-833.522) (-830.872) (-831.465) -- 0:00:38
371500 -- (-832.602) (-835.078) [-835.328] (-833.756) * (-831.330) (-835.386) [-835.262] (-831.540) -- 0:00:38
372000 -- (-837.895) (-832.840) [-834.632] (-833.231) * (-837.660) (-838.732) (-831.076) [-830.845] -- 0:00:38
372500 -- [-831.682] (-835.127) (-833.176) (-831.297) * (-832.684) (-832.550) (-838.710) [-834.138] -- 0:00:38
373000 -- (-832.358) (-830.598) [-832.127] (-830.329) * (-831.122) [-834.363] (-833.594) (-833.594) -- 0:00:38
373500 -- (-830.879) (-831.278) (-831.118) [-831.251] * [-832.846] (-831.649) (-829.814) (-830.891) -- 0:00:38
374000 -- (-832.130) (-833.748) (-832.227) [-830.896] * (-833.351) (-834.500) (-831.605) [-831.474] -- 0:00:38
374500 -- (-830.222) (-832.748) [-831.481] (-832.051) * (-834.690) [-832.861] (-831.352) (-833.681) -- 0:00:38
375000 -- [-832.036] (-831.480) (-831.465) (-831.567) * (-831.799) (-834.047) (-831.994) [-833.038] -- 0:00:38
Average standard deviation of split frequencies: 0.009638
375500 -- (-831.789) [-837.103] (-830.923) (-832.815) * (-834.463) [-831.557] (-831.947) (-831.805) -- 0:00:38
376000 -- [-832.852] (-831.860) (-833.285) (-832.305) * (-833.208) [-833.048] (-831.737) (-831.575) -- 0:00:38
376500 -- (-835.016) [-831.325] (-833.200) (-830.572) * (-834.886) (-831.531) [-831.486] (-831.815) -- 0:00:38
377000 -- [-831.098] (-833.477) (-832.655) (-831.386) * (-832.317) (-831.362) [-831.529] (-831.927) -- 0:00:38
377500 -- (-831.469) [-834.778] (-832.520) (-830.075) * (-836.409) [-831.781] (-831.145) (-831.727) -- 0:00:37
378000 -- (-830.512) (-831.769) (-832.001) [-830.371] * (-831.935) (-831.724) (-832.902) [-831.996] -- 0:00:37
378500 -- (-830.784) (-834.815) (-837.078) [-832.236] * (-830.633) (-833.614) (-831.520) [-830.483] -- 0:00:37
379000 -- (-830.659) (-831.311) (-838.546) [-830.668] * (-830.224) (-831.635) [-830.661] (-830.899) -- 0:00:37
379500 -- (-831.505) (-832.558) (-832.729) [-833.786] * (-830.369) (-830.651) [-831.280] (-831.066) -- 0:00:37
380000 -- (-833.014) (-831.509) [-835.052] (-833.413) * (-832.816) (-830.504) [-831.749] (-830.405) -- 0:00:37
Average standard deviation of split frequencies: 0.009443
380500 -- (-831.279) (-832.662) [-831.948] (-832.847) * (-834.286) [-833.556] (-832.568) (-830.418) -- 0:00:37
381000 -- (-832.053) (-834.653) (-832.431) [-831.263] * (-831.100) [-832.646] (-831.542) (-833.026) -- 0:00:37
381500 -- (-832.225) [-832.200] (-834.231) (-836.215) * (-832.535) (-830.630) [-834.306] (-830.010) -- 0:00:37
382000 -- (-832.957) (-832.120) [-831.472] (-832.001) * [-832.479] (-831.818) (-835.527) (-830.909) -- 0:00:37
382500 -- (-831.438) (-830.972) (-830.930) [-830.815] * (-834.070) (-830.772) (-834.629) [-831.507] -- 0:00:37
383000 -- [-832.782] (-830.973) (-831.227) (-835.367) * [-834.234] (-832.814) (-832.675) (-834.224) -- 0:00:37
383500 -- (-836.568) (-834.400) [-830.833] (-832.976) * (-835.714) (-833.889) [-834.305] (-832.219) -- 0:00:36
384000 -- [-832.843] (-831.948) (-832.016) (-832.462) * (-839.975) (-832.657) (-835.237) [-830.460] -- 0:00:36
384500 -- (-834.788) (-833.553) [-831.343] (-832.026) * (-830.780) (-832.103) [-831.244] (-831.514) -- 0:00:36
385000 -- [-831.851] (-833.139) (-830.955) (-835.526) * (-830.644) [-832.691] (-834.352) (-832.260) -- 0:00:36
Average standard deviation of split frequencies: 0.009007
385500 -- (-831.296) (-835.220) (-831.194) [-832.220] * (-830.285) (-832.500) (-832.069) [-831.568] -- 0:00:36
386000 -- [-831.829] (-835.601) (-830.500) (-836.594) * (-831.036) (-833.305) (-834.245) [-831.018] -- 0:00:36
386500 -- [-832.903] (-832.453) (-831.901) (-833.802) * [-831.501] (-832.246) (-834.554) (-830.904) -- 0:00:36
387000 -- (-832.451) [-830.615] (-833.114) (-834.762) * [-831.258] (-829.791) (-834.017) (-832.628) -- 0:00:38
387500 -- [-833.230] (-831.968) (-832.093) (-832.083) * (-830.695) [-830.389] (-835.016) (-833.543) -- 0:00:37
388000 -- [-834.141] (-832.201) (-832.022) (-834.738) * (-831.260) (-832.120) [-831.795] (-837.623) -- 0:00:37
388500 -- [-832.756] (-836.117) (-832.382) (-837.091) * [-832.945] (-832.969) (-830.722) (-831.888) -- 0:00:37
389000 -- (-830.829) (-832.328) [-830.693] (-830.791) * (-831.483) (-833.140) [-831.506] (-830.965) -- 0:00:37
389500 -- [-831.398] (-832.833) (-831.239) (-832.350) * [-831.476] (-833.063) (-831.125) (-833.009) -- 0:00:37
390000 -- (-832.306) (-831.472) [-830.778] (-830.541) * [-832.384] (-830.770) (-838.276) (-836.222) -- 0:00:37
Average standard deviation of split frequencies: 0.009010
390500 -- (-834.252) (-830.439) [-830.176] (-831.553) * (-831.246) (-830.147) [-832.640] (-832.919) -- 0:00:37
391000 -- (-830.923) (-833.802) (-833.428) [-831.295] * (-831.990) [-830.333] (-834.150) (-831.784) -- 0:00:37
391500 -- (-831.189) (-831.027) [-831.628] (-832.054) * (-829.995) (-831.476) (-833.639) [-832.605] -- 0:00:37
392000 -- (-830.894) (-836.391) (-832.980) [-832.127] * [-830.841] (-831.132) (-832.015) (-830.078) -- 0:00:37
392500 -- [-831.428] (-836.161) (-832.038) (-831.493) * [-833.090] (-832.709) (-832.720) (-833.209) -- 0:00:37
393000 -- (-831.056) (-831.968) (-832.960) [-830.250] * [-838.769] (-831.626) (-833.857) (-830.408) -- 0:00:37
393500 -- (-831.813) [-833.131] (-831.752) (-831.532) * [-833.364] (-831.296) (-831.458) (-835.334) -- 0:00:36
394000 -- [-831.838] (-832.894) (-830.848) (-832.463) * (-832.278) (-831.473) [-832.719] (-833.060) -- 0:00:36
394500 -- [-831.643] (-830.691) (-832.997) (-830.165) * (-831.428) (-836.215) [-831.986] (-830.966) -- 0:00:36
395000 -- (-831.549) [-830.835] (-833.157) (-830.196) * [-830.526] (-833.540) (-831.585) (-830.834) -- 0:00:36
Average standard deviation of split frequencies: 0.008888
395500 -- (-831.375) [-831.050] (-833.486) (-834.874) * [-830.712] (-833.951) (-834.423) (-836.585) -- 0:00:36
396000 -- (-829.821) (-833.271) [-833.226] (-833.495) * (-834.868) (-835.111) [-831.329] (-837.648) -- 0:00:36
396500 -- (-829.821) (-832.639) [-834.923] (-837.262) * (-834.633) [-831.159] (-830.967) (-831.439) -- 0:00:36
397000 -- (-830.397) (-830.986) [-831.924] (-833.455) * (-835.908) (-831.277) [-832.396] (-830.869) -- 0:00:36
397500 -- [-832.730] (-832.280) (-834.500) (-834.705) * (-831.582) (-831.431) [-830.969] (-832.506) -- 0:00:36
398000 -- (-832.947) [-830.845] (-831.639) (-833.791) * [-831.119] (-833.492) (-832.184) (-830.592) -- 0:00:36
398500 -- (-836.451) (-832.149) (-831.285) [-831.709] * (-831.097) (-832.041) (-837.148) [-832.715] -- 0:00:36
399000 -- (-831.648) (-834.489) (-832.103) [-831.197] * [-831.716] (-834.532) (-831.617) (-832.131) -- 0:00:36
399500 -- [-832.778] (-838.146) (-833.104) (-832.294) * (-832.096) (-833.047) (-832.364) [-833.426] -- 0:00:36
400000 -- (-832.863) (-835.970) (-832.077) [-830.933] * (-831.096) (-831.756) [-832.738] (-832.900) -- 0:00:36
Average standard deviation of split frequencies: 0.008471
400500 -- (-835.595) [-833.596] (-830.834) (-831.676) * (-832.524) [-830.415] (-832.747) (-832.366) -- 0:00:35
401000 -- (-831.178) (-835.667) (-830.660) [-831.730] * [-833.379] (-833.041) (-831.422) (-832.001) -- 0:00:35
401500 -- (-833.929) (-832.895) (-832.543) [-832.558] * (-834.878) [-831.438] (-832.301) (-831.150) -- 0:00:35
402000 -- [-833.928] (-833.922) (-830.549) (-832.681) * (-832.773) (-835.499) [-833.074] (-830.330) -- 0:00:35
402500 -- (-834.708) (-835.392) (-831.608) [-833.809] * [-832.798] (-835.735) (-833.992) (-830.967) -- 0:00:35
403000 -- (-833.715) (-834.241) [-830.094] (-835.513) * (-830.842) (-833.590) (-832.864) [-832.601] -- 0:00:35
403500 -- (-832.121) (-832.900) (-830.153) [-833.147] * (-832.493) (-830.134) (-831.129) [-831.051] -- 0:00:36
404000 -- (-831.363) [-831.480] (-831.813) (-831.701) * (-831.369) (-833.172) (-832.894) [-831.356] -- 0:00:36
404500 -- (-831.133) (-831.259) (-832.340) [-834.229] * (-835.481) [-834.077] (-832.585) (-833.831) -- 0:00:36
405000 -- [-832.812] (-830.980) (-832.799) (-831.553) * [-833.800] (-838.087) (-830.494) (-832.475) -- 0:00:36
Average standard deviation of split frequencies: 0.008200
405500 -- [-836.950] (-837.047) (-837.689) (-830.871) * (-831.271) [-836.333] (-831.283) (-833.580) -- 0:00:36
406000 -- (-833.304) (-834.033) [-832.309] (-830.826) * (-835.330) (-834.233) [-835.396] (-832.551) -- 0:00:36
406500 -- (-831.463) (-835.035) [-835.507] (-835.808) * [-833.099] (-832.352) (-832.908) (-831.030) -- 0:00:36
407000 -- (-830.161) (-832.982) (-831.260) [-831.381] * (-832.436) (-832.374) [-830.745] (-833.563) -- 0:00:36
407500 -- (-831.725) (-834.722) [-830.376] (-830.822) * (-830.847) (-831.043) (-831.386) [-834.002] -- 0:00:36
408000 -- [-831.995] (-835.503) (-830.940) (-830.953) * (-830.635) [-829.767] (-834.293) (-831.610) -- 0:00:36
408500 -- (-835.073) (-830.517) [-830.194] (-831.391) * (-830.536) (-830.255) [-833.005] (-832.278) -- 0:00:36
409000 -- (-834.468) (-833.107) (-830.277) [-831.882] * (-830.603) (-832.001) (-831.704) [-832.833] -- 0:00:36
409500 -- [-831.041] (-831.804) (-830.439) (-835.835) * (-830.406) (-833.543) [-831.708] (-830.451) -- 0:00:36
410000 -- [-830.824] (-833.557) (-831.089) (-831.799) * (-831.964) (-835.934) (-832.995) [-830.007] -- 0:00:35
Average standard deviation of split frequencies: 0.008251
410500 -- (-831.480) (-836.931) (-830.499) [-830.356] * [-830.281] (-831.214) (-833.732) (-831.882) -- 0:00:35
411000 -- (-834.978) (-831.747) [-831.020] (-831.920) * (-830.281) [-832.242] (-837.989) (-831.025) -- 0:00:35
411500 -- (-834.370) [-833.205] (-834.875) (-833.001) * (-831.176) [-832.613] (-834.239) (-833.286) -- 0:00:35
412000 -- [-829.853] (-834.496) (-834.488) (-831.550) * (-834.825) (-832.689) [-832.103] (-832.799) -- 0:00:35
412500 -- (-830.216) (-831.377) (-835.381) [-833.710] * [-833.939] (-831.428) (-831.839) (-830.727) -- 0:00:35
413000 -- (-831.555) (-831.812) [-832.164] (-832.579) * (-831.974) (-830.270) [-831.778] (-831.129) -- 0:00:35
413500 -- [-831.234] (-831.911) (-830.591) (-831.298) * [-830.715] (-831.424) (-830.473) (-831.847) -- 0:00:35
414000 -- (-830.348) (-830.741) (-830.605) [-831.647] * (-831.866) [-833.602] (-830.133) (-832.244) -- 0:00:35
414500 -- (-834.115) [-830.037] (-832.722) (-833.246) * (-831.753) (-833.929) (-835.760) [-830.836] -- 0:00:35
415000 -- [-836.156] (-832.417) (-834.909) (-831.106) * (-830.692) (-836.653) [-833.863] (-830.239) -- 0:00:35
Average standard deviation of split frequencies: 0.008357
415500 -- (-836.080) (-834.605) [-831.363] (-831.241) * (-831.667) (-832.442) (-833.065) [-830.214] -- 0:00:35
416000 -- (-831.792) (-830.378) (-831.358) [-830.408] * (-833.429) (-835.516) [-831.185] (-831.894) -- 0:00:35
416500 -- (-831.752) (-833.381) (-833.318) [-830.048] * (-832.869) (-834.110) (-830.414) [-830.320] -- 0:00:35
417000 -- (-832.702) (-832.411) [-833.321] (-836.056) * (-834.716) (-830.789) [-830.512] (-831.934) -- 0:00:34
417500 -- [-831.939] (-838.152) (-833.838) (-833.817) * (-831.851) (-832.267) (-831.658) [-832.457] -- 0:00:34
418000 -- (-833.891) [-832.571] (-836.762) (-831.276) * (-831.327) (-831.072) (-830.248) [-832.147] -- 0:00:34
418500 -- (-832.509) [-830.677] (-835.189) (-832.318) * (-831.738) (-830.240) (-830.168) [-831.433] -- 0:00:34
419000 -- (-830.271) [-833.411] (-832.485) (-832.968) * (-831.306) [-833.730] (-830.454) (-831.277) -- 0:00:34
419500 -- [-831.128] (-831.527) (-830.991) (-832.649) * (-833.104) [-835.122] (-831.173) (-830.801) -- 0:00:34
420000 -- (-830.342) (-830.595) (-829.705) [-830.800] * (-832.795) (-833.359) (-832.595) [-831.074] -- 0:00:34
Average standard deviation of split frequencies: 0.008405
420500 -- (-833.864) (-829.796) [-830.625] (-834.030) * (-831.340) (-832.194) [-831.996] (-832.439) -- 0:00:35
421000 -- [-834.013] (-830.976) (-829.934) (-836.332) * (-829.941) (-834.420) [-831.848] (-832.130) -- 0:00:35
421500 -- [-833.369] (-835.400) (-831.971) (-831.177) * (-830.177) (-832.194) (-832.048) [-832.163] -- 0:00:35
422000 -- (-831.607) [-834.547] (-835.030) (-831.183) * (-830.289) (-830.212) [-831.685] (-832.324) -- 0:00:35
422500 -- (-832.005) (-833.110) (-830.510) [-836.139] * [-832.783] (-830.809) (-831.767) (-832.108) -- 0:00:35
423000 -- (-831.666) [-833.930] (-831.759) (-832.274) * (-834.405) (-832.515) (-831.667) [-833.491] -- 0:00:35
423500 -- (-833.414) (-835.091) [-830.176] (-832.582) * (-837.059) (-835.024) (-830.517) [-832.234] -- 0:00:35
424000 -- (-832.591) (-833.819) (-832.771) [-831.880] * [-837.970] (-830.825) (-832.012) (-830.656) -- 0:00:35
424500 -- (-831.073) [-832.897] (-831.111) (-831.905) * (-834.304) (-831.391) (-832.297) [-831.198] -- 0:00:35
425000 -- [-830.076] (-831.007) (-831.671) (-833.006) * [-830.551] (-833.408) (-831.725) (-829.870) -- 0:00:35
Average standard deviation of split frequencies: 0.008576
425500 -- (-833.999) (-835.116) [-832.406] (-835.601) * (-833.685) [-831.897] (-832.678) (-830.088) -- 0:00:35
426000 -- (-832.106) [-830.525] (-834.249) (-832.078) * [-833.499] (-834.647) (-831.675) (-831.854) -- 0:00:35
426500 -- (-838.877) (-831.214) [-831.763] (-840.212) * (-835.423) (-832.308) [-830.889] (-831.608) -- 0:00:34
427000 -- (-836.192) [-831.960] (-832.704) (-832.684) * (-831.759) [-831.522] (-833.525) (-830.857) -- 0:00:34
427500 -- [-838.407] (-830.428) (-831.239) (-829.913) * (-835.062) (-830.485) (-832.379) [-834.135] -- 0:00:34
428000 -- [-832.781] (-833.080) (-832.034) (-830.351) * (-834.249) (-830.851) (-838.261) [-832.031] -- 0:00:34
428500 -- (-839.587) (-831.865) (-830.713) [-830.180] * (-832.392) [-831.213] (-835.355) (-830.650) -- 0:00:34
429000 -- (-834.007) [-831.115] (-832.802) (-832.138) * (-834.860) [-832.008] (-835.361) (-830.366) -- 0:00:34
429500 -- [-834.317] (-831.567) (-831.148) (-830.947) * (-831.984) [-830.509] (-832.621) (-831.495) -- 0:00:34
430000 -- (-837.798) (-833.549) [-830.957] (-831.132) * [-831.891] (-837.924) (-835.374) (-831.082) -- 0:00:34
Average standard deviation of split frequencies: 0.008894
430500 -- [-831.950] (-833.050) (-832.797) (-831.833) * (-830.659) (-832.836) (-831.242) [-832.531] -- 0:00:34
431000 -- [-834.678] (-832.566) (-831.375) (-832.724) * (-830.512) (-835.604) (-834.271) [-832.045] -- 0:00:34
431500 -- (-831.805) [-832.729] (-831.797) (-831.197) * (-833.501) [-830.913] (-832.455) (-831.160) -- 0:00:34
432000 -- [-831.613] (-832.762) (-833.928) (-831.156) * (-830.896) (-830.912) [-831.054] (-834.124) -- 0:00:34
432500 -- [-831.732] (-834.708) (-832.643) (-834.811) * [-834.813] (-831.489) (-833.188) (-831.737) -- 0:00:34
433000 -- (-832.942) (-838.608) [-830.801] (-835.792) * (-831.262) (-830.658) (-832.456) [-831.615] -- 0:00:34
433500 -- [-831.753] (-836.332) (-835.134) (-834.380) * (-830.928) [-831.678] (-833.812) (-833.754) -- 0:00:33
434000 -- (-832.093) [-831.427] (-831.859) (-835.844) * (-835.838) (-831.183) [-835.000] (-831.914) -- 0:00:33
434500 -- (-832.817) (-832.740) (-831.142) [-831.299] * (-832.789) (-832.200) [-830.576] (-830.542) -- 0:00:33
435000 -- (-833.003) (-835.483) (-836.403) [-831.316] * [-832.480] (-836.300) (-832.802) (-830.452) -- 0:00:33
Average standard deviation of split frequencies: 0.009190
435500 -- (-831.834) (-834.499) [-834.227] (-832.045) * [-830.380] (-836.785) (-830.931) (-830.848) -- 0:00:33
436000 -- [-832.017] (-832.214) (-833.785) (-831.216) * (-834.060) (-831.606) (-832.337) [-829.831] -- 0:00:33
436500 -- (-832.228) (-831.942) (-836.683) [-836.031] * [-833.096] (-833.835) (-831.717) (-830.506) -- 0:00:34
437000 -- (-835.296) (-836.214) (-835.356) [-834.355] * (-835.251) (-833.811) [-831.151] (-831.941) -- 0:00:34
437500 -- (-834.282) (-831.558) [-830.196] (-839.970) * (-833.925) (-835.390) (-831.508) [-834.498] -- 0:00:34
438000 -- (-833.322) [-830.318] (-831.341) (-833.361) * (-832.129) [-831.487] (-833.013) (-832.969) -- 0:00:34
438500 -- [-830.606] (-831.725) (-831.248) (-836.666) * (-831.097) (-830.213) [-831.681] (-832.153) -- 0:00:34
439000 -- (-831.436) [-831.995] (-830.860) (-835.917) * (-832.393) [-833.082] (-834.330) (-832.420) -- 0:00:34
439500 -- [-830.985] (-833.949) (-830.945) (-835.567) * (-834.265) (-836.641) (-832.451) [-831.310] -- 0:00:34
440000 -- [-830.974] (-833.043) (-831.769) (-834.385) * [-831.274] (-831.209) (-835.810) (-829.886) -- 0:00:34
Average standard deviation of split frequencies: 0.009093
440500 -- (-833.531) (-833.127) [-833.763] (-834.192) * [-830.815] (-830.426) (-831.711) (-833.270) -- 0:00:34
441000 -- (-831.327) [-833.763] (-833.315) (-837.893) * [-831.008] (-830.493) (-830.591) (-833.425) -- 0:00:34
441500 -- (-831.296) [-833.298] (-831.036) (-842.555) * (-831.189) (-832.440) (-838.392) [-832.481] -- 0:00:34
442000 -- (-831.930) [-831.266] (-830.638) (-834.538) * (-832.314) (-832.753) [-833.835] (-831.938) -- 0:00:34
442500 -- (-831.807) (-832.739) [-831.062] (-832.488) * (-832.668) (-832.383) (-830.386) [-830.431] -- 0:00:34
443000 -- (-832.472) [-836.717] (-830.849) (-830.895) * (-830.233) (-831.225) (-833.928) [-830.862] -- 0:00:33
443500 -- (-832.764) [-834.270] (-832.421) (-832.607) * (-831.895) (-829.859) [-830.639] (-831.478) -- 0:00:33
444000 -- (-830.371) (-831.471) (-838.534) [-831.280] * (-834.566) [-832.110] (-834.009) (-832.052) -- 0:00:33
444500 -- [-829.982] (-831.078) (-838.967) (-831.964) * [-831.885] (-831.120) (-830.265) (-832.423) -- 0:00:33
445000 -- (-833.266) (-835.344) [-832.500] (-830.467) * (-834.046) (-832.428) [-832.513] (-833.511) -- 0:00:33
Average standard deviation of split frequencies: 0.008704
445500 -- [-833.137] (-831.246) (-835.186) (-831.871) * (-831.757) (-832.634) (-835.099) [-831.058] -- 0:00:33
446000 -- (-835.371) [-831.034] (-833.747) (-830.909) * (-833.049) (-835.014) (-831.529) [-831.232] -- 0:00:33
446500 -- [-833.468] (-833.410) (-834.186) (-833.203) * (-834.622) [-829.698] (-830.025) (-830.745) -- 0:00:33
447000 -- (-830.120) (-834.092) (-830.649) [-837.138] * (-830.736) [-833.588] (-830.098) (-831.271) -- 0:00:33
447500 -- (-833.289) (-831.714) (-831.661) [-831.771] * (-832.825) (-830.239) (-832.319) [-831.890] -- 0:00:33
448000 -- (-833.159) (-833.472) [-834.057] (-830.821) * [-834.902] (-834.582) (-833.917) (-831.071) -- 0:00:33
448500 -- (-830.781) (-833.456) (-830.145) [-830.888] * [-834.941] (-832.714) (-833.944) (-831.988) -- 0:00:33
449000 -- (-830.769) [-831.707] (-831.936) (-832.480) * (-833.408) (-832.928) (-830.641) [-832.219] -- 0:00:33
449500 -- (-831.365) [-834.624] (-830.489) (-830.814) * (-832.216) (-833.237) [-834.085] (-832.850) -- 0:00:33
450000 -- (-831.072) (-831.128) (-832.814) [-830.784] * (-832.018) [-833.635] (-837.374) (-832.172) -- 0:00:33
Average standard deviation of split frequencies: 0.009106
450500 -- [-836.935] (-833.698) (-832.065) (-832.493) * (-831.615) [-834.071] (-832.561) (-831.073) -- 0:00:32
451000 -- (-833.528) [-833.741] (-834.216) (-833.825) * (-833.742) (-833.443) (-835.604) [-831.177] -- 0:00:32
451500 -- (-832.346) (-834.835) (-834.126) [-830.777] * (-832.760) [-830.349] (-832.112) (-833.258) -- 0:00:32
452000 -- (-832.121) (-830.992) (-835.476) [-830.699] * [-830.745] (-831.818) (-835.199) (-831.548) -- 0:00:32
452500 -- (-830.800) [-831.885] (-832.249) (-830.722) * [-830.270] (-830.966) (-834.516) (-832.469) -- 0:00:32
453000 -- (-834.261) (-830.328) (-830.652) [-831.036] * [-831.416] (-830.446) (-832.690) (-831.096) -- 0:00:32
453500 -- (-832.269) (-830.507) [-833.878] (-830.551) * (-830.177) [-833.844] (-832.064) (-833.648) -- 0:00:33
454000 -- (-833.907) [-831.248] (-830.864) (-831.534) * (-830.296) (-833.387) [-830.572] (-832.331) -- 0:00:33
454500 -- [-830.606] (-833.750) (-831.259) (-830.942) * (-831.259) (-832.333) [-831.711] (-832.524) -- 0:00:33
455000 -- (-829.820) (-836.382) [-836.823] (-834.366) * (-833.028) (-835.330) (-832.410) [-833.798] -- 0:00:33
Average standard deviation of split frequencies: 0.009718
455500 -- (-830.886) (-834.578) [-830.316] (-832.680) * [-830.826] (-830.085) (-832.393) (-831.878) -- 0:00:33
456000 -- (-832.329) [-833.293] (-830.637) (-831.621) * (-831.215) [-833.026] (-833.075) (-830.869) -- 0:00:33
456500 -- (-833.378) [-832.170] (-830.727) (-831.053) * (-833.392) (-832.977) [-830.702] (-832.695) -- 0:00:33
457000 -- (-836.555) (-831.996) [-831.738] (-832.583) * (-832.297) (-834.061) [-830.725] (-832.405) -- 0:00:33
457500 -- (-831.791) (-830.141) (-832.931) [-833.749] * (-834.344) (-836.039) [-831.282] (-831.656) -- 0:00:33
458000 -- (-833.319) [-831.663] (-833.645) (-834.970) * (-833.038) [-832.797] (-830.353) (-831.896) -- 0:00:33
458500 -- (-831.409) (-832.993) [-834.941] (-832.697) * (-830.787) (-833.664) (-830.066) [-831.692] -- 0:00:33
459000 -- (-833.391) (-834.343) [-833.570] (-831.073) * [-830.431] (-833.326) (-831.822) (-831.415) -- 0:00:33
459500 -- (-831.963) (-830.909) (-832.641) [-830.778] * [-833.208] (-831.655) (-832.741) (-830.295) -- 0:00:32
460000 -- (-831.807) (-830.409) [-832.325] (-832.861) * [-837.447] (-833.699) (-835.277) (-832.712) -- 0:00:32
Average standard deviation of split frequencies: 0.009483
460500 -- (-832.265) (-831.594) [-832.348] (-835.094) * (-830.398) [-830.895] (-834.410) (-836.692) -- 0:00:32
461000 -- (-834.495) (-832.427) (-832.716) [-834.366] * (-830.749) [-830.384] (-831.618) (-834.646) -- 0:00:32
461500 -- (-830.465) [-831.485] (-831.386) (-832.640) * [-830.188] (-831.818) (-830.903) (-833.728) -- 0:00:32
462000 -- (-830.465) (-831.284) (-831.456) [-831.155] * [-830.434] (-834.961) (-831.073) (-835.107) -- 0:00:32
462500 -- [-832.876] (-833.043) (-833.831) (-831.085) * (-832.229) (-830.872) [-831.104] (-832.846) -- 0:00:32
463000 -- [-832.540] (-833.639) (-830.859) (-832.020) * (-835.666) (-832.482) (-833.183) [-832.417] -- 0:00:32
463500 -- (-830.750) (-833.211) [-830.964] (-830.881) * (-831.494) (-833.535) [-833.774] (-833.401) -- 0:00:32
464000 -- [-832.938] (-832.349) (-832.228) (-833.801) * [-831.604] (-831.459) (-830.843) (-833.506) -- 0:00:32
464500 -- (-834.503) [-831.952] (-829.871) (-835.998) * (-834.461) (-831.739) [-835.565] (-829.752) -- 0:00:32
465000 -- (-835.111) (-831.167) (-831.643) [-831.068] * (-831.133) (-831.237) (-832.875) [-830.196] -- 0:00:32
Average standard deviation of split frequencies: 0.010179
465500 -- (-834.520) [-831.854] (-832.598) (-836.068) * (-833.657) (-831.028) [-830.456] (-830.909) -- 0:00:32
466000 -- (-833.130) (-830.856) (-832.065) [-832.802] * (-831.680) (-834.873) [-830.504] (-832.785) -- 0:00:32
466500 -- (-832.884) (-831.381) [-833.258] (-831.419) * (-831.443) (-830.494) [-829.782] (-831.240) -- 0:00:32
467000 -- (-831.117) [-831.381] (-835.676) (-834.448) * (-833.801) (-832.361) (-832.873) [-833.596] -- 0:00:31
467500 -- (-831.735) (-833.260) (-833.941) [-830.590] * (-837.871) (-832.396) [-831.261] (-834.587) -- 0:00:31
468000 -- (-832.422) (-832.326) [-831.897] (-833.489) * (-834.176) (-830.650) [-830.412] (-832.278) -- 0:00:31
468500 -- (-831.461) [-832.586] (-838.765) (-834.409) * (-831.124) (-832.892) (-838.001) [-830.181] -- 0:00:31
469000 -- (-832.721) (-830.928) [-832.411] (-836.021) * (-830.991) (-834.045) (-832.872) [-832.700] -- 0:00:31
469500 -- (-830.568) (-831.972) (-832.861) [-833.735] * [-830.339] (-834.630) (-833.333) (-833.109) -- 0:00:31
470000 -- (-832.874) [-832.021] (-830.301) (-832.374) * [-830.339] (-832.457) (-837.143) (-831.160) -- 0:00:32
Average standard deviation of split frequencies: 0.009191
470500 -- (-830.929) (-832.293) [-830.319] (-835.450) * [-829.998] (-832.223) (-837.042) (-831.295) -- 0:00:32
471000 -- (-832.764) (-833.010) (-830.391) [-835.389] * [-831.620] (-835.389) (-832.863) (-835.171) -- 0:00:32
471500 -- [-833.982] (-832.611) (-830.690) (-832.387) * (-832.813) [-834.707] (-833.171) (-832.832) -- 0:00:32
472000 -- (-832.998) (-834.150) (-830.698) [-833.154] * (-831.984) (-832.677) (-831.382) [-831.335] -- 0:00:32
472500 -- (-831.125) [-833.564] (-832.539) (-834.541) * (-836.361) (-832.771) [-833.352] (-832.955) -- 0:00:32
473000 -- (-831.270) [-831.123] (-830.096) (-834.214) * (-836.313) (-833.652) (-832.458) [-833.041] -- 0:00:32
473500 -- (-830.741) [-832.108] (-830.468) (-831.617) * (-831.434) (-832.697) (-832.685) [-836.506] -- 0:00:32
474000 -- [-833.955] (-839.379) (-833.239) (-831.206) * [-831.397] (-833.486) (-829.830) (-832.554) -- 0:00:32
474500 -- (-830.780) (-830.264) [-833.175] (-830.502) * [-834.010] (-833.880) (-830.232) (-837.161) -- 0:00:32
475000 -- (-832.299) [-830.995] (-835.281) (-830.496) * (-831.301) (-831.118) [-832.779] (-840.026) -- 0:00:32
Average standard deviation of split frequencies: 0.009263
475500 -- (-831.976) [-833.377] (-833.829) (-831.060) * (-833.576) (-832.522) [-830.444] (-836.155) -- 0:00:31
476000 -- [-831.203] (-832.482) (-834.567) (-830.306) * [-833.543] (-832.243) (-831.066) (-837.794) -- 0:00:31
476500 -- (-832.117) (-833.751) (-832.770) [-837.213] * (-830.203) (-831.314) [-830.941] (-833.725) -- 0:00:31
477000 -- (-832.156) [-833.658] (-832.232) (-830.176) * (-831.248) (-831.266) (-830.873) [-833.660] -- 0:00:31
477500 -- (-830.494) (-833.538) (-830.222) [-831.318] * [-831.974] (-831.013) (-830.653) (-832.413) -- 0:00:31
478000 -- (-831.880) (-829.786) (-831.814) [-831.247] * [-833.076] (-833.447) (-830.797) (-831.822) -- 0:00:31
478500 -- [-832.033] (-831.786) (-831.237) (-830.567) * (-831.026) (-831.882) (-831.805) [-831.808] -- 0:00:31
479000 -- [-838.049] (-832.453) (-831.048) (-831.442) * (-831.724) [-830.800] (-832.788) (-832.407) -- 0:00:31
479500 -- (-831.609) [-831.295] (-831.318) (-836.026) * (-832.206) [-831.748] (-831.022) (-833.003) -- 0:00:31
480000 -- (-832.035) (-833.728) [-834.208] (-832.421) * (-832.880) [-831.540] (-830.277) (-832.690) -- 0:00:31
Average standard deviation of split frequencies: 0.008596
480500 -- (-831.349) (-832.407) [-833.181] (-829.818) * [-832.397] (-831.472) (-832.741) (-831.035) -- 0:00:31
481000 -- [-832.939] (-831.522) (-830.841) (-829.915) * (-833.331) (-831.514) (-831.463) [-833.428] -- 0:00:31
481500 -- (-832.829) [-832.373] (-832.151) (-831.024) * (-833.324) (-832.257) (-831.666) [-834.988] -- 0:00:31
482000 -- (-835.360) (-830.480) (-830.442) [-831.481] * [-831.291] (-832.746) (-834.028) (-834.194) -- 0:00:31
482500 -- (-839.341) [-830.522] (-832.848) (-832.332) * (-831.468) (-832.555) [-831.834] (-831.759) -- 0:00:31
483000 -- (-832.690) (-831.283) [-830.277] (-832.896) * (-832.131) [-829.812] (-834.386) (-833.611) -- 0:00:31
483500 -- (-836.524) (-833.429) (-832.117) [-831.405] * (-831.419) [-831.618] (-832.353) (-832.937) -- 0:00:30
484000 -- [-833.543] (-832.582) (-832.061) (-838.321) * (-831.363) (-831.090) (-831.022) [-835.237] -- 0:00:30
484500 -- (-834.740) (-833.520) [-830.298] (-831.398) * (-830.313) [-837.988] (-830.967) (-833.510) -- 0:00:30
485000 -- (-833.140) [-833.545] (-830.162) (-830.733) * (-830.404) (-836.722) [-830.339] (-833.368) -- 0:00:30
Average standard deviation of split frequencies: 0.009243
485500 -- [-831.159] (-831.343) (-832.532) (-832.572) * (-843.167) (-833.728) [-830.934] (-836.505) -- 0:00:30
486000 -- (-831.159) (-830.342) [-831.685] (-832.242) * [-831.599] (-832.888) (-831.680) (-832.376) -- 0:00:30
486500 -- (-831.064) [-832.020] (-832.585) (-830.703) * (-830.179) (-830.013) [-833.823] (-832.715) -- 0:00:31
487000 -- (-829.852) (-833.710) [-831.451] (-831.051) * (-831.199) [-830.293] (-829.952) (-831.332) -- 0:00:31
487500 -- (-830.539) (-831.332) [-830.925] (-834.031) * (-834.603) [-830.931] (-836.868) (-831.535) -- 0:00:31
488000 -- (-832.413) [-830.906] (-830.314) (-833.022) * (-836.344) (-830.932) [-830.941] (-830.999) -- 0:00:31
488500 -- (-831.285) (-832.888) [-831.549] (-831.351) * (-832.426) [-831.832] (-831.281) (-833.201) -- 0:00:31
489000 -- [-832.307] (-831.389) (-831.530) (-835.857) * (-832.950) (-833.685) (-830.809) [-831.878] -- 0:00:31
489500 -- (-831.636) (-830.623) (-836.557) [-830.553] * (-832.566) [-830.831] (-831.233) (-830.889) -- 0:00:31
490000 -- (-834.148) [-830.688] (-831.315) (-830.112) * (-831.019) (-831.066) (-831.630) [-831.439] -- 0:00:31
Average standard deviation of split frequencies: 0.008929
490500 -- (-833.126) (-831.303) (-830.508) [-831.420] * [-834.034] (-831.580) (-832.164) (-834.906) -- 0:00:31
491000 -- (-833.446) (-835.186) (-831.961) [-830.706] * (-831.471) [-831.996] (-830.982) (-831.329) -- 0:00:31
491500 -- [-832.896] (-834.591) (-831.040) (-834.559) * (-831.942) (-832.749) [-833.137] (-831.854) -- 0:00:31
492000 -- [-830.812] (-831.909) (-831.086) (-831.844) * (-832.081) (-830.768) [-831.272] (-831.008) -- 0:00:30
492500 -- (-833.561) (-831.665) [-830.943] (-834.575) * (-832.618) (-833.370) (-838.977) [-831.660] -- 0:00:30
493000 -- (-831.087) (-831.036) [-829.996] (-835.476) * (-834.536) (-839.956) [-831.749] (-833.036) -- 0:00:30
493500 -- (-836.167) [-831.395] (-831.619) (-830.509) * (-832.124) (-831.530) (-839.648) [-833.828] -- 0:00:30
494000 -- (-831.817) [-831.506] (-832.595) (-830.776) * (-832.520) [-833.630] (-830.968) (-834.135) -- 0:00:30
494500 -- (-831.477) (-831.060) (-834.989) [-831.660] * [-831.121] (-829.865) (-836.735) (-832.296) -- 0:00:30
495000 -- (-830.988) (-833.923) [-831.100] (-832.684) * [-833.980] (-833.522) (-836.005) (-834.592) -- 0:00:30
Average standard deviation of split frequencies: 0.009392
495500 -- (-830.809) [-831.201] (-831.967) (-842.888) * (-833.137) [-832.146] (-833.832) (-833.154) -- 0:00:30
496000 -- (-832.899) (-834.891) (-832.418) [-830.255] * [-832.608] (-832.014) (-835.628) (-831.986) -- 0:00:30
496500 -- [-831.024] (-830.094) (-834.121) (-835.989) * [-834.309] (-832.282) (-836.151) (-832.741) -- 0:00:30
497000 -- (-832.554) (-832.409) (-830.694) [-831.401] * (-831.175) (-831.413) [-830.965] (-831.866) -- 0:00:30
497500 -- (-840.033) (-833.351) [-831.742] (-831.426) * (-832.029) [-832.294] (-830.720) (-832.278) -- 0:00:30
498000 -- [-832.123] (-832.471) (-836.260) (-834.841) * (-830.904) (-830.130) (-831.267) [-830.052] -- 0:00:30
498500 -- (-833.332) (-830.526) [-837.160] (-832.335) * (-830.071) (-830.192) [-833.207] (-832.229) -- 0:00:30
499000 -- (-834.229) (-831.016) (-833.569) [-831.368] * (-830.463) (-831.439) (-834.801) [-835.089] -- 0:00:30
499500 -- (-833.376) (-831.429) [-831.951] (-833.063) * (-830.605) (-834.316) [-833.191] (-832.436) -- 0:00:30
500000 -- [-833.015] (-831.835) (-833.244) (-832.639) * [-831.365] (-834.716) (-831.802) (-831.670) -- 0:00:30
Average standard deviation of split frequencies: 0.009651
500500 -- (-834.113) [-830.509] (-834.627) (-833.530) * [-830.682] (-831.184) (-833.224) (-833.229) -- 0:00:29
501000 -- (-836.273) [-831.070] (-834.729) (-833.053) * (-830.453) (-830.880) [-830.286] (-831.064) -- 0:00:29
501500 -- [-832.140] (-833.163) (-831.836) (-832.316) * [-830.277] (-835.681) (-833.407) (-831.866) -- 0:00:29
502000 -- (-831.417) (-832.590) (-833.278) [-831.331] * [-831.264] (-835.221) (-833.488) (-831.866) -- 0:00:29
502500 -- (-833.580) (-831.133) [-833.054] (-831.026) * (-835.775) [-832.248] (-830.063) (-830.973) -- 0:00:29
503000 -- (-830.626) [-830.932] (-832.758) (-833.206) * (-831.490) (-832.690) (-832.483) [-831.715] -- 0:00:30
503500 -- (-831.084) [-834.364] (-834.217) (-831.064) * (-832.404) (-831.516) [-831.621] (-834.275) -- 0:00:30
504000 -- (-833.476) [-831.632] (-831.679) (-831.183) * [-831.133] (-831.543) (-831.590) (-831.686) -- 0:00:30
504500 -- (-833.182) [-832.102] (-833.643) (-832.541) * [-836.306] (-831.766) (-831.808) (-836.160) -- 0:00:30
505000 -- (-833.170) [-832.266] (-832.929) (-834.094) * (-832.414) (-830.129) (-833.461) [-830.880] -- 0:00:30
Average standard deviation of split frequencies: 0.009782
505500 -- (-833.502) [-830.856] (-831.625) (-832.382) * (-832.725) [-830.509] (-831.470) (-832.043) -- 0:00:30
506000 -- (-831.576) [-830.818] (-835.793) (-831.341) * (-835.237) (-832.730) [-831.075] (-832.448) -- 0:00:30
506500 -- (-830.342) (-830.368) [-831.503] (-833.546) * (-830.883) (-837.291) [-835.097] (-832.013) -- 0:00:30
507000 -- (-831.933) (-833.034) (-834.200) [-830.196] * (-832.524) (-835.930) [-838.064] (-833.330) -- 0:00:30
507500 -- (-831.012) (-833.281) [-833.066] (-832.235) * (-831.504) (-832.136) [-830.958] (-830.710) -- 0:00:30
508000 -- [-830.764] (-830.708) (-834.965) (-833.322) * [-830.461] (-832.517) (-832.354) (-830.536) -- 0:00:30
508500 -- [-829.801] (-832.200) (-831.177) (-832.127) * (-834.060) (-834.252) (-831.097) [-830.707] -- 0:00:29
509000 -- (-830.867) (-831.311) [-831.706] (-830.110) * (-831.483) [-830.330] (-830.333) (-829.897) -- 0:00:29
509500 -- (-830.629) [-832.717] (-836.473) (-831.980) * [-830.935] (-831.315) (-830.300) (-831.352) -- 0:00:29
510000 -- (-830.814) (-831.480) (-835.151) [-834.181] * (-830.859) (-833.513) (-830.186) [-831.470] -- 0:00:29
Average standard deviation of split frequencies: 0.009923
510500 -- (-832.296) (-832.813) [-834.598] (-832.002) * [-832.564] (-833.058) (-831.692) (-830.944) -- 0:00:29
511000 -- [-832.468] (-831.379) (-833.883) (-831.572) * (-831.705) [-830.084] (-830.992) (-830.633) -- 0:00:29
511500 -- (-831.693) (-833.228) [-831.898] (-832.988) * (-830.266) (-832.963) (-831.582) [-832.351] -- 0:00:29
512000 -- (-834.626) [-833.736] (-831.469) (-833.854) * (-830.266) (-831.067) [-830.857] (-835.764) -- 0:00:29
512500 -- [-833.526] (-832.077) (-833.722) (-831.322) * (-831.448) [-832.085] (-831.445) (-830.969) -- 0:00:29
513000 -- (-832.017) [-830.298] (-833.621) (-833.409) * (-830.189) (-831.918) (-832.614) [-830.704] -- 0:00:29
513500 -- (-832.191) [-832.272] (-830.519) (-832.976) * [-830.795] (-831.636) (-831.104) (-830.743) -- 0:00:29
514000 -- [-830.058] (-829.909) (-830.891) (-833.319) * (-832.425) (-834.240) (-830.974) [-830.839] -- 0:00:29
514500 -- (-830.714) (-833.890) [-830.209] (-831.974) * (-837.401) (-833.421) [-831.148] (-834.863) -- 0:00:29
515000 -- (-837.432) (-833.264) [-830.903] (-832.608) * [-832.197] (-832.256) (-831.615) (-834.565) -- 0:00:29
Average standard deviation of split frequencies: 0.010620
515500 -- (-832.618) (-834.332) [-831.331] (-830.527) * [-829.776] (-833.627) (-830.945) (-833.172) -- 0:00:29
516000 -- (-830.557) (-830.384) (-832.642) [-831.883] * (-830.679) (-835.769) [-831.108] (-831.863) -- 0:00:29
516500 -- (-829.974) [-830.384] (-834.098) (-832.797) * (-831.923) (-831.975) [-832.658] (-832.471) -- 0:00:29
517000 -- (-830.957) (-830.709) (-832.810) [-832.187] * [-831.129] (-832.528) (-839.199) (-834.288) -- 0:00:28
517500 -- (-831.743) (-832.812) (-832.586) [-831.845] * (-831.540) (-832.284) [-831.228] (-831.466) -- 0:00:28
518000 -- (-831.564) (-836.418) (-830.875) [-831.477] * (-830.872) (-830.326) [-832.463] (-832.556) -- 0:00:28
518500 -- (-832.838) (-831.455) (-837.605) [-831.353] * (-832.988) (-830.414) (-830.375) [-832.924] -- 0:00:28
519000 -- (-835.806) (-830.126) [-835.473] (-830.880) * (-832.059) [-834.046] (-831.090) (-833.763) -- 0:00:28
519500 -- (-837.843) (-833.680) [-830.810] (-830.011) * (-831.496) (-831.262) [-831.399] (-834.473) -- 0:00:29
520000 -- (-833.874) (-833.090) (-831.212) [-829.810] * (-830.809) (-831.098) [-831.900] (-840.401) -- 0:00:29
Average standard deviation of split frequencies: 0.010865
520500 -- (-831.644) (-831.274) (-833.081) [-831.667] * (-831.686) (-830.689) (-831.506) [-834.870] -- 0:00:29
521000 -- (-830.257) (-830.786) [-834.914] (-831.597) * [-829.733] (-829.927) (-830.255) (-833.561) -- 0:00:29
521500 -- (-830.690) (-832.590) (-830.780) [-830.491] * (-833.838) (-830.975) [-831.558] (-834.109) -- 0:00:29
522000 -- (-829.734) [-831.644] (-831.790) (-835.007) * (-834.949) (-833.963) [-830.070] (-830.304) -- 0:00:29
522500 -- (-833.731) (-830.521) [-834.099] (-833.556) * (-832.690) [-831.530] (-832.507) (-832.485) -- 0:00:29
523000 -- (-829.765) (-832.018) [-831.362] (-831.370) * (-832.360) (-832.443) (-830.442) [-831.412] -- 0:00:29
523500 -- [-833.372] (-835.855) (-831.072) (-833.661) * (-838.855) (-834.545) [-830.553] (-830.058) -- 0:00:29
524000 -- (-832.577) (-832.280) [-832.922] (-831.603) * (-831.171) (-836.037) [-831.116] (-831.927) -- 0:00:29
524500 -- (-831.772) (-831.168) [-830.301] (-832.251) * (-830.853) (-836.189) [-831.675] (-830.455) -- 0:00:29
525000 -- (-831.782) [-833.296] (-832.654) (-832.431) * (-832.869) (-830.881) [-831.605] (-834.352) -- 0:00:28
Average standard deviation of split frequencies: 0.010754
525500 -- (-832.006) (-836.856) (-838.981) [-831.483] * (-831.353) (-833.924) [-834.718] (-834.117) -- 0:00:28
526000 -- [-831.314] (-834.908) (-838.689) (-835.648) * (-832.383) (-832.409) [-829.858] (-831.261) -- 0:00:28
526500 -- [-833.225] (-832.437) (-832.465) (-835.180) * (-831.098) (-831.071) [-831.948] (-830.268) -- 0:00:28
527000 -- (-831.879) [-835.312] (-832.979) (-831.582) * (-834.153) (-830.663) [-830.938] (-833.132) -- 0:00:28
527500 -- [-832.865] (-831.505) (-833.570) (-833.574) * (-833.196) [-831.923] (-831.048) (-834.441) -- 0:00:28
528000 -- (-834.542) [-831.469] (-831.739) (-832.647) * (-831.422) [-831.301] (-833.483) (-832.653) -- 0:00:28
528500 -- (-834.254) (-831.130) [-831.592] (-831.745) * (-833.329) (-837.984) [-830.601] (-837.515) -- 0:00:28
529000 -- (-832.730) [-832.699] (-830.434) (-832.501) * (-830.864) [-832.830] (-834.532) (-832.440) -- 0:00:28
529500 -- (-834.193) (-831.462) [-830.747] (-836.263) * (-832.650) (-831.518) (-834.275) [-834.643] -- 0:00:28
530000 -- [-833.037] (-832.063) (-831.243) (-834.219) * (-837.568) (-831.939) [-833.591] (-831.544) -- 0:00:28
Average standard deviation of split frequencies: 0.010771
530500 -- (-832.562) (-831.738) (-834.101) [-831.288] * [-835.664] (-831.811) (-835.349) (-830.987) -- 0:00:28
531000 -- [-832.281] (-831.966) (-831.514) (-830.503) * [-831.818] (-830.170) (-835.784) (-831.736) -- 0:00:28
531500 -- [-832.487] (-834.045) (-832.407) (-830.561) * [-831.796] (-830.783) (-839.417) (-832.339) -- 0:00:28
532000 -- (-832.390) (-832.913) [-831.311] (-830.482) * (-829.917) (-831.612) [-832.462] (-831.888) -- 0:00:28
532500 -- (-835.344) [-831.513] (-830.774) (-830.350) * (-831.281) (-833.069) [-832.735] (-834.849) -- 0:00:28
533000 -- (-832.173) (-830.785) [-831.301] (-834.519) * (-831.487) (-830.615) (-830.946) [-830.247] -- 0:00:28
533500 -- [-830.152] (-832.171) (-831.627) (-832.988) * (-833.620) [-831.195] (-832.660) (-830.722) -- 0:00:27
534000 -- (-830.829) (-832.958) [-834.612] (-830.924) * (-832.130) (-830.950) (-831.876) [-831.587] -- 0:00:27
534500 -- (-831.159) (-834.788) [-829.936] (-831.852) * (-830.503) (-831.994) [-831.655] (-830.873) -- 0:00:27
535000 -- (-830.408) (-838.358) [-830.690] (-831.525) * (-834.983) (-834.032) (-832.841) [-830.426] -- 0:00:27
Average standard deviation of split frequencies: 0.010609
535500 -- (-831.942) [-833.962] (-830.331) (-838.252) * (-832.279) [-832.557] (-834.129) (-833.919) -- 0:00:27
536000 -- (-833.577) (-833.145) (-830.253) [-831.359] * (-831.977) (-830.150) [-835.194] (-830.776) -- 0:00:28
536500 -- (-830.987) [-832.588] (-832.329) (-834.211) * (-834.020) [-831.285] (-834.901) (-832.056) -- 0:00:28
537000 -- (-829.847) (-833.011) (-832.875) [-834.320] * (-835.239) (-833.600) (-832.195) [-835.301] -- 0:00:28
537500 -- (-830.105) (-830.564) [-831.120] (-831.142) * (-832.211) (-831.930) (-830.194) [-832.359] -- 0:00:28
538000 -- (-829.991) (-830.449) [-832.115] (-833.148) * (-833.701) (-830.686) (-831.347) [-834.436] -- 0:00:28
538500 -- (-830.849) [-831.661] (-831.822) (-832.336) * [-830.386] (-831.170) (-836.659) (-833.342) -- 0:00:28
539000 -- (-832.836) [-831.118] (-835.679) (-832.431) * (-830.329) [-831.449] (-831.505) (-834.724) -- 0:00:28
539500 -- (-832.305) [-831.900] (-834.395) (-831.100) * (-830.450) [-830.786] (-830.539) (-831.527) -- 0:00:28
540000 -- (-831.016) [-830.974] (-832.837) (-832.602) * (-832.518) (-830.795) [-831.735] (-830.668) -- 0:00:28
Average standard deviation of split frequencies: 0.010790
540500 -- (-832.208) (-833.675) [-832.623] (-835.876) * (-834.413) [-831.849] (-831.106) (-829.995) -- 0:00:28
541000 -- (-831.425) (-835.309) [-831.054] (-831.226) * (-832.731) (-831.262) [-831.179] (-835.547) -- 0:00:27
541500 -- (-830.867) (-835.009) (-833.337) [-830.949] * [-835.747] (-831.478) (-836.372) (-830.396) -- 0:00:27
542000 -- (-833.827) (-832.940) [-832.449] (-831.102) * (-835.730) [-833.464] (-831.159) (-830.396) -- 0:00:27
542500 -- (-831.217) (-831.545) [-834.309] (-831.379) * (-835.959) [-831.225] (-834.392) (-834.673) -- 0:00:27
543000 -- (-833.677) (-830.569) (-836.491) [-832.137] * (-829.806) (-831.058) (-830.119) [-831.198] -- 0:00:27
543500 -- (-834.404) [-830.534] (-833.157) (-833.614) * (-829.816) [-831.668] (-831.441) (-830.593) -- 0:00:27
544000 -- (-834.118) (-832.999) [-831.139] (-835.033) * [-831.833] (-834.425) (-836.691) (-830.611) -- 0:00:27
544500 -- [-830.389] (-831.166) (-834.974) (-831.025) * (-833.841) (-830.555) (-831.726) [-832.039] -- 0:00:27
545000 -- [-831.458] (-830.587) (-830.333) (-831.726) * (-835.137) [-830.480] (-834.370) (-831.465) -- 0:00:27
Average standard deviation of split frequencies: 0.011224
545500 -- (-833.827) (-834.215) (-830.919) [-833.635] * (-837.169) [-832.043] (-833.853) (-835.009) -- 0:00:27
546000 -- (-830.457) (-832.444) [-831.588] (-832.691) * (-835.835) [-832.018] (-831.184) (-833.375) -- 0:00:27
546500 -- (-831.887) (-833.214) [-830.738] (-834.951) * (-831.364) [-833.199] (-831.960) (-835.276) -- 0:00:27
547000 -- [-831.099] (-830.730) (-830.763) (-832.676) * (-832.319) (-833.777) [-830.521] (-830.860) -- 0:00:27
547500 -- (-834.054) [-830.303] (-834.409) (-834.325) * (-833.210) (-829.880) (-837.210) [-830.381] -- 0:00:27
548000 -- (-835.366) (-832.705) (-834.048) [-831.952] * (-831.339) (-831.794) [-834.563] (-830.381) -- 0:00:27
548500 -- (-833.976) (-831.649) [-833.600] (-830.919) * (-829.893) (-830.556) (-832.319) [-831.883] -- 0:00:27
549000 -- (-832.075) (-832.202) [-832.336] (-831.495) * (-830.618) (-830.385) (-836.733) [-833.858] -- 0:00:27
549500 -- (-831.920) (-831.222) [-831.165] (-831.471) * [-836.302] (-830.615) (-830.071) (-833.218) -- 0:00:27
550000 -- (-831.406) (-834.124) (-832.508) [-830.821] * (-831.571) (-834.507) [-831.950] (-834.364) -- 0:00:27
Average standard deviation of split frequencies: 0.011532
550500 -- (-833.615) (-835.035) [-831.463] (-832.537) * (-831.424) [-833.297] (-830.950) (-833.551) -- 0:00:26
551000 -- (-830.480) (-831.128) (-833.292) [-834.694] * [-831.560] (-829.929) (-829.946) (-831.714) -- 0:00:26
551500 -- (-831.078) (-831.939) [-835.197] (-831.325) * [-830.970] (-830.270) (-834.727) (-832.186) -- 0:00:26
552000 -- (-829.928) [-835.551] (-832.556) (-831.977) * (-829.984) [-830.570] (-831.842) (-831.638) -- 0:00:26
552500 -- [-830.246] (-836.227) (-832.643) (-833.687) * (-832.435) [-830.634] (-832.701) (-832.342) -- 0:00:27
553000 -- (-831.376) [-833.002] (-833.289) (-837.985) * (-831.545) (-830.130) (-831.905) [-831.124] -- 0:00:27
553500 -- (-830.177) [-830.524] (-834.891) (-830.425) * (-830.491) (-832.885) (-831.217) [-830.379] -- 0:00:27
554000 -- (-830.743) [-831.731] (-832.254) (-831.378) * [-830.674] (-831.765) (-830.605) (-831.211) -- 0:00:27
554500 -- (-831.323) (-830.645) (-834.448) [-835.442] * (-832.983) [-830.494] (-834.716) (-835.139) -- 0:00:27
555000 -- (-832.947) (-831.818) (-833.999) [-831.859] * (-838.863) [-830.718] (-835.870) (-834.204) -- 0:00:27
Average standard deviation of split frequencies: 0.011271
555500 -- (-830.426) [-831.834] (-832.441) (-831.035) * (-833.831) [-830.328] (-830.758) (-833.204) -- 0:00:27
556000 -- (-836.302) [-830.303] (-833.651) (-830.923) * (-836.921) [-834.039] (-830.764) (-830.453) -- 0:00:27
556500 -- (-832.264) (-830.070) (-835.708) [-831.361] * [-830.848] (-832.131) (-832.468) (-831.051) -- 0:00:27
557000 -- (-832.789) (-830.070) [-831.469] (-832.571) * (-832.010) (-833.719) (-830.657) [-832.275] -- 0:00:27
557500 -- [-833.012] (-831.473) (-830.979) (-833.406) * (-832.410) (-831.245) [-831.076] (-834.738) -- 0:00:26
558000 -- (-832.263) (-832.083) [-830.561] (-831.617) * (-832.171) (-831.755) (-830.519) [-831.240] -- 0:00:26
558500 -- (-836.032) (-833.865) (-830.219) [-830.946] * (-837.179) [-831.545] (-831.155) (-830.772) -- 0:00:26
559000 -- (-841.179) (-832.457) (-832.143) [-831.409] * [-833.013] (-829.702) (-830.448) (-830.910) -- 0:00:26
559500 -- (-832.252) (-833.686) [-831.633] (-831.666) * (-834.320) [-830.507] (-831.334) (-831.744) -- 0:00:26
560000 -- [-831.070] (-835.968) (-831.318) (-832.322) * (-836.144) [-831.302] (-830.763) (-837.150) -- 0:00:26
Average standard deviation of split frequencies: 0.011474
560500 -- (-832.413) [-834.702] (-833.988) (-833.394) * (-833.745) (-831.467) (-831.098) [-831.140] -- 0:00:26
561000 -- (-831.300) (-834.301) [-831.721] (-833.894) * (-831.161) (-832.460) [-832.708] (-831.685) -- 0:00:26
561500 -- (-832.238) [-833.034] (-835.767) (-832.656) * (-834.736) (-832.296) (-833.968) [-831.837] -- 0:00:26
562000 -- (-831.087) (-833.247) [-832.982] (-830.824) * (-830.334) (-831.963) (-830.716) [-833.754] -- 0:00:26
562500 -- (-833.147) [-830.556] (-832.092) (-833.770) * (-832.022) (-832.275) (-830.747) [-831.096] -- 0:00:26
563000 -- (-833.316) (-831.530) [-833.898] (-831.378) * (-832.986) (-831.833) [-830.367] (-834.289) -- 0:00:26
563500 -- (-832.485) [-831.983] (-831.142) (-832.359) * [-832.102] (-831.712) (-831.273) (-832.454) -- 0:00:26
564000 -- (-831.050) (-833.527) [-835.824] (-829.946) * (-831.092) (-832.654) (-832.931) [-831.579] -- 0:00:26
564500 -- (-829.940) (-835.854) [-834.959] (-832.509) * (-834.212) (-834.908) [-832.650] (-832.344) -- 0:00:26
565000 -- (-830.849) [-830.446] (-834.125) (-832.661) * (-830.258) (-833.117) (-830.566) [-830.610] -- 0:00:26
Average standard deviation of split frequencies: 0.011611
565500 -- (-831.375) (-839.226) [-829.791] (-830.159) * (-830.443) (-832.267) [-830.319] (-831.997) -- 0:00:26
566000 -- (-833.679) (-832.073) (-830.893) [-832.667] * (-835.194) (-833.065) (-832.739) [-832.617] -- 0:00:26
566500 -- [-832.099] (-830.797) (-830.690) (-838.650) * (-830.981) (-830.905) (-838.561) [-831.703] -- 0:00:26
567000 -- (-831.109) (-832.890) [-831.033] (-829.902) * [-833.839] (-832.968) (-830.951) (-832.287) -- 0:00:25
567500 -- [-834.099] (-831.162) (-831.094) (-833.051) * (-831.476) [-831.232] (-831.688) (-830.360) -- 0:00:25
568000 -- [-832.689] (-830.785) (-831.045) (-831.099) * (-831.090) [-831.181] (-831.863) (-830.931) -- 0:00:25
568500 -- (-834.669) (-830.467) [-831.651] (-833.008) * (-833.937) (-830.672) [-833.448] (-831.667) -- 0:00:25
569000 -- (-831.574) (-833.781) (-832.166) [-836.159] * [-831.839] (-830.793) (-834.287) (-831.084) -- 0:00:25
569500 -- (-831.262) (-833.828) [-834.325] (-831.307) * (-835.698) [-830.464] (-830.705) (-832.767) -- 0:00:26
570000 -- (-831.145) (-837.080) (-832.345) [-833.094] * (-832.197) (-833.327) [-833.352] (-833.333) -- 0:00:26
Average standard deviation of split frequencies: 0.011273
570500 -- [-831.084] (-831.620) (-830.404) (-833.552) * (-835.136) (-832.947) [-830.258] (-832.275) -- 0:00:26
571000 -- (-830.902) (-831.087) [-832.388] (-834.305) * (-832.603) [-831.529] (-830.892) (-832.455) -- 0:00:26
571500 -- (-837.120) (-831.297) [-831.065] (-831.490) * [-831.280] (-830.220) (-831.282) (-831.887) -- 0:00:26
572000 -- (-836.277) (-830.750) (-832.088) [-832.126] * (-833.407) [-830.068] (-833.307) (-832.734) -- 0:00:26
572500 -- (-833.036) [-835.077] (-834.951) (-830.090) * (-832.044) (-829.971) [-832.444] (-830.346) -- 0:00:26
573000 -- (-832.663) [-833.092] (-833.887) (-830.905) * (-830.612) [-832.906] (-834.658) (-830.563) -- 0:00:26
573500 -- (-831.289) (-832.481) (-832.767) [-831.490] * (-831.718) (-831.391) (-835.286) [-831.192] -- 0:00:26
574000 -- [-839.212] (-833.036) (-833.857) (-831.259) * (-833.529) (-830.721) [-830.495] (-832.974) -- 0:00:25
574500 -- [-834.368] (-834.755) (-831.324) (-831.824) * (-831.963) (-832.716) [-832.904] (-831.230) -- 0:00:25
575000 -- (-833.254) (-830.233) (-831.966) [-831.580] * [-834.049] (-832.435) (-832.342) (-831.143) -- 0:00:25
Average standard deviation of split frequencies: 0.010230
575500 -- (-834.804) (-830.744) [-832.526] (-831.914) * (-831.393) (-831.058) [-830.764] (-833.055) -- 0:00:25
576000 -- (-831.721) (-835.862) (-831.124) [-831.234] * [-830.813] (-833.708) (-840.276) (-833.292) -- 0:00:25
576500 -- [-831.887] (-834.585) (-831.159) (-832.190) * [-830.456] (-833.584) (-831.572) (-835.839) -- 0:00:25
577000 -- (-832.705) (-835.141) (-832.169) [-834.434] * [-831.168] (-833.047) (-834.280) (-835.981) -- 0:00:25
577500 -- (-832.961) (-839.583) [-830.267] (-834.711) * [-833.730] (-834.452) (-832.762) (-831.719) -- 0:00:25
578000 -- (-832.164) (-831.334) (-830.844) [-831.004] * (-835.119) (-833.345) (-832.411) [-836.015] -- 0:00:25
578500 -- (-833.513) [-832.662] (-833.207) (-831.874) * (-830.424) (-832.657) [-835.449] (-832.563) -- 0:00:25
579000 -- [-831.438] (-831.200) (-831.227) (-830.614) * (-831.235) [-831.592] (-832.478) (-832.875) -- 0:00:25
579500 -- (-832.760) [-832.469] (-829.832) (-831.223) * (-830.751) (-835.871) [-833.312] (-835.035) -- 0:00:25
580000 -- [-831.839] (-836.057) (-834.216) (-830.831) * (-833.375) [-831.764] (-830.839) (-832.362) -- 0:00:25
Average standard deviation of split frequencies: 0.009894
580500 -- (-830.926) (-835.650) (-831.184) [-835.432] * (-833.266) [-831.593] (-831.008) (-832.621) -- 0:00:25
581000 -- [-834.678] (-831.115) (-832.280) (-837.338) * (-829.734) [-830.463] (-830.816) (-834.216) -- 0:00:25
581500 -- (-837.334) (-830.635) [-830.056] (-838.749) * (-832.334) (-834.682) (-833.847) [-833.763] -- 0:00:25
582000 -- (-834.016) (-834.259) [-831.974] (-831.373) * (-831.844) [-833.422] (-831.469) (-833.439) -- 0:00:25
582500 -- (-834.470) (-831.234) (-830.617) [-831.089] * [-834.070] (-833.148) (-834.916) (-833.037) -- 0:00:25
583000 -- (-834.314) (-831.549) [-830.904] (-833.326) * (-833.194) (-830.445) [-831.464] (-832.073) -- 0:00:25
583500 -- (-835.800) (-832.372) (-831.056) [-831.500] * (-832.819) [-830.652] (-832.676) (-831.318) -- 0:00:24
584000 -- (-831.702) (-833.303) [-832.442] (-833.371) * [-831.414] (-831.584) (-832.060) (-832.735) -- 0:00:24
584500 -- [-830.534] (-832.373) (-833.660) (-831.525) * (-831.220) (-832.235) (-831.172) [-831.941] -- 0:00:24
585000 -- (-832.706) (-836.730) [-833.553] (-835.344) * (-836.096) [-831.520] (-832.611) (-832.538) -- 0:00:24
Average standard deviation of split frequencies: 0.009804
585500 -- (-836.049) (-837.529) (-831.546) [-832.060] * (-834.867) [-830.228] (-833.456) (-832.949) -- 0:00:25
586000 -- (-832.027) (-832.184) [-832.099] (-832.555) * [-833.609] (-830.445) (-832.809) (-830.788) -- 0:00:25
586500 -- (-830.620) [-831.962] (-830.675) (-831.210) * [-832.824] (-830.612) (-831.673) (-834.940) -- 0:00:25
587000 -- (-832.483) (-832.006) [-833.378] (-830.759) * [-831.599] (-833.026) (-832.200) (-836.331) -- 0:00:25
587500 -- (-830.028) [-829.954] (-830.490) (-831.681) * (-831.625) (-829.920) (-832.703) [-831.821] -- 0:00:25
588000 -- (-831.728) (-833.508) (-832.435) [-831.252] * (-832.354) (-830.649) [-831.620] (-833.303) -- 0:00:25
588500 -- (-831.381) (-833.621) (-830.278) [-830.386] * (-832.376) (-832.117) (-830.586) [-830.678] -- 0:00:25
589000 -- (-831.422) (-832.589) [-830.847] (-834.361) * (-831.322) [-831.895] (-831.165) (-833.656) -- 0:00:25
589500 -- (-833.232) (-832.363) [-834.486] (-834.170) * [-832.020] (-830.451) (-832.009) (-831.144) -- 0:00:25
590000 -- (-835.038) (-831.483) (-831.718) [-833.802] * (-831.603) [-831.860] (-834.322) (-834.797) -- 0:00:25
Average standard deviation of split frequencies: 0.009527
590500 -- [-830.306] (-832.132) (-834.882) (-834.907) * (-832.485) (-830.208) [-832.301] (-830.830) -- 0:00:24
591000 -- (-829.917) (-836.993) (-835.122) [-831.107] * [-832.849] (-830.401) (-831.282) (-832.191) -- 0:00:24
591500 -- [-831.508] (-834.740) (-836.852) (-831.895) * (-832.068) [-831.385] (-830.678) (-830.276) -- 0:00:24
592000 -- (-833.818) (-832.589) [-836.439] (-834.164) * [-831.782] (-831.678) (-831.320) (-830.070) -- 0:00:24
592500 -- (-830.853) [-830.218] (-830.732) (-834.032) * (-833.429) (-834.031) (-831.162) [-830.774] -- 0:00:24
593000 -- (-832.120) [-831.025] (-830.819) (-834.398) * (-834.366) (-836.166) (-831.407) [-832.797] -- 0:00:24
593500 -- (-835.064) (-832.695) [-832.624] (-832.450) * (-837.408) [-832.725] (-831.211) (-832.025) -- 0:00:24
594000 -- (-830.172) [-831.919] (-832.467) (-831.625) * (-837.369) (-830.797) [-830.538] (-833.246) -- 0:00:24
594500 -- [-829.967] (-833.919) (-831.997) (-832.334) * (-832.852) (-831.726) [-834.107] (-830.703) -- 0:00:24
595000 -- (-832.198) (-834.904) (-834.035) [-832.261] * [-831.933] (-831.339) (-835.422) (-832.953) -- 0:00:24
Average standard deviation of split frequencies: 0.009986
595500 -- [-832.467] (-834.622) (-834.244) (-833.203) * (-832.555) [-833.465] (-831.416) (-830.607) -- 0:00:24
596000 -- [-831.576] (-830.160) (-831.353) (-833.913) * (-834.435) (-833.533) [-830.461] (-832.347) -- 0:00:24
596500 -- (-835.090) (-832.200) [-831.524] (-831.662) * [-837.055] (-833.011) (-830.525) (-832.917) -- 0:00:24
597000 -- (-834.457) (-833.790) (-836.193) [-831.241] * (-834.569) (-833.864) (-831.079) [-831.041] -- 0:00:24
597500 -- (-830.788) (-833.090) (-830.683) [-831.198] * [-830.778] (-834.201) (-833.003) (-832.016) -- 0:00:24
598000 -- (-832.679) (-836.163) [-831.487] (-830.109) * [-831.391] (-833.622) (-831.899) (-833.092) -- 0:00:24
598500 -- (-834.136) (-836.911) (-833.584) [-832.666] * (-834.035) [-832.331] (-830.672) (-831.280) -- 0:00:24
599000 -- (-831.306) [-829.926] (-833.211) (-834.238) * [-831.342] (-832.144) (-831.219) (-830.255) -- 0:00:24
599500 -- (-834.064) (-829.986) (-831.933) [-832.084] * (-831.077) (-832.489) (-832.468) [-830.503] -- 0:00:24
600000 -- (-831.734) [-830.262] (-830.201) (-831.775) * (-832.151) (-831.346) (-835.532) [-830.256] -- 0:00:24
Average standard deviation of split frequencies: 0.010055
600500 -- (-831.356) (-832.686) [-832.660] (-830.677) * (-831.552) [-832.594] (-831.247) (-832.808) -- 0:00:23
601000 -- (-829.902) (-836.699) [-832.348] (-830.688) * [-832.030] (-830.268) (-836.437) (-832.538) -- 0:00:23
601500 -- (-833.786) [-834.130] (-833.371) (-829.866) * [-831.265] (-831.609) (-837.959) (-836.485) -- 0:00:23
602000 -- (-832.990) (-833.366) [-832.138] (-831.106) * (-834.984) [-831.257] (-837.417) (-832.361) -- 0:00:24
602500 -- (-833.462) (-832.038) [-832.122] (-830.970) * (-831.496) (-831.921) [-832.720] (-833.195) -- 0:00:24
603000 -- (-833.490) [-830.606] (-833.292) (-831.990) * (-833.531) [-834.865] (-833.071) (-832.880) -- 0:00:24
603500 -- [-830.156] (-830.319) (-832.594) (-833.309) * (-834.879) [-833.805] (-831.205) (-832.622) -- 0:00:24
604000 -- (-831.062) (-831.615) [-835.385] (-836.859) * (-834.793) [-830.630] (-831.205) (-830.960) -- 0:00:24
604500 -- (-835.863) (-835.860) [-830.521] (-832.086) * [-831.326] (-833.140) (-831.260) (-831.048) -- 0:00:24
605000 -- (-832.587) (-834.049) (-831.583) [-833.015] * (-832.625) (-833.608) [-832.073] (-831.834) -- 0:00:24
Average standard deviation of split frequencies: 0.009578
605500 -- (-831.926) [-831.451] (-831.976) (-831.026) * (-832.969) (-831.049) [-832.675] (-830.175) -- 0:00:24
606000 -- (-833.938) (-830.529) [-831.506] (-832.283) * (-836.116) (-831.659) (-832.653) [-831.510] -- 0:00:24
606500 -- (-832.568) [-833.220] (-831.613) (-830.132) * (-834.014) [-832.241] (-831.277) (-834.102) -- 0:00:24
607000 -- (-830.063) (-835.023) [-830.353] (-832.321) * [-831.434] (-830.261) (-832.203) (-832.168) -- 0:00:23
607500 -- (-831.047) (-833.642) [-831.325] (-831.750) * (-831.098) [-832.054] (-833.914) (-836.404) -- 0:00:23
608000 -- (-831.926) (-831.765) (-832.497) [-832.023] * [-831.450] (-834.744) (-832.097) (-834.175) -- 0:00:23
608500 -- (-831.150) (-835.763) [-831.361] (-832.840) * (-836.879) (-833.544) [-831.315] (-831.687) -- 0:00:23
609000 -- (-831.467) [-834.694] (-831.055) (-832.211) * (-831.618) (-832.487) (-835.788) [-830.514] -- 0:00:23
609500 -- (-830.097) (-830.874) [-832.266] (-833.263) * (-835.753) (-834.632) [-832.424] (-835.259) -- 0:00:23
610000 -- (-833.248) (-831.575) (-832.767) [-835.199] * (-830.264) (-834.839) (-831.460) [-830.178] -- 0:00:23
Average standard deviation of split frequencies: 0.009212
610500 -- (-831.510) [-832.605] (-833.264) (-837.301) * (-832.026) (-832.818) [-832.532] (-836.186) -- 0:00:23
611000 -- (-832.667) [-831.334] (-831.086) (-832.097) * (-835.577) (-832.763) (-833.506) [-833.734] -- 0:00:23
611500 -- [-833.416] (-831.128) (-830.874) (-834.359) * (-834.578) (-832.864) [-833.693] (-835.423) -- 0:00:23
612000 -- (-831.646) (-830.503) [-830.719] (-833.047) * (-831.022) (-831.161) [-831.038] (-830.114) -- 0:00:23
612500 -- (-831.919) (-831.772) (-831.991) [-831.409] * (-834.645) (-834.285) (-838.725) [-831.225] -- 0:00:23
613000 -- (-831.209) (-832.265) [-831.079] (-835.453) * (-833.985) (-831.081) [-833.536] (-832.394) -- 0:00:23
613500 -- (-831.433) (-832.279) (-832.989) [-832.331] * [-830.764] (-830.379) (-836.807) (-832.063) -- 0:00:23
614000 -- [-831.263] (-831.270) (-839.692) (-830.946) * (-830.596) [-834.681] (-839.144) (-833.334) -- 0:00:23
614500 -- [-830.368] (-835.644) (-836.107) (-833.091) * (-830.569) (-833.105) (-836.454) [-832.603] -- 0:00:23
615000 -- (-830.345) [-835.164] (-834.519) (-830.308) * [-830.767] (-830.203) (-836.292) (-830.868) -- 0:00:23
Average standard deviation of split frequencies: 0.009132
615500 -- (-834.083) (-833.540) [-832.746] (-830.321) * (-832.749) (-831.133) (-831.785) [-830.311] -- 0:00:23
616000 -- (-833.206) [-832.445] (-830.445) (-832.189) * (-832.694) (-831.641) (-832.356) [-831.599] -- 0:00:23
616500 -- (-830.729) (-834.774) (-830.317) [-832.053] * (-833.870) (-832.047) (-833.170) [-831.238] -- 0:00:23
617000 -- (-838.061) [-831.255] (-831.697) (-831.770) * (-838.173) (-832.471) (-831.596) [-831.112] -- 0:00:22
617500 -- (-833.706) [-832.318] (-832.102) (-834.249) * (-833.638) (-831.720) (-831.649) [-830.423] -- 0:00:22
618000 -- [-831.448] (-830.643) (-830.771) (-831.455) * (-835.857) (-831.969) [-833.882] (-830.012) -- 0:00:22
618500 -- (-833.239) (-834.520) (-831.843) [-831.574] * (-833.465) (-832.707) (-831.818) [-831.495] -- 0:00:22
619000 -- [-831.875] (-830.237) (-831.410) (-831.714) * [-831.612] (-833.013) (-832.620) (-832.092) -- 0:00:23
619500 -- (-831.993) (-833.819) (-832.533) [-831.782] * (-831.668) [-837.472] (-831.337) (-830.576) -- 0:00:23
620000 -- [-832.087] (-831.097) (-833.882) (-831.805) * [-835.285] (-834.054) (-832.542) (-835.441) -- 0:00:23
Average standard deviation of split frequencies: 0.009418
620500 -- (-834.331) (-834.896) (-832.826) [-831.400] * [-832.058] (-833.142) (-832.688) (-834.197) -- 0:00:23
621000 -- (-834.106) (-830.772) [-831.997] (-830.512) * (-830.377) (-830.575) [-830.144] (-830.938) -- 0:00:23
621500 -- (-832.853) [-831.546] (-835.515) (-832.604) * (-831.054) (-832.311) (-832.840) [-831.766] -- 0:00:23
622000 -- [-832.832] (-830.855) (-835.905) (-834.026) * (-830.980) [-830.917] (-834.032) (-830.921) -- 0:00:23
622500 -- (-833.355) [-837.076] (-831.459) (-830.511) * (-830.648) (-833.970) (-836.150) [-830.090] -- 0:00:23
623000 -- [-830.990] (-835.272) (-831.426) (-832.005) * (-832.699) [-830.880] (-833.237) (-829.940) -- 0:00:22
623500 -- (-831.307) (-833.282) (-834.876) [-832.190] * [-831.802] (-832.104) (-831.650) (-834.261) -- 0:00:22
624000 -- (-832.728) (-831.414) [-834.793] (-833.095) * (-833.487) (-831.107) (-834.980) [-830.855] -- 0:00:22
624500 -- (-831.551) (-831.267) [-835.540] (-831.205) * (-831.307) (-833.397) (-832.311) [-832.753] -- 0:00:22
625000 -- (-833.078) (-831.582) [-832.964] (-835.516) * (-831.270) [-831.792] (-831.580) (-831.605) -- 0:00:22
Average standard deviation of split frequencies: 0.009388
625500 -- (-833.346) (-833.217) [-830.583] (-832.723) * (-834.840) [-830.387] (-834.224) (-830.285) -- 0:00:22
626000 -- (-831.396) (-831.753) [-832.712] (-836.508) * (-830.521) [-832.040] (-833.909) (-834.778) -- 0:00:22
626500 -- (-831.748) (-833.956) (-830.073) [-831.851] * (-832.764) (-832.226) [-831.965] (-832.692) -- 0:00:22
627000 -- (-832.832) [-831.257] (-830.206) (-831.850) * (-831.821) (-834.741) [-830.206] (-834.425) -- 0:00:22
627500 -- (-831.553) [-831.762] (-832.461) (-836.273) * (-833.928) (-832.706) (-832.950) [-830.858] -- 0:00:22
628000 -- [-831.051] (-832.330) (-831.745) (-831.708) * (-831.383) (-831.253) [-830.179] (-830.290) -- 0:00:22
628500 -- (-832.395) (-830.926) (-830.074) [-832.224] * (-832.558) [-830.886] (-830.129) (-830.093) -- 0:00:22
629000 -- (-831.079) [-831.057] (-832.546) (-831.343) * (-832.582) (-831.906) [-832.642] (-833.537) -- 0:00:22
629500 -- [-831.959] (-832.026) (-833.022) (-834.483) * [-832.183] (-834.076) (-833.441) (-834.316) -- 0:00:22
630000 -- [-832.360] (-830.729) (-833.624) (-831.667) * (-830.150) (-834.485) [-832.174] (-831.895) -- 0:00:22
Average standard deviation of split frequencies: 0.008770
630500 -- (-831.894) [-831.533] (-830.119) (-831.869) * (-833.944) [-830.851] (-831.461) (-830.929) -- 0:00:22
631000 -- [-834.158] (-835.873) (-833.303) (-833.997) * (-832.469) (-830.483) (-831.212) [-830.795] -- 0:00:22
631500 -- [-830.693] (-832.716) (-832.246) (-835.256) * (-831.125) (-831.989) [-831.523] (-830.499) -- 0:00:22
632000 -- (-833.022) (-831.923) (-834.607) [-831.079] * (-831.258) (-832.950) [-832.830] (-829.943) -- 0:00:22
632500 -- [-831.543] (-831.203) (-831.742) (-830.843) * (-832.737) [-830.974] (-833.020) (-830.399) -- 0:00:22
633000 -- [-832.170] (-830.241) (-830.008) (-830.849) * [-831.098] (-831.757) (-830.553) (-834.109) -- 0:00:22
633500 -- (-832.761) (-833.113) [-829.752] (-831.533) * (-829.702) (-832.058) (-831.001) [-832.079] -- 0:00:21
634000 -- (-835.677) (-831.632) [-832.069] (-831.422) * [-830.323] (-833.977) (-832.554) (-830.914) -- 0:00:21
634500 -- (-834.678) (-831.476) [-836.015] (-834.840) * (-831.537) (-833.594) (-832.369) [-830.709] -- 0:00:21
635000 -- [-833.515] (-831.149) (-839.449) (-832.169) * (-832.048) (-832.611) [-830.617] (-833.969) -- 0:00:22
Average standard deviation of split frequencies: 0.008549
635500 -- (-838.317) (-833.395) (-836.320) [-832.595] * (-830.432) (-830.194) [-831.258] (-833.185) -- 0:00:22
636000 -- (-836.148) (-831.399) [-833.491] (-834.269) * (-833.588) (-830.540) [-830.836] (-830.768) -- 0:00:22
636500 -- [-838.427] (-831.146) (-834.052) (-839.684) * (-836.796) (-830.764) (-831.873) [-831.529] -- 0:00:22
637000 -- (-831.158) [-831.016] (-838.031) (-831.880) * (-830.695) (-831.196) (-830.773) [-832.416] -- 0:00:22
637500 -- [-830.746] (-832.236) (-831.091) (-830.966) * [-831.674] (-830.152) (-831.408) (-831.088) -- 0:00:22
638000 -- (-830.383) [-830.092] (-830.786) (-833.630) * (-830.254) [-830.271] (-832.224) (-834.150) -- 0:00:22
638500 -- [-831.000] (-833.100) (-831.256) (-833.370) * [-832.336] (-831.700) (-830.672) (-833.874) -- 0:00:22
639000 -- (-831.834) (-834.945) (-835.828) [-832.058] * (-830.492) (-831.835) [-832.182] (-834.424) -- 0:00:22
639500 -- (-832.456) [-830.928] (-834.243) (-829.784) * (-833.474) (-835.105) [-833.380] (-834.767) -- 0:00:21
640000 -- (-831.777) (-832.599) [-833.394] (-831.264) * (-832.036) (-833.009) (-830.797) [-832.981] -- 0:00:21
Average standard deviation of split frequencies: 0.008535
640500 -- (-830.470) [-834.696] (-836.847) (-836.817) * (-831.139) (-832.755) (-832.174) [-835.338] -- 0:00:21
641000 -- (-832.015) [-832.523] (-831.696) (-831.052) * (-831.708) (-831.806) [-830.568] (-832.983) -- 0:00:21
641500 -- (-832.051) (-833.418) [-831.074] (-834.284) * (-832.347) (-830.922) (-831.982) [-830.089] -- 0:00:21
642000 -- [-832.892] (-833.133) (-830.696) (-833.232) * (-832.910) [-831.951] (-832.097) (-831.464) -- 0:00:21
642500 -- [-831.387] (-830.652) (-832.020) (-834.335) * (-834.214) (-832.241) [-832.505] (-832.590) -- 0:00:21
643000 -- [-830.735] (-830.284) (-832.583) (-832.759) * (-833.850) (-831.861) [-834.243] (-832.774) -- 0:00:21
643500 -- (-832.237) (-835.285) [-830.364] (-830.265) * (-830.812) [-832.281] (-833.573) (-833.444) -- 0:00:21
644000 -- (-833.240) (-836.096) [-830.884] (-831.588) * (-832.256) (-836.822) (-830.361) [-830.129] -- 0:00:21
644500 -- [-831.819] (-834.418) (-831.467) (-832.424) * [-832.933] (-836.478) (-830.047) (-832.430) -- 0:00:21
645000 -- [-830.497] (-835.966) (-833.173) (-832.149) * (-835.014) (-832.100) [-832.315] (-832.515) -- 0:00:21
Average standard deviation of split frequencies: 0.008659
645500 -- (-831.827) (-836.284) (-831.163) [-837.878] * (-830.262) [-830.125] (-832.451) (-831.375) -- 0:00:21
646000 -- (-832.017) (-837.086) [-830.943] (-831.082) * (-830.274) (-830.985) [-834.040] (-833.740) -- 0:00:21
646500 -- [-831.606] (-831.346) (-830.703) (-830.266) * (-830.754) [-830.552] (-833.312) (-831.891) -- 0:00:21
647000 -- (-830.623) [-830.000] (-832.031) (-831.064) * (-835.954) (-833.140) (-830.788) [-830.984] -- 0:00:21
647500 -- (-834.350) (-832.298) [-830.157] (-831.875) * (-836.778) [-831.508] (-832.618) (-830.552) -- 0:00:21
648000 -- (-833.446) (-832.253) [-832.237] (-832.684) * (-836.039) [-833.619] (-831.321) (-831.604) -- 0:00:21
648500 -- (-832.734) (-832.544) (-837.469) [-833.369] * (-836.093) [-834.785] (-833.181) (-831.990) -- 0:00:21
649000 -- (-834.595) (-832.658) (-833.773) [-833.747] * (-833.511) (-836.140) [-836.352] (-832.273) -- 0:00:21
649500 -- (-831.367) [-832.133] (-833.160) (-840.180) * (-831.266) (-832.529) [-831.203] (-832.850) -- 0:00:21
650000 -- (-830.904) (-831.619) (-835.327) [-833.046] * (-832.370) (-833.724) (-830.277) [-830.700] -- 0:00:21
Average standard deviation of split frequencies: 0.008404
650500 -- (-832.950) (-831.828) (-836.216) [-830.764] * (-830.620) [-831.478] (-831.564) (-832.115) -- 0:00:20
651000 -- [-831.780] (-831.072) (-830.887) (-833.187) * (-831.309) [-831.993] (-830.204) (-831.939) -- 0:00:20
651500 -- (-831.721) (-831.034) [-830.740] (-831.778) * (-832.614) (-833.834) (-831.689) [-831.976] -- 0:00:21
652000 -- [-831.271] (-832.555) (-832.138) (-832.177) * [-831.971] (-831.662) (-831.928) (-831.458) -- 0:00:21
652500 -- [-830.726] (-833.498) (-831.231) (-835.305) * (-833.146) (-837.424) [-830.345] (-830.504) -- 0:00:21
653000 -- (-832.189) (-830.345) [-830.255] (-836.622) * [-833.473] (-833.174) (-832.751) (-831.660) -- 0:00:21
653500 -- (-835.231) (-831.608) [-830.442] (-834.146) * (-831.894) (-832.620) [-834.838] (-830.914) -- 0:00:21
654000 -- (-831.133) (-831.349) (-829.994) [-833.169] * (-830.291) (-834.198) [-830.845] (-830.067) -- 0:00:21
654500 -- (-831.128) (-831.047) (-832.513) [-836.213] * [-831.350] (-834.646) (-831.671) (-831.412) -- 0:00:21
655000 -- (-831.112) (-834.483) [-831.786] (-832.420) * (-831.284) [-832.414] (-831.973) (-832.836) -- 0:00:21
Average standard deviation of split frequencies: 0.008671
655500 -- (-830.669) [-834.224] (-831.343) (-830.909) * (-833.443) [-830.851] (-831.828) (-831.189) -- 0:00:21
656000 -- (-830.306) (-835.943) [-834.494] (-832.924) * (-833.526) [-831.832] (-833.348) (-830.324) -- 0:00:20
656500 -- (-834.167) [-833.106] (-833.570) (-831.748) * (-837.061) [-831.940] (-835.924) (-830.278) -- 0:00:20
657000 -- (-831.577) (-831.762) [-833.754] (-832.549) * (-833.321) [-831.817] (-830.949) (-832.060) -- 0:00:20
657500 -- [-832.530] (-832.378) (-836.500) (-832.970) * (-833.391) (-830.407) [-829.937] (-830.419) -- 0:00:20
658000 -- (-832.335) (-830.421) (-834.925) [-832.249] * (-832.695) (-831.405) (-831.003) [-829.904] -- 0:00:20
658500 -- [-830.904] (-833.644) (-831.516) (-832.853) * [-831.977] (-831.977) (-835.768) (-835.277) -- 0:00:20
659000 -- [-831.549] (-833.143) (-831.650) (-832.351) * (-830.552) (-833.850) [-837.111] (-830.811) -- 0:00:20
659500 -- [-832.192] (-831.213) (-832.565) (-833.991) * (-831.404) [-829.792] (-833.758) (-832.140) -- 0:00:20
660000 -- [-834.221] (-833.253) (-830.027) (-831.766) * [-830.931] (-830.212) (-831.858) (-831.251) -- 0:00:20
Average standard deviation of split frequencies: 0.008420
660500 -- (-833.378) (-831.506) [-830.084] (-830.782) * [-831.667] (-831.025) (-836.192) (-833.318) -- 0:00:20
661000 -- (-833.988) [-830.961] (-834.786) (-831.355) * (-831.777) (-830.773) [-832.982] (-844.109) -- 0:00:20
661500 -- (-832.787) (-832.407) [-834.323] (-836.237) * (-834.376) [-831.267] (-833.011) (-831.578) -- 0:00:20
662000 -- (-829.945) (-830.897) [-834.690] (-838.464) * (-831.668) (-834.591) [-831.052] (-832.018) -- 0:00:20
662500 -- (-832.316) (-832.787) (-832.995) [-836.321] * (-831.551) (-832.453) [-831.168] (-832.750) -- 0:00:20
663000 -- [-832.039] (-830.971) (-832.104) (-839.357) * (-832.047) (-831.474) (-831.644) [-832.099] -- 0:00:20
663500 -- (-830.913) (-831.157) (-831.694) [-838.618] * (-831.545) [-834.725] (-831.860) (-831.801) -- 0:00:20
664000 -- (-833.778) (-834.698) [-831.938] (-833.620) * [-831.272] (-834.947) (-832.425) (-833.425) -- 0:00:20
664500 -- (-834.600) (-838.171) [-831.417] (-835.724) * (-832.177) (-830.827) [-831.857] (-832.283) -- 0:00:20
665000 -- (-830.886) (-834.713) [-832.873] (-832.700) * [-833.749] (-832.540) (-832.306) (-832.457) -- 0:00:20
Average standard deviation of split frequencies: 0.008635
665500 -- (-833.877) (-836.092) [-831.896] (-833.685) * (-833.314) [-833.960] (-832.744) (-832.224) -- 0:00:20
666000 -- (-834.092) (-835.724) (-833.250) [-835.800] * (-831.115) (-831.143) [-831.269] (-832.238) -- 0:00:20
666500 -- (-833.976) [-829.995] (-834.409) (-831.575) * (-835.190) (-830.284) [-833.064] (-831.314) -- 0:00:20
667000 -- (-833.137) (-831.368) [-832.691] (-831.685) * (-832.678) (-830.312) [-832.527] (-833.570) -- 0:00:19
667500 -- (-831.330) [-831.150] (-832.694) (-831.793) * (-831.433) (-832.353) (-831.005) [-831.557] -- 0:00:19
668000 -- [-832.035] (-831.906) (-833.296) (-835.254) * (-831.188) (-832.437) [-832.991] (-830.553) -- 0:00:19
668500 -- (-832.041) [-834.783] (-831.752) (-834.080) * [-834.318] (-830.835) (-831.372) (-832.221) -- 0:00:20
669000 -- (-832.681) (-834.026) [-832.029] (-833.724) * (-830.999) (-831.800) [-831.287] (-831.352) -- 0:00:20
669500 -- (-831.126) [-833.851] (-830.560) (-831.802) * (-831.582) (-831.319) [-833.744] (-833.408) -- 0:00:20
670000 -- [-831.756] (-834.938) (-830.560) (-833.209) * (-832.138) (-834.100) (-831.166) [-830.575] -- 0:00:20
Average standard deviation of split frequencies: 0.008763
670500 -- (-830.571) (-832.739) [-832.738] (-831.624) * [-832.238] (-830.596) (-832.769) (-835.881) -- 0:00:20
671000 -- (-830.094) [-831.376] (-833.508) (-831.654) * [-830.866] (-834.701) (-831.331) (-836.321) -- 0:00:20
671500 -- [-829.880] (-830.832) (-832.793) (-831.504) * (-833.330) (-832.348) [-830.793] (-831.053) -- 0:00:20
672000 -- (-834.042) (-831.215) (-833.207) [-830.900] * (-831.623) (-832.783) (-830.423) [-832.594] -- 0:00:20
672500 -- (-833.073) (-830.119) (-832.258) [-830.682] * (-834.013) (-832.678) [-830.477] (-833.230) -- 0:00:19
673000 -- (-830.300) [-833.332] (-832.917) (-831.605) * (-831.003) (-833.299) [-832.451] (-833.309) -- 0:00:19
673500 -- (-832.087) [-831.896] (-832.014) (-832.409) * (-832.628) (-831.389) (-831.437) [-831.044] -- 0:00:19
674000 -- (-832.073) (-832.429) [-832.633] (-835.973) * (-832.600) (-834.315) [-830.557] (-834.678) -- 0:00:19
674500 -- (-832.302) [-830.419] (-832.808) (-835.236) * (-830.588) (-833.400) [-831.378] (-834.691) -- 0:00:19
675000 -- (-835.662) (-830.953) [-830.341] (-833.636) * (-831.614) [-832.962] (-830.440) (-832.994) -- 0:00:19
Average standard deviation of split frequencies: 0.008647
675500 -- (-831.724) (-831.952) (-830.234) [-834.325] * (-839.787) (-830.960) (-833.038) [-832.210] -- 0:00:19
676000 -- (-830.996) (-830.637) (-834.707) [-836.973] * (-836.550) [-829.982] (-833.293) (-832.451) -- 0:00:19
676500 -- (-833.364) (-831.207) [-830.233] (-833.695) * (-834.327) (-832.238) [-830.265] (-831.985) -- 0:00:19
677000 -- [-832.750] (-833.276) (-830.097) (-830.068) * (-831.943) [-831.072] (-832.502) (-830.319) -- 0:00:19
677500 -- (-832.933) (-832.533) (-830.481) [-830.729] * (-830.563) (-830.345) [-832.920] (-831.735) -- 0:00:19
678000 -- [-835.531] (-831.197) (-830.724) (-835.891) * (-842.055) [-831.317] (-831.333) (-833.450) -- 0:00:19
678500 -- (-832.832) (-830.148) [-831.904] (-832.754) * (-843.747) (-831.764) (-831.205) [-830.891] -- 0:00:19
679000 -- (-839.151) [-832.347] (-830.359) (-832.482) * (-832.567) (-832.171) [-832.303] (-833.727) -- 0:00:19
679500 -- (-843.011) [-832.537] (-834.913) (-830.734) * [-831.491] (-830.960) (-833.707) (-834.105) -- 0:00:19
680000 -- [-830.438] (-832.168) (-835.963) (-830.517) * [-831.335] (-835.736) (-832.013) (-834.276) -- 0:00:19
Average standard deviation of split frequencies: 0.008657
680500 -- (-831.079) [-834.073] (-831.088) (-831.860) * (-832.468) [-833.407] (-833.265) (-834.755) -- 0:00:19
681000 -- (-833.708) (-837.124) [-831.166] (-830.998) * (-830.449) (-830.970) [-830.698] (-830.628) -- 0:00:19
681500 -- (-833.989) (-834.363) (-830.234) [-832.544] * (-831.608) (-833.985) [-830.561] (-833.732) -- 0:00:19
682000 -- (-832.515) (-831.406) [-830.262] (-834.072) * (-831.257) (-832.148) (-832.083) [-831.715] -- 0:00:19
682500 -- [-831.974] (-832.623) (-835.334) (-833.742) * (-833.023) (-837.071) (-834.588) [-831.849] -- 0:00:19
683000 -- (-836.311) [-831.916] (-834.466) (-835.013) * [-830.438] (-833.758) (-833.565) (-830.718) -- 0:00:19
683500 -- (-832.534) (-831.795) [-833.314] (-833.732) * (-831.798) [-832.819] (-832.057) (-829.909) -- 0:00:18
684000 -- (-835.176) [-833.195] (-833.257) (-833.825) * (-833.147) [-832.596] (-831.203) (-829.938) -- 0:00:18
684500 -- (-835.873) [-833.823] (-833.579) (-830.759) * [-833.159] (-831.436) (-831.878) (-832.126) -- 0:00:18
685000 -- [-831.423] (-834.318) (-832.422) (-831.804) * (-830.629) (-831.207) [-830.047] (-831.947) -- 0:00:19
Average standard deviation of split frequencies: 0.008504
685500 -- (-834.870) (-833.478) [-831.713] (-832.776) * (-831.189) (-835.567) (-831.397) [-830.856] -- 0:00:19
686000 -- (-834.961) [-832.210] (-832.218) (-830.928) * (-831.449) (-833.965) [-832.660] (-836.378) -- 0:00:19
686500 -- (-831.265) [-831.845] (-830.244) (-833.808) * (-833.784) (-830.421) (-832.270) [-832.608] -- 0:00:19
687000 -- [-834.747] (-832.803) (-835.651) (-833.320) * [-833.035] (-831.084) (-830.839) (-832.199) -- 0:00:19
687500 -- (-832.239) (-833.788) [-832.123] (-832.644) * (-832.373) (-831.224) [-832.133] (-831.613) -- 0:00:19
688000 -- [-831.547] (-830.386) (-830.177) (-830.717) * [-830.934] (-830.571) (-832.732) (-832.046) -- 0:00:19
688500 -- (-830.981) (-830.235) (-831.947) [-831.891] * (-834.769) [-832.867] (-836.173) (-832.044) -- 0:00:19
689000 -- [-830.386] (-830.828) (-831.001) (-831.335) * [-830.664] (-831.085) (-833.178) (-832.376) -- 0:00:18
689500 -- (-832.487) (-830.242) [-829.911] (-830.104) * (-834.627) (-831.098) (-833.993) [-829.989] -- 0:00:18
690000 -- (-831.842) (-830.250) (-830.768) [-832.390] * (-831.550) [-832.296] (-831.930) (-832.807) -- 0:00:18
Average standard deviation of split frequencies: 0.008532
690500 -- (-830.524) (-830.092) [-831.189] (-829.877) * (-833.911) (-833.973) (-835.984) [-831.437] -- 0:00:18
691000 -- (-832.802) [-830.027] (-831.196) (-830.284) * [-835.005] (-835.783) (-831.360) (-830.716) -- 0:00:18
691500 -- (-835.638) (-830.014) [-832.319] (-831.144) * [-831.051] (-832.593) (-832.529) (-832.335) -- 0:00:18
692000 -- (-831.554) (-835.370) (-834.237) [-833.774] * (-831.268) [-830.745] (-833.102) (-834.504) -- 0:00:18
692500 -- [-831.296] (-832.180) (-834.777) (-837.669) * (-833.661) [-830.695] (-834.389) (-830.284) -- 0:00:18
693000 -- (-831.578) (-832.871) (-830.090) [-831.101] * (-836.544) (-830.750) (-838.451) [-830.494] -- 0:00:18
693500 -- (-832.273) (-830.551) [-829.996] (-830.669) * [-833.055] (-830.376) (-835.562) (-830.363) -- 0:00:18
694000 -- (-831.175) [-830.926] (-833.570) (-836.302) * (-832.290) (-832.048) (-836.820) [-832.039] -- 0:00:18
694500 -- (-831.711) [-831.967] (-833.692) (-830.756) * (-832.286) (-832.751) (-835.462) [-830.784] -- 0:00:18
695000 -- (-831.377) (-830.481) [-832.751] (-833.108) * (-830.013) (-831.128) [-832.442] (-831.598) -- 0:00:18
Average standard deviation of split frequencies: 0.008678
695500 -- (-835.842) (-833.789) [-832.460] (-831.617) * (-832.014) (-833.451) (-832.672) [-832.371] -- 0:00:18
696000 -- (-833.317) [-833.039] (-830.146) (-832.297) * (-836.460) (-832.017) (-832.301) [-830.632] -- 0:00:18
696500 -- (-831.586) (-830.642) (-829.990) [-831.614] * (-832.901) (-831.042) (-835.062) [-830.522] -- 0:00:18
697000 -- [-832.012] (-831.326) (-833.829) (-831.093) * [-831.012] (-837.972) (-830.611) (-832.932) -- 0:00:18
697500 -- (-833.245) (-830.003) [-830.367] (-832.016) * (-833.458) (-835.916) [-832.725] (-831.680) -- 0:00:18
698000 -- (-832.546) (-831.572) [-831.457] (-831.059) * (-833.004) (-835.173) (-832.081) [-832.357] -- 0:00:18
698500 -- (-831.809) [-830.107] (-831.847) (-830.980) * (-832.229) (-830.795) (-833.543) [-832.254] -- 0:00:18
699000 -- (-830.617) (-831.201) (-833.601) [-831.017] * (-830.237) (-831.115) (-830.883) [-831.212] -- 0:00:18
699500 -- (-834.688) (-833.482) (-831.847) [-833.258] * (-830.329) (-830.393) (-832.189) [-830.986] -- 0:00:18
700000 -- [-835.694] (-832.679) (-830.381) (-835.492) * (-833.058) (-830.691) [-832.094] (-834.851) -- 0:00:18
Average standard deviation of split frequencies: 0.008536
700500 -- (-830.242) [-831.123] (-832.363) (-831.710) * [-832.980] (-831.676) (-830.933) (-834.108) -- 0:00:17
701000 -- (-830.258) (-832.581) [-830.710] (-833.663) * [-831.720] (-830.157) (-836.335) (-835.491) -- 0:00:17
701500 -- (-833.621) [-832.870] (-830.775) (-831.355) * (-830.295) [-830.382] (-835.011) (-834.174) -- 0:00:18
702000 -- [-830.120] (-833.014) (-830.763) (-832.013) * (-831.059) (-831.546) [-832.535] (-835.970) -- 0:00:18
702500 -- (-833.740) (-831.688) (-830.502) [-833.845] * [-831.714] (-835.448) (-832.427) (-836.588) -- 0:00:18
703000 -- (-831.267) (-830.525) (-832.535) [-834.973] * (-829.896) (-835.343) (-832.657) [-831.427] -- 0:00:18
703500 -- (-834.739) [-830.612] (-832.689) (-832.898) * [-831.972] (-838.508) (-833.219) (-833.498) -- 0:00:18
704000 -- (-830.929) (-830.916) [-833.491] (-832.046) * (-833.039) (-835.528) (-833.988) [-833.739] -- 0:00:18
704500 -- (-832.963) [-832.503] (-833.008) (-836.056) * (-833.463) (-833.536) [-833.068] (-832.964) -- 0:00:18
705000 -- (-831.382) (-832.690) [-831.645] (-831.693) * (-834.881) (-831.298) (-840.775) [-832.097] -- 0:00:17
Average standard deviation of split frequencies: 0.008472
705500 -- (-831.516) [-831.416] (-831.633) (-835.808) * (-835.298) [-833.033] (-832.312) (-830.672) -- 0:00:17
706000 -- (-830.728) (-830.913) [-830.432] (-832.390) * [-830.762] (-832.424) (-830.709) (-833.183) -- 0:00:17
706500 -- [-830.496] (-833.153) (-831.335) (-832.278) * (-831.212) (-830.304) [-833.877] (-834.237) -- 0:00:17
707000 -- (-832.545) [-831.917] (-831.439) (-832.761) * (-831.403) [-834.701] (-831.365) (-835.628) -- 0:00:17
707500 -- (-835.477) (-831.917) (-831.851) [-831.742] * (-831.309) (-833.977) [-831.440] (-832.460) -- 0:00:17
708000 -- (-832.986) [-831.131] (-830.238) (-835.488) * (-833.469) (-831.618) [-833.371] (-834.994) -- 0:00:17
708500 -- (-830.980) [-832.283] (-831.797) (-830.319) * [-834.493] (-831.672) (-832.064) (-834.498) -- 0:00:17
709000 -- (-835.725) (-831.894) (-831.258) [-830.929] * (-830.844) (-831.754) (-835.859) [-831.977] -- 0:00:17
709500 -- [-836.243] (-832.660) (-835.141) (-833.517) * (-830.935) (-831.318) (-831.494) [-831.783] -- 0:00:17
710000 -- (-833.712) [-832.173] (-831.472) (-836.005) * (-832.826) [-833.375] (-831.092) (-831.612) -- 0:00:17
Average standard deviation of split frequencies: 0.008167
710500 -- (-835.290) (-831.413) [-834.432] (-835.799) * [-833.478] (-832.883) (-832.979) (-831.921) -- 0:00:17
711000 -- (-834.684) (-834.400) [-832.610] (-835.687) * (-831.174) (-833.554) (-832.271) [-835.259] -- 0:00:17
711500 -- [-830.780] (-832.682) (-832.279) (-841.678) * (-836.229) (-832.336) (-831.173) [-833.428] -- 0:00:17
712000 -- (-829.882) (-833.465) [-832.251] (-840.642) * (-833.711) (-834.435) [-830.792] (-833.290) -- 0:00:17
712500 -- (-830.602) [-830.990] (-833.035) (-837.800) * (-831.492) (-832.265) [-832.135] (-830.942) -- 0:00:17
713000 -- [-831.981] (-833.953) (-832.508) (-833.558) * (-832.597) (-833.580) (-831.176) [-831.606] -- 0:00:17
713500 -- [-831.017] (-831.557) (-832.298) (-831.076) * (-833.989) (-832.026) (-833.986) [-832.488] -- 0:00:17
714000 -- (-832.660) (-834.289) [-830.392] (-832.727) * (-838.318) (-832.404) (-838.339) [-831.991] -- 0:00:17
714500 -- (-834.477) [-833.152] (-829.957) (-833.315) * (-831.839) [-832.489] (-835.251) (-831.122) -- 0:00:17
715000 -- (-831.578) (-833.724) [-833.245] (-830.737) * (-832.712) [-830.128] (-836.350) (-831.130) -- 0:00:17
Average standard deviation of split frequencies: 0.008024
715500 -- (-830.846) [-833.407] (-832.545) (-831.920) * (-837.266) (-830.774) (-834.216) [-835.567] -- 0:00:17
716000 -- (-830.544) [-830.928] (-831.515) (-831.566) * (-833.234) [-831.595] (-833.879) (-832.837) -- 0:00:17
716500 -- (-831.345) (-830.600) (-832.106) [-831.172] * (-831.522) (-831.488) [-835.123] (-831.822) -- 0:00:17
717000 -- (-831.598) (-830.482) [-831.240] (-831.652) * [-831.257] (-832.413) (-830.821) (-835.072) -- 0:00:16
717500 -- (-836.731) (-830.665) (-831.039) [-832.241] * (-830.908) (-830.319) (-833.834) [-838.930] -- 0:00:16
718000 -- (-829.908) [-832.110] (-831.137) (-833.937) * [-830.770] (-830.180) (-834.144) (-839.122) -- 0:00:17
718500 -- (-829.908) (-831.890) [-831.074] (-835.178) * [-830.719] (-830.921) (-833.685) (-835.846) -- 0:00:17
719000 -- (-830.877) (-830.878) (-831.300) [-837.087] * [-832.015] (-831.410) (-831.832) (-831.939) -- 0:00:17
719500 -- [-830.394] (-833.169) (-830.339) (-834.923) * (-832.372) (-833.890) [-830.557] (-834.172) -- 0:00:17
720000 -- (-831.440) (-830.853) [-832.042] (-832.646) * (-831.387) (-832.050) (-833.963) [-832.337] -- 0:00:17
Average standard deviation of split frequencies: 0.007768
720500 -- (-832.578) [-830.537] (-832.894) (-831.881) * (-834.125) [-832.884] (-831.815) (-830.870) -- 0:00:17
721000 -- (-831.459) (-832.298) (-834.191) [-831.826] * [-832.596] (-833.013) (-832.117) (-831.646) -- 0:00:17
721500 -- [-834.117] (-836.216) (-833.996) (-831.189) * (-831.346) (-833.146) (-830.975) [-832.349] -- 0:00:16
722000 -- [-831.528] (-833.611) (-832.572) (-830.876) * (-833.329) (-831.251) [-832.096] (-830.981) -- 0:00:16
722500 -- (-834.317) [-833.314] (-832.272) (-831.575) * (-831.107) (-831.835) (-831.200) [-830.907] -- 0:00:16
723000 -- [-830.279] (-836.073) (-833.574) (-833.249) * (-831.571) (-834.348) [-832.173] (-837.938) -- 0:00:16
723500 -- (-831.846) (-833.113) [-832.781] (-831.226) * (-832.543) (-834.539) [-830.668] (-836.144) -- 0:00:16
724000 -- (-836.647) [-832.114] (-832.089) (-834.666) * [-831.010] (-831.445) (-831.610) (-835.742) -- 0:00:16
724500 -- (-831.389) [-830.552] (-833.148) (-830.418) * (-835.217) (-833.271) (-832.483) [-833.431] -- 0:00:16
725000 -- (-830.686) (-835.736) (-833.137) [-833.016] * (-834.537) (-830.301) (-830.570) [-832.796] -- 0:00:16
Average standard deviation of split frequencies: 0.007995
725500 -- [-831.145] (-832.303) (-830.620) (-833.366) * (-834.742) (-830.880) [-831.841] (-834.508) -- 0:00:16
726000 -- (-833.396) (-837.123) [-831.289] (-833.584) * [-832.131] (-832.289) (-833.534) (-835.923) -- 0:00:16
726500 -- (-833.089) [-831.091] (-830.877) (-831.502) * (-833.824) (-834.180) [-832.238] (-832.971) -- 0:00:16
727000 -- (-831.064) [-830.581] (-834.260) (-832.291) * (-832.864) (-831.941) [-832.496] (-831.661) -- 0:00:16
727500 -- (-837.946) (-832.601) [-832.332] (-832.659) * (-833.892) [-830.986] (-830.800) (-831.808) -- 0:00:16
728000 -- (-831.924) [-832.628] (-833.034) (-831.417) * (-830.710) [-834.855] (-832.444) (-830.444) -- 0:00:16
728500 -- (-832.280) (-832.972) [-833.895] (-830.349) * (-831.480) (-830.809) [-830.592] (-830.559) -- 0:00:16
729000 -- (-832.481) (-833.995) (-831.067) [-832.044] * (-832.746) (-832.672) (-834.207) [-832.155] -- 0:00:16
729500 -- (-836.127) (-836.920) [-831.524] (-831.840) * (-833.156) (-832.539) (-834.188) [-831.841] -- 0:00:16
730000 -- (-831.627) [-835.276] (-830.990) (-830.107) * (-835.874) [-833.046] (-830.889) (-832.239) -- 0:00:16
Average standard deviation of split frequencies: 0.008105
730500 -- [-831.458] (-830.985) (-832.356) (-833.087) * [-832.907] (-836.046) (-838.968) (-832.065) -- 0:00:16
731000 -- (-830.103) [-830.982] (-832.675) (-833.106) * [-832.659] (-833.357) (-838.350) (-831.803) -- 0:00:16
731500 -- [-831.138] (-831.635) (-831.094) (-830.522) * [-832.145] (-833.267) (-833.343) (-831.915) -- 0:00:16
732000 -- [-831.367] (-833.884) (-832.069) (-830.989) * (-835.487) (-833.710) (-834.034) [-830.987] -- 0:00:16
732500 -- (-831.202) (-833.260) [-833.330] (-838.518) * (-834.897) [-834.873] (-834.807) (-832.494) -- 0:00:16
733000 -- (-831.488) [-833.178] (-831.594) (-832.091) * (-832.343) [-832.448] (-832.455) (-834.899) -- 0:00:16
733500 -- (-830.435) (-830.768) [-833.361] (-835.595) * [-834.894] (-832.277) (-831.926) (-830.737) -- 0:00:15
734000 -- (-831.506) (-833.844) (-831.404) [-830.998] * (-833.635) [-829.933] (-837.815) (-830.495) -- 0:00:15
734500 -- [-831.751] (-833.398) (-834.019) (-830.466) * (-833.259) [-831.611] (-838.818) (-830.099) -- 0:00:16
735000 -- (-833.038) (-833.439) [-835.369] (-830.675) * [-833.291] (-833.604) (-833.868) (-830.864) -- 0:00:16
Average standard deviation of split frequencies: 0.007601
735500 -- (-831.474) (-831.712) (-834.570) [-833.132] * [-833.560] (-833.250) (-833.408) (-832.255) -- 0:00:16
736000 -- (-833.171) (-832.778) [-832.576] (-832.542) * [-830.813] (-832.923) (-834.228) (-831.118) -- 0:00:16
736500 -- (-831.950) [-833.785] (-834.432) (-830.631) * (-830.856) [-831.660] (-832.724) (-831.684) -- 0:00:16
737000 -- [-831.043] (-830.174) (-831.321) (-831.639) * (-831.583) (-831.056) [-833.329] (-831.207) -- 0:00:16
737500 -- [-834.035] (-832.679) (-831.515) (-834.053) * (-832.813) (-831.157) (-833.051) [-830.888] -- 0:00:16
738000 -- (-833.625) (-833.391) (-831.762) [-832.468] * [-833.524] (-831.328) (-831.578) (-830.547) -- 0:00:15
738500 -- (-830.429) [-831.042] (-837.774) (-832.522) * (-831.062) (-840.198) (-833.982) [-830.977] -- 0:00:15
739000 -- (-832.447) (-831.263) [-830.151] (-833.855) * (-832.302) (-834.273) (-832.910) [-830.774] -- 0:00:15
739500 -- (-830.622) (-831.871) [-832.011] (-834.188) * [-830.225] (-834.926) (-834.041) (-832.784) -- 0:00:15
740000 -- (-830.507) (-833.543) (-831.188) [-832.724] * (-831.496) [-832.481] (-831.818) (-833.323) -- 0:00:15
Average standard deviation of split frequencies: 0.007935
740500 -- (-833.044) (-832.869) [-831.037] (-831.568) * [-832.807] (-832.915) (-830.878) (-833.397) -- 0:00:15
741000 -- (-833.733) (-832.417) (-830.921) [-831.355] * (-829.945) [-831.055] (-831.199) (-830.895) -- 0:00:15
741500 -- [-830.540] (-832.558) (-830.224) (-833.446) * (-830.737) (-831.767) (-830.709) [-830.796] -- 0:00:15
742000 -- (-832.128) (-832.447) (-834.383) [-832.755] * (-829.671) (-834.963) [-831.202] (-830.777) -- 0:00:15
742500 -- [-830.863] (-830.049) (-832.144) (-834.908) * (-830.245) (-832.714) (-834.043) [-830.336] -- 0:00:15
743000 -- (-831.438) (-833.770) (-836.613) [-831.438] * (-830.902) (-832.697) [-830.652] (-829.846) -- 0:00:15
743500 -- (-833.864) [-832.665] (-831.735) (-829.839) * (-830.822) (-834.247) (-832.111) [-830.272] -- 0:00:15
744000 -- (-830.547) (-831.814) [-831.022] (-830.134) * (-831.315) [-833.653] (-832.789) (-832.608) -- 0:00:15
744500 -- (-832.774) (-830.939) (-832.794) [-830.384] * (-832.469) (-833.424) [-831.896] (-832.145) -- 0:00:15
745000 -- [-831.982] (-830.286) (-830.683) (-831.145) * (-830.968) (-832.503) (-833.904) [-831.335] -- 0:00:15
Average standard deviation of split frequencies: 0.007709
745500 -- (-831.367) [-832.360] (-836.341) (-831.716) * (-832.380) (-831.889) [-830.210] (-830.829) -- 0:00:15
746000 -- (-830.600) (-833.038) (-833.977) [-830.859] * (-839.878) (-831.557) (-832.662) [-832.811] -- 0:00:15
746500 -- (-830.686) [-837.588] (-832.958) (-831.730) * [-834.253] (-831.743) (-832.837) (-831.398) -- 0:00:15
747000 -- (-833.120) (-834.991) [-830.345] (-833.117) * [-835.929] (-833.646) (-832.709) (-831.143) -- 0:00:15
747500 -- (-833.972) (-836.693) (-832.223) [-832.771] * (-834.336) [-830.425] (-831.750) (-834.107) -- 0:00:15
748000 -- (-832.193) (-834.891) (-830.499) [-834.860] * (-834.442) (-831.069) (-830.294) [-831.970] -- 0:00:15
748500 -- (-831.829) (-830.276) [-831.382] (-835.304) * [-831.028] (-833.085) (-831.045) (-835.471) -- 0:00:15
749000 -- [-830.817] (-832.263) (-831.083) (-835.470) * (-832.012) (-834.009) (-833.595) [-833.976] -- 0:00:15
749500 -- (-830.276) (-830.896) [-831.401] (-831.014) * (-833.218) (-832.080) (-831.197) [-830.479] -- 0:00:15
750000 -- (-830.340) (-831.350) (-834.959) [-830.974] * [-832.148] (-833.356) (-832.802) (-836.124) -- 0:00:15
Average standard deviation of split frequencies: 0.006672
750500 -- (-829.915) [-830.820] (-830.133) (-833.154) * (-831.258) [-832.223] (-832.341) (-831.075) -- 0:00:14
751000 -- (-830.499) (-832.048) [-832.707] (-834.248) * (-831.098) (-831.888) (-833.035) [-834.077] -- 0:00:15
751500 -- (-830.160) [-829.865] (-834.118) (-831.903) * (-831.562) (-830.680) [-833.390] (-834.112) -- 0:00:15
752000 -- (-831.584) (-835.821) [-832.509] (-832.127) * (-832.321) (-831.858) [-832.165] (-831.950) -- 0:00:15
752500 -- (-835.045) (-832.715) [-831.352] (-830.664) * (-830.465) [-830.989] (-831.853) (-830.969) -- 0:00:15
753000 -- [-837.102] (-832.196) (-835.707) (-830.693) * (-830.789) [-831.473] (-830.486) (-830.739) -- 0:00:15
753500 -- (-830.195) (-831.812) (-833.004) [-831.564] * (-830.118) (-833.736) [-830.957] (-832.203) -- 0:00:15
754000 -- (-831.506) (-831.245) (-833.036) [-830.862] * (-830.222) (-833.171) (-830.803) [-835.857] -- 0:00:15
754500 -- (-830.464) [-832.569] (-832.443) (-831.185) * (-831.561) (-831.297) (-831.043) [-831.243] -- 0:00:14
755000 -- (-831.758) (-831.087) [-830.914] (-831.153) * [-832.141] (-836.424) (-831.884) (-831.065) -- 0:00:14
Average standard deviation of split frequencies: 0.007150
755500 -- (-830.215) (-830.875) [-832.437] (-830.926) * (-833.666) [-833.091] (-830.510) (-831.051) -- 0:00:14
756000 -- (-830.891) (-834.936) (-831.453) [-830.315] * (-831.234) (-833.202) [-831.254] (-833.744) -- 0:00:14
756500 -- [-831.114] (-831.092) (-831.589) (-830.860) * (-831.217) (-831.758) [-831.887] (-832.132) -- 0:00:14
757000 -- [-837.724] (-833.620) (-831.420) (-830.568) * (-834.866) [-830.543] (-831.070) (-831.169) -- 0:00:14
757500 -- (-832.469) (-830.654) [-830.747] (-833.771) * [-833.406] (-830.175) (-833.864) (-832.660) -- 0:00:14
758000 -- [-830.410] (-830.280) (-832.952) (-832.341) * (-831.204) (-830.224) [-831.769] (-833.028) -- 0:00:14
758500 -- [-832.517] (-832.771) (-832.301) (-831.489) * (-831.058) (-834.259) (-832.138) [-834.087] -- 0:00:14
759000 -- (-830.338) [-833.366] (-832.068) (-830.744) * [-831.514] (-831.702) (-832.891) (-831.055) -- 0:00:14
759500 -- (-831.462) (-834.729) [-831.951] (-833.067) * (-831.749) (-832.974) (-831.157) [-831.285] -- 0:00:14
760000 -- [-832.082] (-830.721) (-831.725) (-835.444) * (-831.380) [-831.483] (-833.425) (-832.253) -- 0:00:14
Average standard deviation of split frequencies: 0.007065
760500 -- (-833.642) (-832.839) [-832.613] (-832.536) * (-832.278) (-833.265) [-832.368] (-833.384) -- 0:00:14
761000 -- (-831.802) (-830.282) [-831.744] (-831.240) * (-834.609) [-831.934] (-834.041) (-832.903) -- 0:00:14
761500 -- (-830.847) (-832.130) [-831.515] (-831.234) * (-832.128) (-831.837) (-839.591) [-830.551] -- 0:00:14
762000 -- (-831.932) [-830.798] (-832.617) (-832.613) * [-833.040] (-831.926) (-837.871) (-834.601) -- 0:00:14
762500 -- (-832.464) (-830.735) [-831.579] (-832.564) * [-832.194] (-830.774) (-838.776) (-832.682) -- 0:00:14
763000 -- (-830.409) [-831.232] (-837.988) (-834.049) * [-830.771] (-835.038) (-834.756) (-831.834) -- 0:00:14
763500 -- (-834.032) [-835.941] (-836.589) (-829.826) * (-831.614) (-831.100) [-831.685] (-833.703) -- 0:00:14
764000 -- (-833.806) (-834.954) [-832.185] (-832.859) * (-833.109) (-831.330) [-831.424] (-831.161) -- 0:00:14
764500 -- (-838.527) (-833.725) (-831.724) [-832.795] * (-831.862) [-834.497] (-833.711) (-830.977) -- 0:00:14
765000 -- (-831.194) [-832.847] (-836.519) (-830.552) * (-833.116) (-831.142) (-833.274) [-830.223] -- 0:00:14
Average standard deviation of split frequencies: 0.007098
765500 -- (-834.454) [-832.546] (-832.031) (-830.520) * (-832.906) (-833.096) [-834.812] (-830.698) -- 0:00:14
766000 -- (-834.309) (-831.766) (-834.681) [-830.673] * (-834.070) [-835.024] (-834.416) (-832.806) -- 0:00:14
766500 -- [-830.707] (-832.054) (-837.254) (-836.563) * [-831.620] (-833.987) (-834.301) (-830.995) -- 0:00:14
767000 -- (-831.207) [-834.773] (-835.619) (-831.775) * (-831.480) (-830.487) (-831.821) [-831.178] -- 0:00:13
767500 -- (-835.557) (-831.698) (-831.930) [-830.555] * [-831.389] (-834.100) (-832.492) (-831.044) -- 0:00:14
768000 -- (-835.388) [-830.075] (-832.001) (-832.031) * (-831.024) [-830.799] (-831.192) (-832.270) -- 0:00:14
768500 -- (-833.660) (-830.117) (-833.110) [-831.930] * (-830.207) [-830.477] (-834.688) (-830.924) -- 0:00:14
769000 -- (-834.550) [-833.204] (-833.618) (-832.010) * [-831.399] (-832.862) (-830.388) (-832.662) -- 0:00:14
769500 -- (-833.040) (-831.326) (-830.691) [-833.990] * [-830.450] (-833.665) (-833.518) (-830.490) -- 0:00:14
770000 -- (-833.421) [-833.199] (-832.606) (-832.542) * (-831.909) (-836.912) [-831.763] (-831.551) -- 0:00:14
Average standard deviation of split frequencies: 0.007422
770500 -- [-831.255] (-831.223) (-831.213) (-833.029) * (-832.390) [-831.625] (-833.556) (-831.397) -- 0:00:13
771000 -- (-831.619) (-830.017) [-831.481] (-833.983) * [-833.067] (-832.671) (-832.398) (-832.313) -- 0:00:13
771500 -- (-830.130) [-829.726] (-831.199) (-832.074) * (-831.344) (-834.460) (-833.275) [-831.797] -- 0:00:13
772000 -- (-832.329) (-831.359) [-832.636] (-833.262) * (-831.352) (-832.004) (-833.036) [-831.149] -- 0:00:13
772500 -- (-835.390) (-831.619) (-834.799) [-833.912] * (-837.113) (-833.629) (-831.743) [-830.893] -- 0:00:13
773000 -- (-833.588) [-833.903] (-832.113) (-836.808) * (-832.689) [-831.089] (-832.386) (-829.987) -- 0:00:13
773500 -- (-830.824) [-831.719] (-833.163) (-832.433) * (-835.700) (-832.812) (-833.460) [-829.985] -- 0:00:13
774000 -- (-830.466) [-833.063] (-834.938) (-835.290) * (-833.863) [-831.616] (-830.688) (-831.390) -- 0:00:13
774500 -- (-830.622) (-833.660) [-830.006] (-835.081) * [-831.168] (-835.250) (-832.303) (-832.113) -- 0:00:13
775000 -- (-834.797) (-830.764) [-831.315] (-832.952) * [-830.794] (-832.235) (-831.950) (-834.039) -- 0:00:13
Average standard deviation of split frequencies: 0.007857
775500 -- (-831.953) (-832.140) (-833.823) [-830.442] * (-831.250) [-831.949] (-830.246) (-832.481) -- 0:00:13
776000 -- (-830.990) (-832.653) (-830.990) [-831.834] * (-832.091) [-830.523] (-830.378) (-833.587) -- 0:00:13
776500 -- (-829.960) (-832.805) [-831.967] (-834.260) * (-831.060) (-837.205) (-830.540) [-836.912] -- 0:00:13
777000 -- (-831.247) (-831.706) [-830.356] (-833.918) * [-831.240] (-833.920) (-834.136) (-830.839) -- 0:00:13
777500 -- (-832.401) (-832.949) [-831.228] (-830.841) * (-834.983) (-831.518) (-832.737) [-832.101] -- 0:00:13
778000 -- (-831.563) (-831.961) (-835.297) [-832.575] * (-830.276) [-832.624] (-834.315) (-832.092) -- 0:00:13
778500 -- [-831.589] (-832.953) (-830.279) (-835.044) * (-834.829) (-833.170) [-830.891] (-830.926) -- 0:00:13
779000 -- (-834.813) (-842.267) [-831.956] (-833.637) * (-830.889) [-830.901] (-830.016) (-832.173) -- 0:00:13
779500 -- (-834.255) (-838.055) (-830.721) [-831.655] * (-831.117) (-831.364) (-830.676) [-830.368] -- 0:00:13
780000 -- (-832.226) (-838.226) (-830.939) [-833.000] * (-832.050) [-832.633] (-832.301) (-832.018) -- 0:00:13
Average standard deviation of split frequencies: 0.007729
780500 -- (-831.406) (-832.859) [-833.344] (-834.120) * (-830.538) (-832.140) [-830.624] (-832.224) -- 0:00:13
781000 -- (-829.930) [-830.637] (-832.339) (-831.181) * (-832.225) (-834.911) [-834.323] (-830.531) -- 0:00:13
781500 -- (-835.032) [-831.762] (-832.229) (-830.250) * (-831.304) [-832.267] (-834.565) (-831.040) -- 0:00:13
782000 -- [-831.819] (-834.209) (-833.144) (-830.624) * (-830.479) (-835.755) (-831.537) [-830.507] -- 0:00:13
782500 -- (-833.473) (-830.276) (-830.966) [-831.262] * [-831.298] (-830.917) (-831.582) (-830.849) -- 0:00:13
783000 -- (-830.883) (-829.818) [-832.740] (-832.146) * (-832.909) [-835.032] (-830.733) (-830.930) -- 0:00:13
783500 -- (-833.819) (-830.430) [-831.314] (-831.946) * [-830.830] (-833.753) (-831.965) (-832.179) -- 0:00:12
784000 -- (-838.590) [-832.035] (-831.209) (-838.428) * (-831.227) (-837.968) [-833.504] (-829.881) -- 0:00:13
784500 -- (-836.802) (-831.611) (-834.166) [-832.359] * [-830.466] (-834.730) (-830.325) (-830.724) -- 0:00:13
785000 -- (-831.595) [-831.003] (-833.636) (-832.436) * [-830.649] (-834.861) (-834.370) (-831.043) -- 0:00:13
Average standard deviation of split frequencies: 0.007757
785500 -- [-831.518] (-831.731) (-839.278) (-832.513) * (-829.908) [-833.726] (-831.424) (-831.043) -- 0:00:13
786000 -- (-831.624) (-832.276) (-833.600) [-831.377] * (-834.895) (-837.124) [-832.543] (-832.020) -- 0:00:13
786500 -- (-832.589) (-833.779) (-837.515) [-830.485] * [-834.665] (-837.509) (-830.970) (-834.099) -- 0:00:13
787000 -- (-830.815) (-833.162) [-832.856] (-831.573) * [-830.523] (-832.065) (-831.039) (-833.348) -- 0:00:12
787500 -- (-832.823) (-830.452) [-835.101] (-831.481) * (-832.508) (-834.109) (-832.253) [-833.490] -- 0:00:12
788000 -- (-831.591) [-830.664] (-835.492) (-831.097) * (-834.547) (-830.932) (-833.937) [-837.252] -- 0:00:12
788500 -- (-831.001) [-831.296] (-832.767) (-831.802) * [-833.940] (-832.515) (-832.270) (-830.176) -- 0:00:12
789000 -- (-832.676) (-834.014) [-830.643] (-835.926) * (-830.395) (-832.642) [-829.724] (-829.732) -- 0:00:12
789500 -- (-832.964) (-831.216) [-832.121] (-830.539) * (-834.220) (-830.181) (-833.465) [-835.095] -- 0:00:12
790000 -- [-831.466] (-831.274) (-832.627) (-834.348) * (-834.921) [-831.801] (-831.786) (-832.581) -- 0:00:12
Average standard deviation of split frequencies: 0.007433
790500 -- (-831.174) (-831.213) (-833.336) [-833.036] * [-832.515] (-835.404) (-834.620) (-832.289) -- 0:00:12
791000 -- (-832.674) (-830.525) [-831.749] (-832.380) * (-831.703) (-830.885) (-832.179) [-831.605] -- 0:00:12
791500 -- (-834.220) [-830.776] (-831.755) (-832.524) * [-831.815] (-831.606) (-831.710) (-833.087) -- 0:00:12
792000 -- (-835.836) (-832.483) (-833.045) [-831.019] * (-832.723) (-831.057) [-833.509] (-835.273) -- 0:00:12
792500 -- (-831.159) (-832.102) [-830.530] (-830.101) * (-830.776) (-832.007) [-834.811] (-830.724) -- 0:00:12
793000 -- (-836.555) (-833.068) [-830.801] (-832.869) * (-835.329) [-833.989] (-830.805) (-833.626) -- 0:00:12
793500 -- (-831.338) (-832.626) (-830.324) [-831.877] * (-833.058) (-831.104) (-830.165) [-830.030] -- 0:00:12
794000 -- (-835.848) [-832.151] (-830.340) (-830.247) * (-830.378) (-830.673) [-830.779] (-833.287) -- 0:00:12
794500 -- (-832.863) [-830.639] (-831.624) (-831.123) * [-831.716] (-830.516) (-830.643) (-830.009) -- 0:00:12
795000 -- (-831.359) [-830.325] (-831.572) (-833.951) * (-833.334) (-832.164) (-831.753) [-831.143] -- 0:00:12
Average standard deviation of split frequencies: 0.007817
795500 -- (-834.170) (-831.317) (-832.417) [-833.734] * (-831.511) [-835.122] (-830.989) (-832.780) -- 0:00:12
796000 -- (-831.651) (-831.293) [-834.539] (-831.853) * (-832.344) (-830.740) [-830.435] (-833.365) -- 0:00:12
796500 -- (-832.749) [-833.291] (-836.741) (-833.361) * [-834.046] (-830.987) (-831.168) (-832.095) -- 0:00:12
797000 -- (-830.366) (-831.586) (-833.715) [-831.104] * [-831.789] (-834.325) (-831.181) (-831.866) -- 0:00:12
797500 -- (-832.636) (-831.753) [-834.182] (-831.320) * [-831.798] (-835.519) (-833.564) (-830.759) -- 0:00:12
798000 -- (-830.598) (-832.952) [-831.021] (-830.938) * (-832.892) [-831.893] (-832.143) (-830.416) -- 0:00:12
798500 -- (-832.036) (-831.292) (-835.659) [-831.770] * (-832.713) (-830.940) (-832.222) [-830.270] -- 0:00:12
799000 -- [-830.791] (-833.441) (-833.865) (-831.309) * (-830.820) (-831.784) (-830.981) [-830.878] -- 0:00:12
799500 -- [-830.610] (-833.372) (-832.195) (-830.220) * (-830.075) (-834.525) [-831.041] (-835.661) -- 0:00:12
800000 -- [-832.520] (-834.986) (-831.350) (-832.867) * (-831.063) [-830.794] (-829.818) (-830.061) -- 0:00:12
Average standard deviation of split frequencies: 0.007654
800500 -- (-831.404) (-835.482) [-830.383] (-831.235) * (-833.805) (-830.223) [-830.034] (-831.258) -- 0:00:12
801000 -- (-832.853) (-834.183) (-830.695) [-831.287] * (-831.312) (-831.080) [-835.107] (-831.629) -- 0:00:12
801500 -- (-835.608) (-833.089) (-834.012) [-834.192] * [-831.642] (-830.401) (-830.870) (-832.833) -- 0:00:12
802000 -- [-833.635] (-830.012) (-830.902) (-830.654) * (-833.353) (-831.342) (-833.163) [-834.061] -- 0:00:12
802500 -- (-832.752) (-830.291) [-835.306] (-831.825) * (-832.435) [-831.761] (-831.547) (-830.239) -- 0:00:12
803000 -- (-832.639) (-830.731) (-833.753) [-831.213] * (-831.944) (-830.672) [-836.979] (-832.122) -- 0:00:12
803500 -- (-830.511) [-832.133] (-831.816) (-831.217) * (-834.419) (-832.396) [-833.167] (-831.554) -- 0:00:11
804000 -- (-832.400) (-832.859) [-830.956] (-831.439) * (-831.185) (-832.842) (-832.696) [-832.618] -- 0:00:11
804500 -- [-830.078] (-833.234) (-831.108) (-834.152) * (-830.138) (-832.113) (-831.466) [-831.007] -- 0:00:11
805000 -- (-831.059) (-833.076) [-830.903] (-832.070) * [-834.527] (-831.201) (-830.696) (-832.544) -- 0:00:11
Average standard deviation of split frequencies: 0.007915
805500 -- [-833.007] (-832.646) (-833.914) (-831.566) * (-833.084) (-831.044) (-831.753) [-831.628] -- 0:00:11
806000 -- (-830.315) (-830.047) [-831.054] (-831.571) * [-832.583] (-833.167) (-832.807) (-831.668) -- 0:00:11
806500 -- (-831.784) (-831.120) [-831.064] (-831.430) * (-832.584) (-836.436) [-831.386] (-835.449) -- 0:00:11
807000 -- (-831.157) (-832.756) [-833.341] (-831.236) * [-833.992] (-833.695) (-833.004) (-832.824) -- 0:00:11
807500 -- (-834.808) (-834.031) [-832.708] (-830.876) * [-832.166] (-833.935) (-833.300) (-834.470) -- 0:00:11
808000 -- (-833.602) (-833.728) [-833.388] (-831.827) * [-834.148] (-831.112) (-834.829) (-831.672) -- 0:00:11
808500 -- [-834.235] (-832.784) (-834.794) (-831.173) * (-834.277) [-830.354] (-838.115) (-833.866) -- 0:00:11
809000 -- (-834.226) [-831.896] (-833.065) (-833.612) * (-833.390) [-833.191] (-832.146) (-831.704) -- 0:00:11
809500 -- (-832.963) [-832.189] (-833.705) (-832.864) * (-833.818) (-830.906) (-831.738) [-832.696] -- 0:00:11
810000 -- (-833.275) [-832.854] (-833.081) (-831.211) * [-836.644] (-832.346) (-834.216) (-831.463) -- 0:00:11
Average standard deviation of split frequencies: 0.007908
810500 -- [-832.420] (-833.884) (-834.656) (-838.942) * (-835.833) [-833.022] (-832.157) (-832.940) -- 0:00:11
811000 -- (-832.208) [-834.160] (-831.543) (-837.137) * (-833.387) (-830.520) (-832.110) [-831.043] -- 0:00:11
811500 -- (-830.403) [-829.980] (-830.136) (-834.418) * (-834.657) [-830.550] (-829.863) (-831.624) -- 0:00:11
812000 -- (-833.562) (-830.177) [-832.584] (-831.248) * (-831.935) [-830.815] (-834.027) (-832.947) -- 0:00:11
812500 -- (-832.677) [-830.762] (-831.448) (-833.980) * (-831.468) [-832.790] (-833.013) (-833.040) -- 0:00:11
813000 -- (-831.355) (-833.260) [-834.383] (-833.983) * (-832.750) (-831.573) [-834.111] (-833.990) -- 0:00:11
813500 -- (-830.277) [-831.220] (-831.374) (-831.976) * [-832.169] (-832.563) (-834.570) (-833.335) -- 0:00:11
814000 -- (-833.530) [-833.698] (-834.672) (-831.047) * (-832.784) (-833.227) [-832.093] (-831.457) -- 0:00:11
814500 -- (-834.421) (-832.928) (-835.079) [-830.308] * [-831.503] (-834.507) (-832.647) (-830.446) -- 0:00:11
815000 -- (-831.436) (-831.160) [-831.557] (-830.292) * [-831.249] (-831.760) (-832.153) (-830.556) -- 0:00:11
Average standard deviation of split frequencies: 0.007741
815500 -- (-830.762) (-831.464) (-835.865) [-836.890] * (-831.103) [-830.587] (-831.047) (-831.570) -- 0:00:11
816000 -- [-835.299] (-833.207) (-834.331) (-831.179) * (-834.528) [-830.289] (-831.457) (-831.477) -- 0:00:11
816500 -- (-833.543) (-834.580) (-834.539) [-834.760] * [-830.618] (-832.242) (-832.078) (-831.689) -- 0:00:11
817000 -- [-830.529] (-831.007) (-830.946) (-833.990) * (-835.230) [-830.272] (-831.282) (-832.179) -- 0:00:11
817500 -- (-832.591) [-830.368] (-833.324) (-832.555) * (-832.342) (-831.178) (-831.886) [-831.069] -- 0:00:11
818000 -- (-834.445) (-832.210) (-834.286) [-835.181] * [-831.680] (-837.157) (-833.379) (-831.971) -- 0:00:11
818500 -- (-832.634) (-834.097) [-835.691] (-835.956) * (-833.152) (-831.950) (-833.974) [-832.841] -- 0:00:11
819000 -- (-830.715) (-830.965) (-833.450) [-833.417] * [-830.536] (-830.272) (-831.971) (-830.184) -- 0:00:11
819500 -- (-831.011) [-831.965] (-832.746) (-833.427) * [-831.570] (-831.847) (-831.311) (-831.849) -- 0:00:11
820000 -- (-831.838) (-834.250) [-830.633] (-829.933) * (-834.507) (-830.456) [-835.015] (-831.335) -- 0:00:10
Average standard deviation of split frequencies: 0.007659
820500 -- (-830.431) (-834.519) [-831.300] (-833.299) * (-830.052) (-833.330) [-834.147] (-835.712) -- 0:00:10
821000 -- (-835.702) (-830.260) (-833.349) [-831.039] * (-831.083) [-831.511] (-831.344) (-831.771) -- 0:00:10
821500 -- (-833.005) (-835.594) (-830.837) [-830.363] * (-830.758) [-832.393] (-833.676) (-832.023) -- 0:00:10
822000 -- (-832.633) (-835.106) (-830.316) [-831.050] * [-830.798] (-832.508) (-833.346) (-833.004) -- 0:00:10
822500 -- [-831.956] (-832.798) (-836.599) (-833.495) * (-832.891) (-833.510) [-831.007] (-831.718) -- 0:00:10
823000 -- [-832.571] (-832.018) (-830.527) (-831.421) * (-834.575) (-831.413) [-835.273] (-831.059) -- 0:00:10
823500 -- [-833.325] (-834.852) (-830.970) (-831.697) * (-835.852) (-835.325) (-831.776) [-832.773] -- 0:00:10
824000 -- (-836.046) (-834.662) [-831.602] (-832.757) * (-835.175) (-834.416) (-833.444) [-831.999] -- 0:00:10
824500 -- (-833.195) [-831.349] (-832.159) (-831.918) * (-832.466) (-831.677) [-830.056] (-830.626) -- 0:00:10
825000 -- (-830.948) (-830.134) (-832.238) [-830.491] * (-832.506) (-830.843) (-830.983) [-830.532] -- 0:00:10
Average standard deviation of split frequencies: 0.007914
825500 -- (-834.049) (-832.059) [-830.217] (-833.550) * [-832.871] (-831.017) (-831.912) (-835.630) -- 0:00:10
826000 -- (-833.714) (-833.459) [-831.063] (-837.388) * [-831.189] (-833.970) (-833.428) (-830.176) -- 0:00:10
826500 -- (-836.126) (-833.870) (-843.078) [-830.676] * (-830.997) (-833.033) [-830.116] (-832.147) -- 0:00:10
827000 -- (-833.151) (-831.572) [-832.819] (-829.991) * [-830.787] (-832.728) (-833.310) (-832.572) -- 0:00:10
827500 -- (-830.708) [-831.387] (-831.118) (-830.904) * (-831.614) (-831.939) [-836.388] (-831.931) -- 0:00:10
828000 -- [-833.374] (-833.985) (-831.832) (-834.036) * (-831.109) (-831.563) (-832.328) [-830.363] -- 0:00:10
828500 -- (-832.714) (-832.612) [-833.076] (-830.338) * (-830.938) (-831.727) [-831.926] (-832.944) -- 0:00:10
829000 -- [-830.952] (-837.649) (-830.158) (-833.255) * (-833.650) (-833.633) [-830.317] (-833.270) -- 0:00:10
829500 -- [-830.819] (-831.701) (-830.997) (-834.459) * [-833.301] (-832.278) (-830.755) (-835.199) -- 0:00:10
830000 -- (-830.818) [-831.370] (-831.615) (-837.152) * [-830.375] (-830.750) (-831.645) (-834.937) -- 0:00:10
Average standard deviation of split frequencies: 0.008172
830500 -- (-831.924) (-831.774) [-831.607] (-832.389) * (-831.921) [-832.713] (-832.867) (-832.165) -- 0:00:10
831000 -- (-829.781) [-830.047] (-832.320) (-832.727) * (-834.054) [-834.321] (-831.974) (-830.589) -- 0:00:10
831500 -- (-834.176) (-830.722) (-834.006) [-830.211] * (-832.983) (-829.956) (-830.140) [-832.726] -- 0:00:10
832000 -- (-830.273) (-832.431) (-832.309) [-830.135] * (-832.184) [-830.833] (-834.507) (-830.596) -- 0:00:10
832500 -- (-830.696) [-830.418] (-831.443) (-835.527) * (-836.419) [-830.825] (-833.786) (-835.000) -- 0:00:10
833000 -- (-830.138) [-831.301] (-832.385) (-838.416) * (-833.410) [-833.865] (-833.391) (-837.552) -- 0:00:10
833500 -- (-832.504) (-834.438) [-836.056] (-837.830) * (-832.224) [-832.196] (-832.836) (-830.538) -- 0:00:10
834000 -- (-831.544) [-830.839] (-831.599) (-834.323) * [-831.047] (-831.464) (-832.410) (-833.400) -- 0:00:10
834500 -- (-830.918) (-834.907) (-834.582) [-833.467] * (-834.580) (-833.890) [-832.575] (-835.752) -- 0:00:10
835000 -- (-832.760) [-830.432] (-831.685) (-835.730) * (-831.934) [-830.816] (-831.686) (-832.215) -- 0:00:10
Average standard deviation of split frequencies: 0.008106
835500 -- (-831.670) [-837.113] (-831.158) (-834.734) * (-832.214) (-837.323) (-832.428) [-830.568] -- 0:00:10
836000 -- (-831.890) (-837.891) (-832.293) [-835.235] * [-830.607] (-833.750) (-833.162) (-829.919) -- 0:00:10
836500 -- [-833.149] (-830.347) (-831.215) (-832.631) * (-832.509) (-836.231) (-832.137) [-832.088] -- 0:00:09
837000 -- (-831.972) [-831.968] (-831.221) (-831.311) * (-833.764) [-836.842] (-834.696) (-831.649) -- 0:00:09
837500 -- (-832.058) (-831.189) (-831.599) [-831.739] * (-830.656) [-835.201] (-832.758) (-832.409) -- 0:00:09
838000 -- (-836.940) (-831.528) [-830.590] (-834.001) * (-832.600) (-834.690) (-832.508) [-831.306] -- 0:00:09
838500 -- (-832.698) (-830.984) (-831.744) [-831.959] * (-832.650) (-833.495) (-832.004) [-834.569] -- 0:00:09
839000 -- (-830.834) (-831.451) (-835.070) [-831.958] * (-835.397) (-831.116) [-831.715] (-832.915) -- 0:00:09
839500 -- (-830.578) (-839.855) (-831.367) [-833.298] * [-833.385] (-835.654) (-830.913) (-833.766) -- 0:00:09
840000 -- (-831.106) (-832.631) [-831.367] (-836.104) * (-834.116) [-832.625] (-833.084) (-833.747) -- 0:00:09
Average standard deviation of split frequencies: 0.008336
840500 -- (-831.996) (-833.050) (-833.202) [-832.747] * (-832.770) (-833.403) (-832.486) [-831.211] -- 0:00:09
841000 -- (-832.708) [-830.582] (-837.682) (-834.013) * (-833.475) (-831.389) (-832.516) [-831.147] -- 0:00:09
841500 -- [-832.870] (-831.344) (-839.086) (-832.281) * (-831.752) [-830.557] (-833.530) (-831.883) -- 0:00:09
842000 -- (-836.107) [-833.821] (-834.035) (-833.210) * (-831.159) [-840.326] (-834.559) (-830.971) -- 0:00:09
842500 -- [-831.589] (-836.660) (-832.577) (-830.815) * [-832.870] (-831.481) (-838.059) (-835.043) -- 0:00:09
843000 -- (-832.686) (-831.152) [-832.009] (-837.027) * (-833.559) [-831.171] (-832.026) (-831.532) -- 0:00:09
843500 -- (-832.452) (-832.117) [-836.126] (-834.153) * (-830.858) [-831.047] (-837.367) (-830.170) -- 0:00:09
844000 -- (-830.353) (-832.287) [-830.836] (-834.389) * (-834.733) (-831.650) (-833.002) [-831.022] -- 0:00:09
844500 -- [-833.799] (-832.513) (-829.904) (-832.526) * (-834.835) (-832.438) [-830.164] (-831.207) -- 0:00:09
845000 -- (-830.857) (-831.741) [-830.113] (-834.577) * [-833.295] (-836.037) (-830.911) (-830.763) -- 0:00:09
Average standard deviation of split frequencies: 0.009124
845500 -- (-831.849) (-830.337) (-833.632) [-832.454] * (-834.154) (-835.049) [-832.449] (-831.090) -- 0:00:09
846000 -- [-830.435] (-830.815) (-833.163) (-835.500) * (-831.621) (-831.836) (-832.406) [-831.310] -- 0:00:09
846500 -- [-832.223] (-834.724) (-836.551) (-833.379) * (-835.719) [-832.345] (-836.086) (-832.583) -- 0:00:09
847000 -- (-833.067) (-831.521) (-831.618) [-834.116] * (-833.572) (-830.449) (-836.137) [-830.206] -- 0:00:09
847500 -- (-834.271) (-832.194) [-830.008] (-834.877) * (-833.863) (-832.003) (-835.774) [-831.193] -- 0:00:09
848000 -- (-830.057) [-830.907] (-831.141) (-833.256) * [-830.523] (-831.231) (-835.447) (-831.772) -- 0:00:09
848500 -- (-830.880) [-831.291] (-833.121) (-833.029) * (-831.923) (-834.246) (-831.669) [-830.637] -- 0:00:09
849000 -- (-832.446) (-832.171) [-832.278] (-834.718) * [-832.474] (-831.311) (-833.112) (-833.609) -- 0:00:09
849500 -- (-831.215) (-830.399) [-832.968] (-836.269) * (-832.031) (-831.303) [-834.747] (-830.904) -- 0:00:09
850000 -- (-831.789) (-829.993) [-832.326] (-832.537) * (-834.797) (-832.583) (-831.125) [-831.778] -- 0:00:09
Average standard deviation of split frequencies: 0.009317
850500 -- [-831.610] (-830.562) (-833.172) (-833.355) * [-830.799] (-831.095) (-830.288) (-835.371) -- 0:00:09
851000 -- (-831.214) (-831.609) (-831.559) [-831.460] * (-831.853) (-831.622) (-830.816) [-832.409] -- 0:00:09
851500 -- (-831.430) [-832.862] (-830.848) (-832.113) * (-831.676) (-830.532) (-831.379) [-838.350] -- 0:00:09
852000 -- (-832.442) (-832.997) [-830.780] (-831.079) * (-833.977) [-830.325] (-832.920) (-832.548) -- 0:00:09
852500 -- (-836.127) [-832.888] (-833.399) (-830.619) * (-830.643) (-830.564) (-832.299) [-831.496] -- 0:00:08
853000 -- (-836.336) (-831.027) [-831.260] (-832.379) * (-830.895) (-832.325) (-831.771) [-831.731] -- 0:00:08
853500 -- (-834.666) [-831.220] (-830.637) (-831.017) * (-832.652) (-831.950) (-832.008) [-831.628] -- 0:00:08
854000 -- (-832.263) (-833.515) [-830.352] (-831.743) * (-831.463) (-831.959) [-831.235] (-836.048) -- 0:00:08
854500 -- (-830.752) [-831.073] (-830.817) (-829.929) * (-834.634) (-837.072) (-830.915) [-831.592] -- 0:00:08
855000 -- (-830.016) [-830.794] (-831.505) (-830.285) * (-830.805) [-832.043] (-834.678) (-832.166) -- 0:00:08
Average standard deviation of split frequencies: 0.009052
855500 -- (-833.723) (-830.650) (-831.226) [-830.931] * [-830.193] (-831.140) (-834.138) (-830.794) -- 0:00:08
856000 -- (-831.390) [-831.074] (-830.930) (-832.051) * (-831.731) [-833.149] (-832.540) (-831.743) -- 0:00:08
856500 -- (-830.205) (-831.706) (-835.365) [-830.495] * (-834.641) [-834.238] (-832.765) (-832.035) -- 0:00:08
857000 -- [-831.418] (-831.400) (-839.246) (-831.961) * (-836.422) (-830.514) (-831.274) [-835.587] -- 0:00:08
857500 -- (-833.055) (-834.465) (-831.765) [-832.969] * (-838.192) (-833.769) [-832.260] (-833.007) -- 0:00:08
858000 -- (-843.134) [-833.067] (-832.985) (-833.431) * (-830.974) (-830.251) (-832.417) [-833.438] -- 0:00:08
858500 -- [-833.614] (-832.864) (-833.219) (-831.449) * (-831.985) (-831.825) (-831.994) [-831.701] -- 0:00:08
859000 -- (-830.869) (-831.108) [-832.563] (-836.727) * (-831.539) [-833.602] (-830.993) (-830.819) -- 0:00:08
859500 -- (-830.869) (-831.033) (-830.810) [-832.947] * (-830.873) [-831.246] (-832.009) (-832.859) -- 0:00:08
860000 -- (-831.335) (-831.027) [-831.592] (-831.568) * (-830.460) [-831.520] (-835.506) (-833.943) -- 0:00:08
Average standard deviation of split frequencies: 0.008216
860500 -- (-830.184) [-831.399] (-834.755) (-832.673) * [-832.072] (-830.691) (-831.295) (-833.843) -- 0:00:08
861000 -- [-831.723] (-830.851) (-830.333) (-839.893) * (-836.422) (-832.023) [-833.195] (-831.428) -- 0:00:08
861500 -- (-831.544) (-831.307) [-830.861] (-831.394) * (-834.177) (-830.648) [-832.767] (-831.284) -- 0:00:08
862000 -- (-831.428) [-830.869] (-833.550) (-831.826) * (-833.731) [-829.763] (-830.390) (-834.112) -- 0:00:08
862500 -- (-830.663) (-830.783) (-834.872) [-831.330] * [-832.019] (-830.038) (-830.016) (-836.402) -- 0:00:08
863000 -- (-830.909) [-831.986] (-834.362) (-834.669) * [-833.325] (-834.081) (-831.767) (-833.954) -- 0:00:08
863500 -- (-832.655) (-832.946) [-833.494] (-833.360) * (-829.949) (-832.232) [-830.603] (-833.455) -- 0:00:08
864000 -- [-830.302] (-834.015) (-831.771) (-841.154) * (-831.388) [-830.138] (-834.929) (-833.668) -- 0:00:08
864500 -- (-831.186) (-837.014) [-831.774] (-836.693) * (-832.510) (-831.608) [-832.233] (-831.645) -- 0:00:08
865000 -- [-831.975] (-831.048) (-834.026) (-835.637) * (-832.427) [-831.503] (-832.234) (-832.042) -- 0:00:08
Average standard deviation of split frequencies: 0.007961
865500 -- (-834.919) (-833.443) [-834.864] (-835.792) * (-831.064) (-831.025) [-830.475] (-831.346) -- 0:00:08
866000 -- [-831.423] (-833.513) (-830.914) (-834.786) * [-830.361] (-830.126) (-830.619) (-830.847) -- 0:00:08
866500 -- (-831.363) (-831.278) (-831.105) [-834.480] * [-830.211] (-832.328) (-831.025) (-831.627) -- 0:00:08
867000 -- (-832.240) [-834.961] (-831.911) (-832.871) * (-832.155) (-831.595) (-830.609) [-831.355] -- 0:00:08
867500 -- (-832.240) [-831.543] (-833.447) (-832.886) * (-834.566) (-837.137) [-831.470] (-832.349) -- 0:00:08
868000 -- (-832.093) (-837.417) [-834.200] (-832.269) * (-833.086) (-832.167) (-832.991) [-832.644] -- 0:00:08
868500 -- (-832.741) [-831.032] (-830.672) (-830.792) * (-832.262) [-837.805] (-832.803) (-833.296) -- 0:00:08
869000 -- (-836.759) (-833.476) (-832.894) [-830.293] * [-831.530] (-830.026) (-832.449) (-831.841) -- 0:00:07
869500 -- (-834.101) (-829.912) (-831.979) [-830.396] * (-832.272) (-830.922) [-832.534] (-834.750) -- 0:00:07
870000 -- (-831.952) (-832.134) (-831.486) [-832.005] * [-831.370] (-832.780) (-835.657) (-832.059) -- 0:00:07
Average standard deviation of split frequencies: 0.008020
870500 -- [-835.116] (-833.703) (-833.618) (-831.725) * [-831.628] (-834.276) (-837.481) (-830.620) -- 0:00:07
871000 -- (-832.778) (-832.088) [-831.117] (-833.394) * [-831.895] (-834.445) (-834.861) (-831.338) -- 0:00:07
871500 -- (-833.429) (-830.659) [-833.733] (-835.217) * (-830.521) [-832.665] (-834.392) (-832.928) -- 0:00:07
872000 -- (-830.746) (-832.624) [-831.680] (-830.441) * (-833.601) [-833.486] (-835.573) (-834.061) -- 0:00:07
872500 -- (-832.583) (-833.200) (-835.229) [-831.443] * (-833.504) [-830.685] (-837.178) (-830.270) -- 0:00:07
873000 -- (-833.096) [-831.616] (-832.995) (-830.807) * (-831.379) (-830.576) (-833.310) [-832.254] -- 0:00:07
873500 -- (-831.770) (-832.014) [-832.000] (-830.446) * (-831.287) [-830.576] (-834.767) (-836.533) -- 0:00:07
874000 -- (-832.591) (-831.976) [-830.081] (-832.944) * (-830.961) (-831.452) (-834.209) [-836.137] -- 0:00:07
874500 -- (-833.008) (-833.583) (-830.868) [-830.803] * [-832.102] (-833.347) (-834.357) (-833.396) -- 0:00:07
875000 -- (-832.155) [-831.179] (-830.227) (-831.318) * (-831.078) [-832.293] (-831.036) (-833.886) -- 0:00:07
Average standard deviation of split frequencies: 0.008467
875500 -- (-831.152) (-830.143) [-831.190] (-831.168) * (-830.704) (-830.119) [-832.208] (-834.910) -- 0:00:07
876000 -- [-835.005] (-829.875) (-832.587) (-832.966) * (-832.307) [-831.171] (-833.295) (-834.480) -- 0:00:07
876500 -- (-833.408) [-832.504] (-833.397) (-831.636) * (-831.325) [-830.503] (-831.543) (-834.069) -- 0:00:07
877000 -- (-837.156) [-831.731] (-832.699) (-833.560) * (-832.188) [-830.535] (-832.426) (-833.745) -- 0:00:07
877500 -- (-831.539) (-832.487) [-832.512] (-834.044) * (-830.256) (-831.053) [-833.860] (-835.260) -- 0:00:07
878000 -- (-830.361) (-834.365) [-831.634] (-836.352) * [-830.283] (-832.847) (-833.446) (-831.689) -- 0:00:07
878500 -- (-829.905) (-832.931) [-831.902] (-835.007) * (-832.229) (-830.899) (-834.923) [-831.094] -- 0:00:07
879000 -- (-833.942) (-833.796) [-831.024] (-830.104) * (-833.416) (-830.803) [-831.212] (-830.891) -- 0:00:07
879500 -- [-835.560] (-831.642) (-830.828) (-831.785) * (-837.239) (-831.306) [-831.732] (-833.408) -- 0:00:07
880000 -- (-843.558) (-831.955) [-831.428] (-834.657) * (-832.871) (-831.335) [-830.283] (-831.208) -- 0:00:07
Average standard deviation of split frequencies: 0.008493
880500 -- (-833.399) (-835.850) [-829.892] (-831.676) * (-833.751) [-832.927] (-833.580) (-833.582) -- 0:00:07
881000 -- (-835.549) (-830.633) [-834.147] (-830.479) * (-833.971) (-835.045) (-831.095) [-836.163] -- 0:00:07
881500 -- (-831.524) (-831.007) (-831.120) [-831.760] * (-836.231) (-831.368) [-833.079] (-835.681) -- 0:00:07
882000 -- (-831.897) (-830.221) [-831.644] (-838.209) * [-830.120] (-830.837) (-832.766) (-835.837) -- 0:00:07
882500 -- [-830.384] (-838.614) (-830.592) (-830.758) * [-831.528] (-836.103) (-832.784) (-831.914) -- 0:00:07
883000 -- (-831.585) (-843.006) (-831.045) [-831.373] * [-832.947] (-834.300) (-833.337) (-831.607) -- 0:00:07
883500 -- (-831.299) [-833.964] (-832.477) (-831.732) * (-832.728) (-829.746) (-836.459) [-833.401] -- 0:00:07
884000 -- (-830.906) (-832.364) (-836.234) [-832.573] * (-831.737) (-832.351) (-836.342) [-831.636] -- 0:00:07
884500 -- (-831.790) [-830.070] (-836.480) (-837.077) * [-830.681] (-831.605) (-830.964) (-834.042) -- 0:00:07
885000 -- (-830.920) (-830.900) (-836.032) [-832.157] * (-832.004) (-831.839) [-830.201] (-831.540) -- 0:00:07
Average standard deviation of split frequencies: 0.008336
885500 -- (-834.341) [-830.727] (-833.633) (-831.976) * [-830.584] (-830.436) (-831.125) (-833.850) -- 0:00:06
886000 -- (-830.465) [-831.199] (-833.348) (-831.824) * (-835.443) (-830.730) [-830.379] (-833.164) -- 0:00:06
886500 -- (-830.344) [-836.339] (-830.647) (-833.839) * (-831.678) (-834.568) [-830.733] (-832.987) -- 0:00:06
887000 -- [-831.274] (-832.001) (-833.016) (-833.517) * (-830.018) (-836.399) (-831.907) [-831.650] -- 0:00:06
887500 -- [-832.488] (-832.093) (-830.750) (-832.547) * (-830.845) (-834.420) (-833.448) [-830.545] -- 0:00:06
888000 -- [-832.875] (-833.800) (-830.810) (-831.860) * [-830.518] (-830.376) (-834.168) (-834.237) -- 0:00:06
888500 -- (-831.385) [-831.921] (-831.646) (-830.505) * (-832.732) (-830.590) (-830.588) [-831.475] -- 0:00:06
889000 -- (-832.549) (-833.588) [-831.476] (-830.463) * (-831.434) [-831.770] (-834.727) (-833.519) -- 0:00:06
889500 -- (-834.686) (-831.912) [-833.941] (-832.140) * [-831.667] (-832.255) (-836.851) (-837.547) -- 0:00:06
890000 -- [-835.907] (-831.804) (-836.676) (-832.354) * (-830.297) [-832.174] (-833.504) (-833.973) -- 0:00:06
Average standard deviation of split frequencies: 0.008856
890500 -- [-832.989] (-830.809) (-830.574) (-833.290) * (-831.872) [-834.217] (-832.942) (-834.910) -- 0:00:06
891000 -- (-835.009) [-830.298] (-830.475) (-829.797) * (-831.663) (-831.598) (-831.730) [-832.406] -- 0:00:06
891500 -- (-833.108) (-830.558) [-832.045] (-832.932) * [-831.365] (-832.785) (-831.700) (-832.054) -- 0:00:06
892000 -- (-832.354) (-835.723) [-831.896] (-833.246) * [-833.124] (-830.460) (-832.377) (-830.871) -- 0:00:06
892500 -- [-839.115] (-834.729) (-832.540) (-834.138) * (-834.557) (-830.460) (-835.175) [-831.574] -- 0:00:06
893000 -- (-833.033) (-833.547) [-836.659] (-832.224) * (-833.720) [-832.134] (-830.599) (-832.970) -- 0:00:06
893500 -- [-830.604] (-834.101) (-834.913) (-831.422) * (-832.932) [-833.789] (-832.075) (-830.066) -- 0:00:06
894000 -- (-831.368) (-835.220) (-833.399) [-832.848] * (-832.886) (-830.716) [-831.710] (-832.558) -- 0:00:06
894500 -- (-831.455) (-833.568) (-833.286) [-832.996] * (-832.794) (-830.937) [-836.264] (-831.005) -- 0:00:06
895000 -- (-830.597) [-832.668] (-830.558) (-832.637) * (-830.764) [-831.163] (-830.988) (-832.666) -- 0:00:06
Average standard deviation of split frequencies: 0.009190
895500 -- [-832.557] (-831.261) (-831.236) (-832.637) * (-831.185) (-831.018) (-833.488) [-831.718] -- 0:00:06
896000 -- (-830.604) [-831.402] (-835.204) (-835.064) * (-832.584) (-830.981) (-832.567) [-833.008] -- 0:00:06
896500 -- (-833.012) (-834.090) (-834.738) [-830.737] * (-833.567) (-830.540) (-833.492) [-832.667] -- 0:00:06
897000 -- (-831.742) [-830.053] (-830.590) (-830.072) * (-832.609) (-832.026) [-835.330] (-834.127) -- 0:00:06
897500 -- [-831.864] (-832.199) (-832.893) (-832.671) * (-831.901) [-832.670] (-833.812) (-830.429) -- 0:00:06
898000 -- (-831.719) (-830.788) [-830.685] (-833.118) * [-832.002] (-831.087) (-832.411) (-830.844) -- 0:00:06
898500 -- (-836.194) [-831.910] (-832.473) (-832.647) * (-832.912) (-830.521) (-831.255) [-829.714] -- 0:00:06
899000 -- [-832.387] (-832.244) (-831.529) (-844.300) * [-831.509] (-831.025) (-830.601) (-832.740) -- 0:00:06
899500 -- (-832.858) [-832.277] (-831.517) (-835.658) * (-831.020) (-833.071) [-831.375] (-834.699) -- 0:00:06
900000 -- (-830.692) (-833.414) (-830.568) [-831.993] * [-832.601] (-832.205) (-834.062) (-838.008) -- 0:00:06
Average standard deviation of split frequencies: 0.008828
900500 -- (-831.092) (-831.169) (-832.992) [-831.887] * (-831.671) [-831.125] (-839.261) (-836.528) -- 0:00:06
901000 -- (-832.278) [-831.010] (-830.416) (-831.337) * (-833.447) (-832.326) (-833.335) [-831.270] -- 0:00:06
901500 -- [-831.424] (-832.755) (-829.829) (-831.527) * [-830.640] (-834.345) (-831.768) (-832.127) -- 0:00:06
902000 -- (-830.953) [-832.370] (-830.130) (-831.357) * (-835.817) (-832.544) (-833.143) [-832.663] -- 0:00:05
902500 -- (-832.068) (-834.281) [-830.704] (-831.975) * (-834.909) (-835.980) [-831.283] (-833.644) -- 0:00:05
903000 -- [-836.426] (-831.435) (-831.236) (-830.803) * (-838.424) (-832.222) [-831.258] (-832.134) -- 0:00:05
903500 -- (-831.762) [-834.098] (-835.143) (-831.773) * (-832.617) (-830.776) [-830.965] (-831.106) -- 0:00:05
904000 -- (-835.042) (-830.480) [-833.912] (-830.842) * (-835.534) (-832.378) (-830.917) [-831.314] -- 0:00:05
904500 -- (-830.256) (-831.020) (-831.011) [-831.250] * (-838.489) [-830.721] (-831.730) (-831.053) -- 0:00:05
905000 -- (-830.255) (-831.308) [-830.122] (-830.098) * (-834.015) [-831.388] (-839.276) (-832.761) -- 0:00:05
Average standard deviation of split frequencies: 0.008915
905500 -- [-832.428] (-833.418) (-830.005) (-829.940) * (-835.061) (-832.167) (-831.471) [-831.165] -- 0:00:05
906000 -- (-830.830) (-831.897) (-829.930) [-834.245] * [-835.906] (-832.886) (-833.179) (-833.027) -- 0:00:05
906500 -- (-831.197) (-829.910) [-831.449] (-831.917) * [-834.636] (-832.681) (-834.981) (-833.899) -- 0:00:05
907000 -- [-831.840] (-829.911) (-831.983) (-834.925) * (-832.435) (-832.653) (-831.709) [-833.544] -- 0:00:05
907500 -- (-832.996) [-832.435] (-833.870) (-831.821) * (-832.236) (-832.303) [-831.235] (-831.989) -- 0:00:05
908000 -- [-830.834] (-831.072) (-835.007) (-832.526) * (-831.071) [-832.636] (-832.172) (-831.441) -- 0:00:05
908500 -- (-831.056) (-835.484) (-833.974) [-831.190] * (-831.104) [-834.789] (-831.332) (-831.976) -- 0:00:05
909000 -- (-831.397) (-843.975) [-834.909] (-830.148) * [-832.486] (-833.601) (-836.760) (-832.528) -- 0:00:05
909500 -- (-831.664) (-836.246) (-833.567) [-832.851] * (-831.345) (-831.623) [-829.853] (-830.477) -- 0:00:05
910000 -- [-830.969] (-834.545) (-831.947) (-834.296) * (-831.365) (-833.095) (-831.326) [-832.593] -- 0:00:05
Average standard deviation of split frequencies: 0.008800
910500 -- (-829.772) [-830.767] (-831.843) (-835.559) * (-831.115) (-836.181) (-831.742) [-834.063] -- 0:00:05
911000 -- (-832.296) [-832.818] (-832.877) (-836.286) * [-833.850] (-834.252) (-835.078) (-834.954) -- 0:00:05
911500 -- (-832.555) [-830.237] (-834.828) (-830.394) * (-830.077) (-833.662) (-833.916) [-834.158] -- 0:00:05
912000 -- (-832.922) [-831.126] (-837.539) (-833.673) * (-836.031) [-833.855] (-836.865) (-834.277) -- 0:00:05
912500 -- (-833.990) (-833.535) (-832.158) [-831.890] * (-832.508) (-835.767) [-834.008] (-830.465) -- 0:00:05
913000 -- [-832.118] (-830.652) (-831.253) (-832.176) * (-833.644) (-831.749) (-831.169) [-833.175] -- 0:00:05
913500 -- (-834.468) (-832.736) [-831.613] (-832.160) * (-831.255) (-831.177) [-830.971] (-831.580) -- 0:00:05
914000 -- (-832.973) [-831.305] (-831.403) (-832.122) * (-830.069) (-831.960) (-831.336) [-835.286] -- 0:00:05
914500 -- [-831.436] (-832.203) (-830.589) (-835.234) * (-833.511) (-832.139) [-833.508] (-835.192) -- 0:00:05
915000 -- [-833.211] (-831.959) (-831.449) (-835.294) * (-830.930) (-831.924) [-831.253] (-835.140) -- 0:00:05
Average standard deviation of split frequencies: 0.008577
915500 -- [-832.119] (-831.103) (-830.511) (-831.128) * [-835.529] (-835.684) (-833.146) (-831.847) -- 0:00:05
916000 -- (-838.002) (-831.183) [-831.755] (-831.092) * [-830.736] (-831.500) (-833.480) (-830.782) -- 0:00:05
916500 -- (-835.278) (-833.892) [-832.578] (-835.345) * (-834.864) (-831.054) [-835.825] (-830.894) -- 0:00:05
917000 -- (-833.692) (-831.520) [-831.014] (-833.079) * (-837.335) [-831.434] (-836.660) (-832.275) -- 0:00:05
917500 -- (-830.463) (-830.812) [-833.967] (-832.172) * (-832.041) (-832.870) [-836.660] (-840.182) -- 0:00:05
918000 -- (-832.762) (-830.581) (-830.608) [-836.625] * (-831.193) (-830.935) [-835.473] (-834.275) -- 0:00:05
918500 -- (-831.099) (-831.299) [-830.716] (-832.991) * (-830.640) (-830.554) (-829.935) [-831.891] -- 0:00:04
919000 -- (-833.233) (-831.184) (-831.041) [-833.415] * (-830.637) (-831.758) [-831.066] (-835.622) -- 0:00:04
919500 -- (-832.215) (-832.109) (-830.322) [-831.864] * [-830.329] (-831.043) (-831.331) (-831.734) -- 0:00:04
920000 -- (-833.966) (-831.961) (-831.332) [-831.002] * (-831.842) (-836.712) (-830.288) [-833.154] -- 0:00:04
Average standard deviation of split frequencies: 0.008465
920500 -- (-835.720) [-830.550] (-836.128) (-833.305) * (-830.181) [-831.592] (-834.859) (-831.615) -- 0:00:04
921000 -- [-831.090] (-834.584) (-832.393) (-832.327) * (-834.886) [-832.150] (-830.110) (-831.837) -- 0:00:04
921500 -- [-831.407] (-832.763) (-831.394) (-831.704) * (-837.609) [-832.448] (-830.148) (-830.626) -- 0:00:04
922000 -- (-831.787) (-836.662) (-833.495) [-832.217] * (-836.571) (-831.939) (-830.037) [-830.532] -- 0:00:04
922500 -- (-831.999) [-830.981] (-831.485) (-833.852) * (-834.251) (-832.251) (-830.673) [-830.654] -- 0:00:04
923000 -- (-830.976) (-831.088) [-830.206] (-834.578) * (-830.613) (-830.406) [-831.541] (-831.805) -- 0:00:04
923500 -- (-830.905) (-830.867) (-832.318) [-832.671] * (-833.229) (-840.140) [-834.601] (-834.831) -- 0:00:04
924000 -- (-831.607) (-834.293) (-833.022) [-831.805] * (-834.046) (-835.158) [-834.692] (-831.185) -- 0:00:04
924500 -- (-833.842) [-833.778] (-830.886) (-830.702) * [-832.466] (-833.572) (-832.909) (-831.373) -- 0:00:04
925000 -- (-834.485) (-831.176) [-831.709] (-830.652) * (-831.052) (-831.496) [-832.958] (-833.668) -- 0:00:04
Average standard deviation of split frequencies: 0.008417
925500 -- (-835.018) (-834.180) [-832.124] (-832.029) * (-830.639) [-830.351] (-830.346) (-831.207) -- 0:00:04
926000 -- (-830.567) [-832.377] (-830.924) (-830.092) * (-831.660) (-834.842) [-830.331] (-832.796) -- 0:00:04
926500 -- (-830.488) (-833.226) (-833.038) [-829.872] * [-831.415] (-833.721) (-833.148) (-834.144) -- 0:00:04
927000 -- (-831.016) (-831.341) [-831.438] (-830.710) * (-834.524) (-838.452) [-831.134] (-833.925) -- 0:00:04
927500 -- [-831.713] (-833.777) (-831.107) (-832.714) * [-830.680] (-832.300) (-832.440) (-833.038) -- 0:00:04
928000 -- (-834.887) [-831.156] (-830.234) (-832.441) * [-830.063] (-833.575) (-832.131) (-832.772) -- 0:00:04
928500 -- (-833.939) [-831.970] (-835.264) (-834.389) * (-834.832) [-831.548] (-835.298) (-834.046) -- 0:00:04
929000 -- (-831.448) (-831.331) (-837.325) [-831.006] * [-831.244] (-832.262) (-831.478) (-835.697) -- 0:00:04
929500 -- (-831.130) [-830.966] (-835.550) (-832.475) * (-831.413) (-830.977) [-833.326] (-834.765) -- 0:00:04
930000 -- (-831.765) (-831.972) (-837.258) [-832.199] * (-831.860) (-833.083) [-831.441] (-831.206) -- 0:00:04
Average standard deviation of split frequencies: 0.007800
930500 -- [-832.529] (-831.134) (-834.690) (-830.924) * (-830.689) [-832.513] (-834.545) (-831.014) -- 0:00:04
931000 -- (-831.797) (-830.805) (-834.567) [-830.939] * (-830.609) [-835.405] (-831.170) (-831.491) -- 0:00:04
931500 -- [-831.342] (-832.843) (-833.701) (-834.320) * (-831.675) (-831.168) [-831.082] (-834.047) -- 0:00:04
932000 -- (-831.946) [-830.944] (-832.424) (-830.263) * (-831.797) (-833.482) [-832.470] (-830.682) -- 0:00:04
932500 -- (-833.430) (-832.737) (-831.990) [-832.034] * (-830.191) (-831.791) (-831.914) [-831.102] -- 0:00:04
933000 -- (-831.683) (-832.135) (-831.404) [-830.433] * (-830.353) (-832.905) (-831.337) [-831.338] -- 0:00:04
933500 -- [-831.431] (-836.883) (-831.396) (-831.845) * (-833.301) [-837.075] (-831.330) (-833.251) -- 0:00:04
934000 -- (-831.924) (-832.206) [-830.293] (-833.352) * (-833.365) (-835.276) [-830.192] (-830.913) -- 0:00:04
934500 -- [-830.855] (-831.914) (-832.445) (-831.910) * (-830.499) [-834.868] (-830.156) (-832.180) -- 0:00:03
935000 -- [-834.790] (-831.011) (-835.064) (-830.980) * (-831.653) (-831.477) [-831.598] (-833.508) -- 0:00:03
Average standard deviation of split frequencies: 0.007991
935500 -- (-831.070) [-831.395] (-832.167) (-831.251) * (-837.453) (-831.178) [-836.877] (-832.833) -- 0:00:03
936000 -- [-831.690] (-832.126) (-835.835) (-834.790) * (-842.503) (-831.514) [-832.717] (-831.578) -- 0:00:03
936500 -- (-836.391) [-832.914] (-831.783) (-830.743) * (-840.329) [-832.276] (-830.937) (-832.466) -- 0:00:03
937000 -- (-832.516) (-831.150) (-830.830) [-831.142] * [-833.904] (-834.381) (-830.988) (-832.630) -- 0:00:03
937500 -- (-830.960) (-831.145) [-831.572] (-831.447) * (-830.381) [-831.542] (-831.109) (-835.145) -- 0:00:03
938000 -- (-831.213) [-832.962] (-829.964) (-832.536) * (-831.505) (-830.517) (-830.837) [-834.668] -- 0:00:03
938500 -- (-837.511) [-830.595] (-831.082) (-840.287) * [-830.488] (-830.791) (-830.577) (-831.836) -- 0:00:03
939000 -- (-835.934) (-833.296) [-831.953] (-835.001) * [-830.274] (-831.581) (-835.955) (-833.851) -- 0:00:03
939500 -- (-835.293) [-833.100] (-832.429) (-833.358) * (-831.185) [-833.157] (-835.305) (-832.203) -- 0:00:03
940000 -- (-834.406) (-833.003) [-832.258] (-831.152) * (-830.541) [-838.483] (-830.324) (-835.310) -- 0:00:03
Average standard deviation of split frequencies: 0.008052
940500 -- [-834.461] (-831.445) (-831.016) (-830.633) * (-830.779) (-831.761) [-832.593] (-832.872) -- 0:00:03
941000 -- (-831.691) (-832.152) (-831.583) [-830.025] * (-831.045) (-830.930) (-833.447) [-832.168] -- 0:00:03
941500 -- (-831.684) (-834.933) [-832.730] (-832.338) * (-831.455) (-832.566) [-830.998] (-833.462) -- 0:00:03
942000 -- (-832.020) (-831.805) (-837.801) [-832.284] * [-831.123] (-832.160) (-831.593) (-833.613) -- 0:00:03
942500 -- [-830.900] (-830.881) (-837.733) (-831.640) * [-831.157] (-831.246) (-832.564) (-835.177) -- 0:00:03
943000 -- (-836.578) (-832.432) (-836.890) [-830.870] * (-833.436) [-832.371] (-831.883) (-833.156) -- 0:00:03
943500 -- (-835.696) (-832.583) [-831.484] (-831.513) * (-836.496) (-834.274) (-830.812) [-836.449] -- 0:00:03
944000 -- (-830.912) (-834.171) (-830.803) [-836.607] * (-830.551) [-836.719] (-830.775) (-832.912) -- 0:00:03
944500 -- (-830.893) (-834.902) [-833.404] (-830.543) * (-833.920) [-831.908] (-830.880) (-833.944) -- 0:00:03
945000 -- [-829.727] (-832.926) (-830.105) (-832.834) * [-832.292] (-831.839) (-833.668) (-831.913) -- 0:00:03
Average standard deviation of split frequencies: 0.008160
945500 -- (-829.727) (-830.050) [-830.077] (-831.265) * (-832.586) (-834.926) (-836.577) [-830.586] -- 0:00:03
946000 -- (-831.918) [-830.341] (-832.502) (-834.681) * (-835.466) [-831.834] (-835.116) (-832.143) -- 0:00:03
946500 -- (-834.376) [-830.176] (-832.287) (-831.243) * (-833.234) [-835.984] (-833.521) (-831.160) -- 0:00:03
947000 -- (-830.322) [-832.583] (-837.404) (-831.126) * (-832.731) (-831.269) (-832.386) [-831.248] -- 0:00:03
947500 -- (-834.344) (-832.344) [-834.940] (-831.924) * (-835.710) (-832.438) (-831.932) [-830.426] -- 0:00:03
948000 -- (-837.262) [-831.394] (-838.590) (-831.204) * [-834.240] (-832.731) (-832.635) (-832.744) -- 0:00:03
948500 -- (-833.569) (-831.082) [-830.483] (-831.068) * (-832.589) [-832.672] (-830.955) (-830.548) -- 0:00:03
949000 -- (-830.484) (-831.798) (-830.400) [-834.497] * (-833.122) (-832.284) [-833.075] (-833.141) -- 0:00:03
949500 -- (-830.640) [-831.642] (-830.802) (-834.659) * (-830.208) (-831.741) [-831.576] (-834.568) -- 0:00:03
950000 -- (-831.489) [-830.590] (-832.676) (-835.389) * (-831.737) [-830.026] (-831.043) (-836.191) -- 0:00:03
Average standard deviation of split frequencies: 0.007872
950500 -- (-830.567) [-830.098] (-831.676) (-834.125) * (-832.451) [-833.207] (-830.431) (-832.244) -- 0:00:03
951000 -- [-830.451] (-831.675) (-833.031) (-832.936) * (-831.536) (-830.154) (-830.185) [-830.757] -- 0:00:02
951500 -- (-832.944) (-832.638) [-830.222] (-830.436) * [-831.256] (-830.861) (-830.496) (-834.141) -- 0:00:02
952000 -- [-831.873] (-834.784) (-831.160) (-830.399) * (-831.157) (-833.446) (-833.692) [-833.349] -- 0:00:02
952500 -- (-831.227) (-834.096) [-833.111] (-834.097) * (-832.240) [-833.396] (-835.911) (-830.381) -- 0:00:02
953000 -- (-830.750) (-831.309) [-831.190] (-833.994) * (-830.890) [-831.856] (-834.674) (-831.263) -- 0:00:02
953500 -- (-833.234) [-830.209] (-834.577) (-834.240) * (-832.038) (-834.380) [-833.317] (-833.523) -- 0:00:02
954000 -- (-832.546) (-833.100) (-834.009) [-830.595] * [-831.361] (-830.106) (-834.314) (-836.049) -- 0:00:02
954500 -- (-833.824) [-834.451] (-831.408) (-832.921) * (-831.356) (-830.888) (-834.192) [-832.345] -- 0:00:02
955000 -- (-831.530) [-832.016] (-830.783) (-832.921) * (-831.241) (-833.308) [-830.224] (-831.629) -- 0:00:02
Average standard deviation of split frequencies: 0.007736
955500 -- (-835.925) (-834.764) [-831.504] (-830.763) * (-831.713) (-830.457) (-832.146) [-835.977] -- 0:00:02
956000 -- (-832.129) (-836.812) (-831.436) [-831.487] * (-833.341) (-829.959) (-836.369) [-831.136] -- 0:00:02
956500 -- (-831.674) (-833.326) [-832.582] (-833.607) * (-833.276) (-831.385) (-832.654) [-831.489] -- 0:00:02
957000 -- (-834.967) [-831.003] (-834.507) (-832.396) * (-832.812) (-832.800) [-831.485] (-832.237) -- 0:00:02
957500 -- (-830.828) [-835.205] (-830.457) (-831.793) * (-831.106) (-832.241) (-836.207) [-830.084] -- 0:00:02
958000 -- (-837.337) [-830.542] (-830.963) (-831.928) * [-832.494] (-831.127) (-831.700) (-831.859) -- 0:00:02
958500 -- (-836.660) (-831.429) (-836.811) [-832.175] * (-832.899) (-831.327) (-830.239) [-832.424] -- 0:00:02
959000 -- (-835.013) (-831.889) [-834.928] (-831.538) * (-833.957) [-830.945] (-833.349) (-833.317) -- 0:00:02
959500 -- (-832.623) (-834.340) [-830.823] (-837.132) * (-831.364) [-832.720] (-832.214) (-832.753) -- 0:00:02
960000 -- [-831.559] (-834.754) (-832.929) (-834.745) * (-830.345) (-831.192) [-832.071] (-832.014) -- 0:00:02
Average standard deviation of split frequencies: 0.007851
960500 -- (-834.374) (-832.656) (-831.995) [-832.810] * (-830.894) (-836.441) [-833.412] (-832.076) -- 0:00:02
961000 -- (-831.440) [-831.708] (-830.190) (-832.337) * (-830.130) (-832.172) [-830.552] (-831.838) -- 0:00:02
961500 -- (-834.479) [-833.921] (-831.531) (-833.863) * (-830.130) [-834.526] (-832.746) (-830.915) -- 0:00:02
962000 -- (-833.513) (-830.765) (-833.047) [-832.549] * (-832.255) [-831.681] (-830.683) (-830.870) -- 0:00:02
962500 -- [-832.831] (-834.297) (-836.430) (-831.187) * (-829.959) [-830.588] (-832.394) (-832.064) -- 0:00:02
963000 -- (-832.510) (-834.569) (-831.844) [-831.905] * (-834.365) (-831.228) [-836.814] (-834.434) -- 0:00:02
963500 -- [-833.369] (-832.712) (-831.169) (-830.933) * (-830.378) (-832.575) [-838.020] (-830.379) -- 0:00:02
964000 -- (-832.077) [-830.936] (-830.780) (-836.921) * [-830.213] (-831.643) (-835.581) (-830.303) -- 0:00:02
964500 -- (-832.452) (-830.059) (-832.279) [-833.742] * (-832.305) (-832.565) (-832.819) [-829.981] -- 0:00:02
965000 -- (-831.871) (-833.451) [-831.040] (-832.205) * (-835.853) (-832.603) [-831.330] (-831.481) -- 0:00:02
Average standard deviation of split frequencies: 0.007686
965500 -- [-837.580] (-832.477) (-830.215) (-830.677) * (-834.130) (-832.211) [-832.871] (-838.298) -- 0:00:02
966000 -- (-834.986) [-831.074] (-832.259) (-833.446) * [-832.774] (-835.745) (-833.931) (-834.928) -- 0:00:02
966500 -- [-830.814] (-831.710) (-833.477) (-832.571) * [-831.258] (-832.051) (-831.799) (-834.397) -- 0:00:02
967000 -- (-831.805) [-831.969] (-832.067) (-832.726) * [-832.826] (-830.445) (-832.736) (-832.172) -- 0:00:02
967500 -- (-831.647) [-831.275] (-830.543) (-830.329) * (-832.842) (-832.469) [-831.716] (-832.370) -- 0:00:01
968000 -- (-830.489) (-832.355) (-832.929) [-831.873] * (-832.738) (-831.988) (-835.323) [-833.175] -- 0:00:01
968500 -- [-831.371] (-835.744) (-829.716) (-834.330) * (-831.686) [-833.507] (-838.623) (-832.683) -- 0:00:01
969000 -- (-833.268) (-833.821) [-830.654] (-834.005) * (-832.110) (-833.300) [-837.921] (-830.784) -- 0:00:01
969500 -- [-834.436] (-833.917) (-831.953) (-833.316) * [-831.153] (-838.014) (-834.219) (-833.033) -- 0:00:01
970000 -- (-835.484) (-833.886) (-832.563) [-830.854] * [-835.218] (-833.848) (-834.231) (-833.131) -- 0:00:01
Average standard deviation of split frequencies: 0.007831
970500 -- (-832.827) (-833.621) [-833.562] (-830.836) * (-836.750) (-832.388) (-830.573) [-832.470] -- 0:00:01
971000 -- (-832.676) [-832.085] (-836.061) (-829.952) * (-836.963) (-832.494) (-829.955) [-831.150] -- 0:00:01
971500 -- [-830.805] (-835.596) (-830.972) (-832.477) * (-833.564) (-831.860) (-830.550) [-831.946] -- 0:00:01
972000 -- (-832.763) [-833.105] (-832.332) (-831.935) * (-832.914) (-834.115) (-832.752) [-831.091] -- 0:00:01
972500 -- (-830.321) (-835.981) [-833.685] (-834.661) * (-830.467) (-834.035) [-832.210] (-830.831) -- 0:00:01
973000 -- (-830.397) (-833.547) (-832.231) [-834.512] * [-830.725] (-831.006) (-831.721) (-835.351) -- 0:00:01
973500 -- [-830.478] (-832.215) (-831.418) (-831.679) * [-832.777] (-832.641) (-831.381) (-830.695) -- 0:00:01
974000 -- [-830.879] (-831.560) (-830.608) (-832.519) * (-833.431) (-831.276) [-832.706] (-834.765) -- 0:00:01
974500 -- (-835.076) (-833.744) (-830.608) [-831.907] * [-830.697] (-830.380) (-832.388) (-834.234) -- 0:00:01
975000 -- (-831.557) (-834.240) (-833.316) [-835.334] * (-832.881) (-830.894) [-833.657] (-836.264) -- 0:00:01
Average standard deviation of split frequencies: 0.007879
975500 -- (-831.058) (-830.008) (-838.550) [-833.383] * (-832.003) (-831.316) [-832.635] (-833.844) -- 0:00:01
976000 -- [-832.033] (-833.456) (-830.758) (-834.492) * (-831.994) [-830.510] (-832.503) (-835.564) -- 0:00:01
976500 -- (-830.691) [-832.540] (-830.788) (-832.631) * [-831.975] (-832.309) (-831.781) (-838.584) -- 0:00:01
977000 -- [-830.136] (-830.792) (-834.121) (-831.017) * (-831.939) (-832.905) (-830.919) [-831.408] -- 0:00:01
977500 -- (-830.909) (-830.585) [-830.954] (-831.867) * (-830.676) (-835.193) (-831.419) [-833.631] -- 0:00:01
978000 -- [-831.429] (-831.470) (-833.145) (-833.519) * (-834.846) [-831.682] (-834.155) (-832.355) -- 0:00:01
978500 -- (-830.571) (-833.394) [-832.085] (-832.410) * [-832.066] (-831.812) (-831.882) (-830.313) -- 0:00:01
979000 -- [-832.089] (-833.427) (-831.919) (-834.344) * (-831.389) (-830.603) [-833.874] (-830.493) -- 0:00:01
979500 -- (-833.598) (-830.773) (-834.246) [-835.209] * (-831.840) (-833.397) (-833.710) [-831.719] -- 0:00:01
980000 -- [-831.823] (-833.882) (-830.536) (-835.723) * (-834.837) (-834.362) (-836.733) [-833.783] -- 0:00:01
Average standard deviation of split frequencies: 0.008052
980500 -- [-831.566] (-831.390) (-835.795) (-835.116) * (-832.709) [-831.166] (-831.215) (-834.343) -- 0:00:01
981000 -- (-830.662) (-832.827) [-833.729] (-835.123) * [-830.369] (-833.866) (-832.308) (-837.283) -- 0:00:01
981500 -- (-833.291) (-832.117) [-832.202] (-831.724) * [-830.542] (-831.574) (-832.633) (-831.103) -- 0:00:01
982000 -- (-836.212) (-832.087) (-836.018) [-831.405] * [-829.999] (-830.634) (-833.210) (-832.184) -- 0:00:01
982500 -- (-831.681) (-831.997) [-836.697] (-830.403) * (-831.075) [-832.369] (-835.394) (-830.457) -- 0:00:01
983000 -- (-831.583) (-833.969) (-833.128) [-831.404] * (-833.913) (-830.022) [-830.698] (-834.578) -- 0:00:01
983500 -- (-830.518) [-832.898] (-830.928) (-832.233) * [-831.989] (-830.649) (-831.788) (-830.244) -- 0:00:01
984000 -- (-831.120) (-834.307) [-830.526] (-831.345) * [-832.403] (-834.611) (-831.946) (-831.811) -- 0:00:00
984500 -- (-833.155) (-831.517) (-831.436) [-831.655] * (-830.056) (-835.420) (-831.299) [-831.434] -- 0:00:00
985000 -- (-835.120) (-832.225) (-839.101) [-830.545] * [-830.601] (-833.396) (-831.650) (-833.961) -- 0:00:00
Average standard deviation of split frequencies: 0.008486
985500 -- (-832.398) [-831.597] (-830.611) (-829.893) * (-832.620) (-832.037) (-830.565) [-830.234] -- 0:00:00
986000 -- (-832.398) [-831.727] (-830.896) (-834.387) * (-831.441) (-834.126) [-831.756] (-831.900) -- 0:00:00
986500 -- (-832.263) (-832.695) [-832.837] (-830.861) * (-831.457) (-831.943) [-830.239] (-831.244) -- 0:00:00
987000 -- (-831.657) [-832.191] (-834.452) (-836.360) * (-832.354) (-835.006) (-831.490) [-831.781] -- 0:00:00
987500 -- (-831.641) (-835.370) (-831.018) [-832.819] * (-831.450) (-835.973) (-831.563) [-834.185] -- 0:00:00
988000 -- (-832.972) (-833.526) (-833.534) [-833.080] * (-831.119) [-831.098] (-833.873) (-835.805) -- 0:00:00
988500 -- (-832.914) [-834.607] (-833.788) (-830.358) * (-832.061) [-833.603] (-834.207) (-831.523) -- 0:00:00
989000 -- (-830.810) [-831.059] (-832.557) (-833.613) * (-832.326) (-836.668) [-834.743] (-833.900) -- 0:00:00
989500 -- (-832.667) (-831.472) [-834.521] (-834.303) * (-833.083) [-830.914] (-833.794) (-830.869) -- 0:00:00
990000 -- (-831.266) (-830.338) (-833.393) [-833.349] * (-830.698) (-830.920) (-831.904) [-832.973] -- 0:00:00
Average standard deviation of split frequencies: 0.008185
990500 -- (-830.397) [-831.478] (-833.644) (-834.051) * (-832.735) (-833.817) (-830.476) [-832.904] -- 0:00:00
991000 -- (-831.351) (-831.657) [-830.875] (-830.439) * (-832.967) (-834.392) [-830.949] (-835.267) -- 0:00:00
991500 -- (-831.282) (-831.452) [-831.873] (-831.672) * (-835.727) (-833.309) [-833.731] (-834.689) -- 0:00:00
992000 -- (-831.937) [-830.914] (-831.717) (-832.636) * (-831.487) (-834.232) [-837.767] (-834.019) -- 0:00:00
992500 -- [-829.958] (-830.592) (-830.441) (-832.221) * [-831.541] (-833.133) (-836.540) (-836.925) -- 0:00:00
993000 -- [-831.045] (-832.012) (-831.262) (-837.283) * [-830.946] (-831.554) (-837.518) (-836.657) -- 0:00:00
993500 -- (-831.092) (-830.972) [-831.887] (-834.689) * (-830.733) [-831.727] (-831.740) (-831.517) -- 0:00:00
994000 -- (-831.594) (-831.944) [-832.770] (-840.812) * (-831.734) (-832.064) [-832.078] (-835.705) -- 0:00:00
994500 -- [-831.938] (-831.478) (-833.018) (-834.954) * [-832.666] (-830.839) (-831.610) (-832.751) -- 0:00:00
995000 -- [-829.870] (-831.847) (-832.776) (-833.089) * (-831.893) (-831.320) (-833.887) [-832.649] -- 0:00:00
Average standard deviation of split frequencies: 0.008235
995500 -- (-831.656) (-831.400) (-834.277) [-832.673] * (-829.996) (-830.427) [-831.120] (-834.213) -- 0:00:00
996000 -- (-831.580) [-832.920] (-833.343) (-831.040) * (-831.656) [-831.931] (-830.123) (-834.628) -- 0:00:00
996500 -- (-833.880) (-832.580) [-830.558] (-830.243) * [-832.276] (-834.545) (-832.726) (-833.228) -- 0:00:00
997000 -- (-834.116) (-837.559) [-831.363] (-830.904) * (-831.622) (-833.672) [-832.941] (-830.737) -- 0:00:00
997500 -- [-832.900] (-836.753) (-831.001) (-832.466) * (-832.067) (-834.473) (-831.236) [-831.277] -- 0:00:00
998000 -- (-833.224) (-833.685) [-831.006] (-831.513) * [-831.711] (-831.436) (-832.790) (-832.420) -- 0:00:00
998500 -- (-833.649) [-832.035] (-831.360) (-831.332) * (-830.392) (-830.263) (-839.664) [-830.573] -- 0:00:00
999000 -- [-833.560] (-831.732) (-836.412) (-832.611) * (-831.168) [-832.467] (-833.622) (-831.476) -- 0:00:00
999500 -- (-830.906) (-832.067) (-833.522) [-831.985] * [-831.445] (-833.793) (-832.039) (-830.081) -- 0:00:00
1000000 -- [-830.778] (-832.250) (-831.964) (-830.457) * (-837.842) (-835.087) (-835.520) [-830.637] -- 0:00:00
Average standard deviation of split frequencies: 0.008417
Analysis completed in 1 mins 1 seconds
Analysis used 59.34 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -829.61
Likelihood of best state for "cold" chain of run 2 was -829.61
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.3 % ( 63 %) Dirichlet(Revmat{all})
100.0 % ( 99 %) Slider(Revmat{all})
29.2 % ( 34 %) Dirichlet(Pi{all})
30.3 % ( 26 %) Slider(Pi{all})
78.4 % ( 64 %) Multiplier(Alpha{1,2})
78.0 % ( 57 %) Multiplier(Alpha{3})
23.6 % ( 21 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 20 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.5 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.5 % ( 73 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
29.0 % ( 23 %) Dirichlet(Pi{all})
31.3 % ( 21 %) Slider(Pi{all})
78.6 % ( 50 %) Multiplier(Alpha{1,2})
77.4 % ( 44 %) Multiplier(Alpha{3})
22.0 % ( 27 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 34 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.3 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166789 0.82 0.67
3 | 166326 166737 0.84
4 | 166549 166567 167032
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167154 0.82 0.67
3 | 165728 166557 0.84
4 | 166906 166753 166902
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -831.33
| 2 2 |
| 1 2 2 1 |
| 2 2 2 1 |
| 21 1 1 2 2 2 21 1 2 |
|2 1 1 1 1 2 2 1 1 1 |
|1 2 1 2 1 222 1 11 2* 2 1|
| 2 2 1122 2 1 2 2 1 11 11 12 |
| 2 2 1 1 121 1 1 21 2 1 |
| 2 * 22 2 2 1121 21 1 22 2 12|
| 1 2 2 2 11111 1 2 2 1 2 |
| 1 2 1 2 |
| 2 2 |
| 2 |
| |
| 1 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -833.11
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -831.37 -834.58
2 -831.34 -834.55
--------------------------------------
TOTAL -831.36 -834.56
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894737 0.090907 0.359434 1.486877 0.855089 1501.00 1501.00 1.000
r(A<->C){all} 0.158784 0.018702 0.000017 0.432122 0.119919 186.93 199.78 1.002
r(A<->G){all} 0.169091 0.020599 0.000178 0.459985 0.131237 264.74 314.22 1.001
r(A<->T){all} 0.167864 0.020464 0.000078 0.452147 0.133045 235.69 246.44 1.009
r(C<->G){all} 0.179966 0.021489 0.000342 0.471465 0.147842 191.44 221.03 1.006
r(C<->T){all} 0.161659 0.019631 0.000100 0.446266 0.121258 175.92 308.65 1.000
r(G<->T){all} 0.162636 0.018678 0.000022 0.434377 0.129714 231.27 281.26 1.000
pi(A){all} 0.177473 0.000240 0.147874 0.206943 0.177257 1254.08 1305.53 1.001
pi(C){all} 0.300475 0.000339 0.263032 0.335370 0.300134 1150.57 1325.79 1.000
pi(G){all} 0.262467 0.000315 0.231193 0.300797 0.262454 1380.54 1440.77 1.000
pi(T){all} 0.259586 0.000322 0.224438 0.294559 0.259494 1311.53 1357.10 1.000
alpha{1,2} 0.411282 0.228454 0.000279 1.374108 0.241753 1092.03 1180.43 1.001
alpha{3} 0.466446 0.244042 0.000121 1.511736 0.308377 1080.01 1280.04 1.000
pinvar{all} 0.997431 0.000010 0.991718 0.999997 0.998400 1169.14 1232.47 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..****
8 -- ...**.
9 -- .*.*..
10 -- ..*..*
11 -- ....**
12 -- .***.*
13 -- .**.**
14 -- ...*.*
15 -- ..*.*.
16 -- .****.
17 -- .*.***
18 -- .**...
19 -- .*...*
20 -- .*..*.
21 -- ..**..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 482 0.160560 0.003769 0.157895 0.163225 2
8 458 0.152565 0.004711 0.149234 0.155896 2
9 449 0.149567 0.006124 0.145237 0.153897 2
10 448 0.149234 0.004711 0.145903 0.152565 2
11 440 0.146569 0.010364 0.139241 0.153897 2
12 438 0.145903 0.008480 0.139907 0.151899 2
13 433 0.144237 0.005182 0.140573 0.147901 2
14 433 0.144237 0.006124 0.139907 0.148568 2
15 432 0.143904 0.003769 0.141239 0.146569 2
16 414 0.137908 0.010364 0.130580 0.145237 2
17 412 0.137242 0.011306 0.129247 0.145237 2
18 407 0.135576 0.005182 0.131912 0.139241 2
19 405 0.134910 0.013662 0.125250 0.144570 2
20 386 0.128581 0.013191 0.119254 0.137908 2
21 383 0.127582 0.019315 0.113924 0.141239 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097159 0.009027 0.000028 0.284177 0.068764 1.000 2
length{all}[2] 0.100111 0.009855 0.000022 0.294007 0.068804 1.000 2
length{all}[3] 0.099562 0.010153 0.000002 0.299348 0.069991 1.000 2
length{all}[4] 0.101145 0.010246 0.000000 0.300932 0.071473 1.000 2
length{all}[5] 0.100002 0.010109 0.000027 0.305127 0.067156 1.000 2
length{all}[6] 0.100444 0.010390 0.000006 0.303123 0.068916 1.000 2
length{all}[7] 0.103961 0.010559 0.000023 0.319701 0.071536 1.002 2
length{all}[8] 0.097656 0.009490 0.000341 0.297638 0.066558 0.998 2
length{all}[9] 0.106750 0.011750 0.000072 0.300470 0.071063 1.001 2
length{all}[10] 0.098834 0.012947 0.000193 0.322036 0.059502 1.001 2
length{all}[11] 0.102852 0.011029 0.000777 0.319705 0.068632 1.001 2
length{all}[12] 0.100898 0.010375 0.000134 0.318569 0.072827 0.999 2
length{all}[13] 0.101720 0.010781 0.000014 0.278913 0.073487 0.998 2
length{all}[14] 0.099465 0.010879 0.000713 0.315206 0.063097 0.998 2
length{all}[15] 0.102053 0.011462 0.000220 0.319163 0.071198 0.999 2
length{all}[16] 0.105847 0.010409 0.000079 0.299069 0.078613 0.999 2
length{all}[17] 0.098384 0.009835 0.000411 0.310457 0.068398 1.001 2
length{all}[18] 0.089013 0.006299 0.000174 0.250787 0.067376 1.002 2
length{all}[19] 0.097074 0.010295 0.000218 0.294528 0.064818 1.007 2
length{all}[20] 0.093104 0.007649 0.000093 0.256339 0.066110 0.999 2
length{all}[21] 0.110802 0.013500 0.000375 0.347357 0.073881 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008417
Maximum standard deviation of split frequencies = 0.019315
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 606
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 202 / 202 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 202 / 202 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.101604 0.039145 0.097172 0.094262 0.089843 0.010884 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -882.248810
Iterating by ming2
Initial: fx= 882.248810
x= 0.10160 0.03914 0.09717 0.09426 0.08984 0.01088 0.30000 1.30000
1 h-m-p 0.0000 0.0001 484.0605 ++ 869.484347 m 0.0001 13 | 1/8
2 h-m-p 0.0014 0.0279 17.3357 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 441.7565 ++ 841.677218 m 0.0001 44 | 2/8
4 h-m-p 0.0044 0.0574 12.8079 ------------.. | 2/8
5 h-m-p 0.0000 0.0003 396.3827 +++ 801.035698 m 0.0003 77 | 3/8
6 h-m-p 0.0160 8.0000 12.5559 -------------.. | 3/8
7 h-m-p 0.0000 0.0000 346.4683 ++ 798.338978 m 0.0000 110 | 4/8
8 h-m-p 0.0160 8.0000 16.6637 -------------.. | 4/8
9 h-m-p 0.0000 0.0000 283.0355 ++ 797.153138 m 0.0000 143 | 5/8
10 h-m-p 0.0160 8.0000 11.6451 -------------.. | 5/8
11 h-m-p 0.0000 0.0000 200.1626 ++ 796.248934 m 0.0000 176 | 6/8
12 h-m-p 0.4296 8.0000 0.0000 Y 796.248934 0 0.0625 187 | 6/8
13 h-m-p 0.1260 8.0000 0.0000 -----C 796.248934 0 0.0000 205
Out..
lnL = -796.248934
206 lfun, 206 eigenQcodon, 1236 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.056431 0.032002 0.047488 0.046203 0.030044 0.058280 0.300041 0.786565 0.537592
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.512757
np = 9
lnL0 = -849.809705
Iterating by ming2
Initial: fx= 849.809705
x= 0.05643 0.03200 0.04749 0.04620 0.03004 0.05828 0.30004 0.78656 0.53759
1 h-m-p 0.0000 0.0002 479.9367 ++ 814.339977 m 0.0002 14 | 1/9
2 h-m-p 0.0000 0.0001 159.9465 ++ 812.365645 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0000 10348.7420 ++ 800.778694 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 2102.1727 ++ 800.014123 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0001 2690.5379 ++ 796.548925 m 0.0001 62 | 5/9
6 h-m-p 0.0000 0.0000 24286.9682 ++ 796.248936 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 796.248936 m 8.0000 86 | 6/9
8 h-m-p 0.3068 8.0000 0.0020 ---------Y 796.248936 0 0.0000 110 | 6/9
9 h-m-p 0.0160 8.0000 0.0000 +++++ 796.248936 m 8.0000 128 | 6/9
10 h-m-p 0.0006 0.3101 4.4376 +++++ 796.248917 m 0.3101 146 | 7/9
11 h-m-p 0.0482 0.2408 6.2954 ------------Y 796.248917 0 0.0000 170 | 7/9
12 h-m-p 0.0842 8.0000 0.0000 --------C 796.248917 0 0.0000 190 | 7/9
13 h-m-p 0.0160 8.0000 0.0000 -C 796.248917 0 0.0010 205
Out..
lnL = -796.248917
206 lfun, 618 eigenQcodon, 2472 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.013383 0.056086 0.039872 0.052974 0.109489 0.093048 1.505793 1.482979 0.448754 0.154706 1.371631
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 7.748881
np = 11
lnL0 = -863.378928
Iterating by ming2
Initial: fx= 863.378928
x= 0.01338 0.05609 0.03987 0.05297 0.10949 0.09305 1.50579 1.48298 0.44875 0.15471 1.37163
1 h-m-p 0.0000 0.0001 417.3913 ++ 849.620406 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0005 262.1699 ++ 824.939364 m 0.0005 30 | 2/11
3 h-m-p 0.0000 0.0000 1341.6556 ++ 815.686520 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0000 343.1963 ++ 815.150946 m 0.0000 58 | 4/11
5 h-m-p 0.0000 0.0028 38.5640 +++ 812.632878 m 0.0028 73 | 5/11
6 h-m-p 0.0000 0.0002 236.4191 ++ 804.815792 m 0.0002 87 | 6/11
7 h-m-p 0.0146 7.3025 11.6049 -------------.. | 6/11
8 h-m-p 0.0000 0.0002 190.9615 +++ 796.248932 m 0.0002 127 | 7/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 796.248932 m 8.0000 141 | 7/11
10 h-m-p 0.0160 8.0000 0.0846 +++++ 796.248923 m 8.0000 162 | 7/11
11 h-m-p 0.3602 8.0000 1.8797 +++ 796.248903 m 8.0000 181 | 7/11
12 h-m-p 1.6000 8.0000 0.4056 ++ 796.248903 m 8.0000 195 | 7/11
13 h-m-p 0.3302 8.0000 9.8269 +++ 796.248892 m 8.0000 214 | 7/11
14 h-m-p 0.3036 1.5180 32.5030 ++ 796.248890 m 1.5180 228 | 7/11
15 h-m-p -0.0000 -0.0000 25.2598
h-m-p: -0.00000000e+00 -0.00000000e+00 2.52597984e+01 796.248890
.. | 7/11
16 h-m-p 0.0160 8.0000 0.0000 +C 796.248890 0 0.0640 254 | 7/11
17 h-m-p 0.2121 8.0000 0.0000 -------C 796.248890 0 0.0000 279
Out..
lnL = -796.248890
280 lfun, 1120 eigenQcodon, 5040 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -796.254114 S = -796.245570 -0.003268
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:02
did 20 / 53 patterns 0:02
did 30 / 53 patterns 0:02
did 40 / 53 patterns 0:02
did 50 / 53 patterns 0:02
did 53 / 53 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.068244 0.050080 0.089674 0.016109 0.046164 0.010920 21.578872 0.294934 1.006106
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 1.675093
np = 9
lnL0 = -849.701421
Iterating by ming2
Initial: fx= 849.701421
x= 0.06824 0.05008 0.08967 0.01611 0.04616 0.01092 21.57887 0.29493 1.00611
1 h-m-p 0.0000 0.0001 445.4766 ++ 837.943832 m 0.0001 14 | 1/9
2 h-m-p 0.0011 0.0287 21.4287 ++YYYCCC 837.829229 5 0.0159 35 | 1/9
3 h-m-p 0.0011 0.0057 54.2638 YYC 837.824358 2 0.0008 49 | 1/9
4 h-m-p 0.1002 0.5009 0.4177 --------------.. | 1/9
5 h-m-p 0.0000 0.0002 408.5555 ++ 811.431503 m 0.0002 93 | 2/9
6 h-m-p 0.0009 0.0047 52.4618 ++ 800.457209 m 0.0047 105 | 3/9
7 h-m-p 0.0000 0.0000 36989.1172 ++ 799.584438 m 0.0000 117 | 4/9
8 h-m-p 0.0001 0.0005 241.4109 ++ 798.919958 m 0.0005 129 | 5/9
9 h-m-p 0.0000 0.0001 1250.6048 ++ 796.248930 m 0.0001 141 | 6/9
10 h-m-p 1.6000 8.0000 0.0004 ---------C 796.248930 0 0.0000 162 | 6/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 796.248930 m 8.0000 180 | 6/9
12 h-m-p 0.0019 0.9386 2.4619 -----------N 796.248930 0 0.0000 206 | 6/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 796.248930 m 8.0000 221 | 6/9
14 h-m-p 0.0160 8.0000 0.0845 +++++ 796.248926 m 8.0000 239 | 6/9
15 h-m-p 0.0536 1.7726 12.6052 -----------Y 796.248926 0 0.0000 265 | 6/9
16 h-m-p 0.0160 8.0000 0.0000 C 796.248926 0 0.0160 277 | 6/9
17 h-m-p 0.1078 8.0000 0.0000 -------------N 796.248926 0 0.0000 305
Out..
lnL = -796.248926
306 lfun, 3366 eigenQcodon, 18360 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.086511 0.033214 0.044222 0.068583 0.052242 0.051681 22.253039 0.900000 0.979158 1.651963 1.300019
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 1.150425
np = 11
lnL0 = -859.898909
Iterating by ming2
Initial: fx= 859.898909
x= 0.08651 0.03321 0.04422 0.06858 0.05224 0.05168 22.25304 0.90000 0.97916 1.65196 1.30002
1 h-m-p 0.0000 0.0002 440.9130 +++ 823.387687 m 0.0002 17 | 1/11
2 h-m-p 0.0002 0.0010 115.5800 ++ 811.629008 m 0.0010 31 | 2/11
3 h-m-p 0.0000 0.0000 69889.5361 ++ 805.678746 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0000 237.8049 ++ 805.463233 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0001 1309.2360 ++ 800.462101 m 0.0001 73 | 5/11
6 h-m-p 0.0000 0.0001 4981.8849 ++ 796.248880 m 0.0001 87 | 6/11
7 h-m-p 1.6000 8.0000 0.0004 ++ 796.248880 m 8.0000 101 | 6/11
8 h-m-p 0.0007 0.1970 4.5968 -----------.. | 6/11
9 h-m-p 0.0160 8.0000 0.0000 +++++ 796.248880 m 8.0000 146 | 6/11
10 h-m-p 0.0135 6.7404 0.0314 +++++ 796.248873 m 6.7404 168 | 7/11
11 h-m-p 0.1917 8.0000 0.6019 +++ 796.248850 m 8.0000 188 | 7/11
12 h-m-p 1.6000 8.0000 0.4713 ++ 796.248847 m 8.0000 206 | 7/11
13 h-m-p 1.3799 8.0000 2.7325 ++ 796.248843 m 8.0000 224 | 7/11
14 h-m-p 1.6000 8.0000 0.2042 ++ 796.248843 m 8.0000 238 | 7/11
15 h-m-p 0.9114 8.0000 1.7924 ----------Y 796.248843 0 0.0000 266 | 7/11
16 h-m-p 0.9270 8.0000 0.0000 -Y 796.248843 0 0.0579 281 | 7/11
17 h-m-p 0.0160 8.0000 0.0000 --Y 796.248843 0 0.0003 301
Out..
lnL = -796.248843
302 lfun, 3624 eigenQcodon, 19932 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -796.244627 S = -796.244184 -0.000194
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:12
did 20 / 53 patterns 0:12
did 30 / 53 patterns 0:13
did 40 / 53 patterns 0:13
did 50 / 53 patterns 0:13
did 53 / 53 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=202
NC_011896_1_WP_010907992_1_921_MLBR_RS04340 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
NC_002677_1_NP_301668_1_540_ctaE VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
NZ_LVXE01000007_1_WP_010907992_1_2547_A3216_RS04130 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
NZ_LYPH01000011_1_WP_010907992_1_369_A8144_RS01760 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
NZ_CP029543_1_WP_010907992_1_939_DIJ64_RS04770 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
NZ_AP014567_1_WP_010907992_1_956_JK2ML_RS04855 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA
**************************************************
NC_011896_1_WP_010907992_1_921_MLBR_RS04340 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
NC_002677_1_NP_301668_1_540_ctaE RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
NZ_LVXE01000007_1_WP_010907992_1_2547_A3216_RS04130 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
NZ_LYPH01000011_1_WP_010907992_1_369_A8144_RS01760 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
NZ_CP029543_1_WP_010907992_1_939_DIJ64_RS04770 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
NZ_AP014567_1_WP_010907992_1_956_JK2ML_RS04855 RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR
**************************************************
NC_011896_1_WP_010907992_1_921_MLBR_RS04340 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
NC_002677_1_NP_301668_1_540_ctaE WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
NZ_LVXE01000007_1_WP_010907992_1_2547_A3216_RS04130 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
NZ_LYPH01000011_1_WP_010907992_1_369_A8144_RS01760 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
NZ_CP029543_1_WP_010907992_1_939_DIJ64_RS04770 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
NZ_AP014567_1_WP_010907992_1_956_JK2ML_RS04855 WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV
**************************************************
NC_011896_1_WP_010907992_1_921_MLBR_RS04340 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
NC_002677_1_NP_301668_1_540_ctaE TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
NZ_LVXE01000007_1_WP_010907992_1_2547_A3216_RS04130 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
NZ_LYPH01000011_1_WP_010907992_1_369_A8144_RS01760 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
NZ_CP029543_1_WP_010907992_1_939_DIJ64_RS04770 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
NZ_AP014567_1_WP_010907992_1_956_JK2ML_RS04855 TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF
**************************************************
NC_011896_1_WP_010907992_1_921_MLBR_RS04340 IR
NC_002677_1_NP_301668_1_540_ctaE IR
NZ_LVXE01000007_1_WP_010907992_1_2547_A3216_RS04130 IR
NZ_LYPH01000011_1_WP_010907992_1_369_A8144_RS01760 IR
NZ_CP029543_1_WP_010907992_1_939_DIJ64_RS04770 IR
NZ_AP014567_1_WP_010907992_1_956_JK2ML_RS04855 IR
**
>NC_011896_1_WP_010907992_1_921_MLBR_RS04340 GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC ATCCGA >NC_002677_1_NP_301668_1_540_ctaE GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC ATCCGA >NZ_LVXE01000007_1_WP_010907992_1_2547_A3216_RS04130 GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC ATCCGA >NZ_LYPH01000011_1_WP_010907992_1_369_A8144_RS01760 GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC ATCCGA >NZ_CP029543_1_WP_010907992_1_939_DIJ64_RS04770 GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC ATCCGA >NZ_AP014567_1_WP_010907992_1_956_JK2ML_RS04855 GTGACGAGCACTGTAGGCACCTTGGGTACTGCAATTACGTCGCGGGTGCA TTCGCTGAATCGGCCCAACATGGTCAGTGTCGGTACCGTAGTCTGGCTTT CCAGTGAGCTGATGTTCTTTGCTGGACTGTTCGCGATGTACTTCACTGCG CGTGCTCAGGCCGGCGGAAAGTGGCCGCCGTCGACCGAACTAAATCTCTA CCAAGCCGTCCCGGTAACGCTGGTGCTCATCGCGTCATCGTTCACCTGCC AAATGGGAGTTTTCTCAGCTGAGCGCGGCGACGTCTTCGGGTTACGCCGC TGGTATGTGATCACCTTATTAATGGGCCTGTTTTTCGTTCTCGGCCAAGG CTACGAATACTACCACTTGATAACTCATGGCACCACCATCCCCAGTAGCG CGTACGGCAGCGTGTTCTATCTGGCCACCGGCTTCCACGGGCTGCACGTC ACTGGTGGCCTGATCGCCTTCATTTTCCTGCTGGCCCGCACCACGATGAG CAAGTTCACACCGGCTCAGGCAACCGCCAGCATCGTCGTCTCCTACTACT GGCATTTCGTTGACATCGTGTGGATCGCTTTGTTCACCGTGATCTATTTC ATCCGA
>NC_011896_1_WP_010907992_1_921_MLBR_RS04340 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF IR >NC_002677_1_NP_301668_1_540_ctaE VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF IR >NZ_LVXE01000007_1_WP_010907992_1_2547_A3216_RS04130 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF IR >NZ_LYPH01000011_1_WP_010907992_1_369_A8144_RS01760 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF IR >NZ_CP029543_1_WP_010907992_1_939_DIJ64_RS04770 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF IR >NZ_AP014567_1_WP_010907992_1_956_JK2ML_RS04855 VTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTA RAQAGGKWPPSTELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRR WYVITLLMGLFFVLGQGYEYYHLITHGTTIPSSAYGSVFYLATGFHGLHV TGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYF IR
#NEXUS
[ID: 8737184131]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907992_1_921_MLBR_RS04340
NC_002677_1_NP_301668_1_540_ctaE
NZ_LVXE01000007_1_WP_010907992_1_2547_A3216_RS04130
NZ_LYPH01000011_1_WP_010907992_1_369_A8144_RS01760
NZ_CP029543_1_WP_010907992_1_939_DIJ64_RS04770
NZ_AP014567_1_WP_010907992_1_956_JK2ML_RS04855
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907992_1_921_MLBR_RS04340,
2 NC_002677_1_NP_301668_1_540_ctaE,
3 NZ_LVXE01000007_1_WP_010907992_1_2547_A3216_RS04130,
4 NZ_LYPH01000011_1_WP_010907992_1_369_A8144_RS01760,
5 NZ_CP029543_1_WP_010907992_1_939_DIJ64_RS04770,
6 NZ_AP014567_1_WP_010907992_1_956_JK2ML_RS04855
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06876396,2:0.06880397,3:0.06999119,4:0.07147275,5:0.06715597,6:0.06891622);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06876396,2:0.06880397,3:0.06999119,4:0.07147275,5:0.06715597,6:0.06891622);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -831.37 -834.58
2 -831.34 -834.55
--------------------------------------
TOTAL -831.36 -834.56
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/ctaE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894737 0.090907 0.359434 1.486877 0.855089 1501.00 1501.00 1.000
r(A<->C){all} 0.158784 0.018702 0.000017 0.432122 0.119919 186.93 199.78 1.002
r(A<->G){all} 0.169091 0.020599 0.000178 0.459985 0.131237 264.74 314.22 1.001
r(A<->T){all} 0.167864 0.020464 0.000078 0.452147 0.133045 235.69 246.44 1.009
r(C<->G){all} 0.179966 0.021489 0.000342 0.471465 0.147842 191.44 221.03 1.006
r(C<->T){all} 0.161659 0.019631 0.000100 0.446266 0.121258 175.92 308.65 1.000
r(G<->T){all} 0.162636 0.018678 0.000022 0.434377 0.129714 231.27 281.26 1.000
pi(A){all} 0.177473 0.000240 0.147874 0.206943 0.177257 1254.08 1305.53 1.001
pi(C){all} 0.300475 0.000339 0.263032 0.335370 0.300134 1150.57 1325.79 1.000
pi(G){all} 0.262467 0.000315 0.231193 0.300797 0.262454 1380.54 1440.77 1.000
pi(T){all} 0.259586 0.000322 0.224438 0.294559 0.259494 1311.53 1357.10 1.000
alpha{1,2} 0.411282 0.228454 0.000279 1.374108 0.241753 1092.03 1180.43 1.001
alpha{3} 0.466446 0.244042 0.000121 1.511736 0.308377 1080.01 1280.04 1.000
pinvar{all} 0.997431 0.000010 0.991718 0.999997 0.998400 1169.14 1232.47 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/ctaE/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 202
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 15 15 15 15 15 15 | TCC 2 2 2 2 2 2 | TAC 8 8 8 8 8 8 | TGC 1 1 1 1 1 1
Leu TTA 3 3 3 3 3 3 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 3 3 3 3 3 3 | Arg CGT 1 1 1 1 1 1
CTC 3 3 3 3 3 3 | CCC 2 2 2 2 2 2 | CAC 3 3 3 3 3 3 | CGC 4 4 4 4 4 4
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 3 3 3 3 3 3 | CGA 1 1 1 1 1 1
CTG 10 10 10 10 10 10 | CCG 4 4 4 4 4 4 | CAG 2 2 2 2 2 2 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 5 5 5 5 5 5 | Asn AAT 2 2 2 2 2 2 | Ser AGT 3 3 3 3 3 3
ATC 9 9 9 9 9 9 | ACC 11 11 11 11 11 11 | AAC 1 1 1 1 1 1 | AGC 5 5 5 5 5 5
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 6 6 6 6 6 6 | ACG 4 4 4 4 4 4 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 5 5 5 5 5 5 | Asp GAT 0 0 0 0 0 0 | Gly GGT 3 3 3 3 3 3
GTC 8 8 8 8 8 8 | GCC 6 6 6 6 6 6 | GAC 2 2 2 2 2 2 | GGC 10 10 10 10 10 10
GTA 3 3 3 3 3 3 | GCA 2 2 2 2 2 2 | Glu GAA 2 2 2 2 2 2 | GGA 3 3 3 3 3 3
GTG 7 7 7 7 7 7 | GCG 4 4 4 4 4 4 | GAG 2 2 2 2 2 2 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907992_1_921_MLBR_RS04340
position 1: T:0.23762 C:0.19802 A:0.25743 G:0.30693
position 2: T:0.38119 C:0.25743 A:0.16337 G:0.19802
position 3: T:0.16337 C:0.44554 A:0.10891 G:0.28218
Average T:0.26073 C:0.30033 A:0.17657 G:0.26238
#2: NC_002677_1_NP_301668_1_540_ctaE
position 1: T:0.23762 C:0.19802 A:0.25743 G:0.30693
position 2: T:0.38119 C:0.25743 A:0.16337 G:0.19802
position 3: T:0.16337 C:0.44554 A:0.10891 G:0.28218
Average T:0.26073 C:0.30033 A:0.17657 G:0.26238
#3: NZ_LVXE01000007_1_WP_010907992_1_2547_A3216_RS04130
position 1: T:0.23762 C:0.19802 A:0.25743 G:0.30693
position 2: T:0.38119 C:0.25743 A:0.16337 G:0.19802
position 3: T:0.16337 C:0.44554 A:0.10891 G:0.28218
Average T:0.26073 C:0.30033 A:0.17657 G:0.26238
#4: NZ_LYPH01000011_1_WP_010907992_1_369_A8144_RS01760
position 1: T:0.23762 C:0.19802 A:0.25743 G:0.30693
position 2: T:0.38119 C:0.25743 A:0.16337 G:0.19802
position 3: T:0.16337 C:0.44554 A:0.10891 G:0.28218
Average T:0.26073 C:0.30033 A:0.17657 G:0.26238
#5: NZ_CP029543_1_WP_010907992_1_939_DIJ64_RS04770
position 1: T:0.23762 C:0.19802 A:0.25743 G:0.30693
position 2: T:0.38119 C:0.25743 A:0.16337 G:0.19802
position 3: T:0.16337 C:0.44554 A:0.10891 G:0.28218
Average T:0.26073 C:0.30033 A:0.17657 G:0.26238
#6: NZ_AP014567_1_WP_010907992_1_956_JK2ML_RS04855
position 1: T:0.23762 C:0.19802 A:0.25743 G:0.30693
position 2: T:0.38119 C:0.25743 A:0.16337 G:0.19802
position 3: T:0.16337 C:0.44554 A:0.10891 G:0.28218
Average T:0.26073 C:0.30033 A:0.17657 G:0.26238
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 18 | Cys C TGT 0
TTC 90 | TCC 12 | TAC 48 | TGC 6
Leu L TTA 18 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 24 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 18 | Arg R CGT 6
CTC 18 | CCC 12 | CAC 18 | CGC 24
CTA 6 | CCA 0 | Gln Q CAA 18 | CGA 6
CTG 60 | CCG 24 | CAG 12 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 30 | Asn N AAT 12 | Ser S AGT 18
ATC 54 | ACC 66 | AAC 6 | AGC 30
ATA 6 | ACA 6 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 36 | ACG 24 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 30 | Asp D GAT 0 | Gly G GGT 18
GTC 48 | GCC 36 | GAC 12 | GGC 60
GTA 18 | GCA 12 | Glu E GAA 12 | GGA 18
GTG 42 | GCG 24 | GAG 12 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.23762 C:0.19802 A:0.25743 G:0.30693
position 2: T:0.38119 C:0.25743 A:0.16337 G:0.19802
position 3: T:0.16337 C:0.44554 A:0.10891 G:0.28218
Average T:0.26073 C:0.30033 A:0.17657 G:0.26238
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -796.248934 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300041 1.300019
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907992_1_921_MLBR_RS04340: 0.000004, NC_002677_1_NP_301668_1_540_ctaE: 0.000004, NZ_LVXE01000007_1_WP_010907992_1_2547_A3216_RS04130: 0.000004, NZ_LYPH01000011_1_WP_010907992_1_369_A8144_RS01760: 0.000004, NZ_CP029543_1_WP_010907992_1_939_DIJ64_RS04770: 0.000004, NZ_AP014567_1_WP_010907992_1_956_JK2ML_RS04855: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30004
omega (dN/dS) = 1.30002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 483.5 122.5 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 483.5 122.5 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 483.5 122.5 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 483.5 122.5 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 483.5 122.5 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 483.5 122.5 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -796.248917 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.505793 0.000010 0.022830
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907992_1_921_MLBR_RS04340: 0.000004, NC_002677_1_NP_301668_1_540_ctaE: 0.000004, NZ_LVXE01000007_1_WP_010907992_1_2547_A3216_RS04130: 0.000004, NZ_LYPH01000011_1_WP_010907992_1_369_A8144_RS01760: 0.000004, NZ_CP029543_1_WP_010907992_1_939_DIJ64_RS04770: 0.000004, NZ_AP014567_1_WP_010907992_1_956_JK2ML_RS04855: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.50579
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.02283 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 470.3 135.7 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 470.3 135.7 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 470.3 135.7 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 470.3 135.7 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 470.3 135.7 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 470.3 135.7 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -796.248890 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 21.578872 0.000000 1.000000 0.000001 97.959032
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907992_1_921_MLBR_RS04340: 0.000004, NC_002677_1_NP_301668_1_540_ctaE: 0.000004, NZ_LVXE01000007_1_WP_010907992_1_2547_A3216_RS04130: 0.000004, NZ_LYPH01000011_1_WP_010907992_1_369_A8144_RS01760: 0.000004, NZ_CP029543_1_WP_010907992_1_939_DIJ64_RS04770: 0.000004, NZ_AP014567_1_WP_010907992_1_956_JK2ML_RS04855: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 21.57887
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 1.00000 0.00000
w: 0.00000 1.00000 97.95903
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 449.2 156.8 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 449.2 156.8 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 449.2 156.8 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 449.2 156.8 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 449.2 156.8 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 449.2 156.8 1.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907992_1_921_MLBR_RS04340)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -796.248926 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 22.253039 0.360211 0.480138
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907992_1_921_MLBR_RS04340: 0.000004, NC_002677_1_NP_301668_1_540_ctaE: 0.000004, NZ_LVXE01000007_1_WP_010907992_1_2547_A3216_RS04130: 0.000004, NZ_LYPH01000011_1_WP_010907992_1_369_A8144_RS01760: 0.000004, NZ_CP029543_1_WP_010907992_1_939_DIJ64_RS04770: 0.000004, NZ_AP014567_1_WP_010907992_1_956_JK2ML_RS04855: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 22.25304
Parameters in M7 (beta):
p = 0.36021 q = 0.48014
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00070 0.01478 0.05996 0.14717 0.27850 0.44500 0.62675 0.79628 0.92515 0.99218
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 449.1 156.9 0.4286 0.0000 0.0000 0.0 0.0
7..2 0.000 449.1 156.9 0.4286 0.0000 0.0000 0.0 0.0
7..3 0.000 449.1 156.9 0.4286 0.0000 0.0000 0.0 0.0
7..4 0.000 449.1 156.9 0.4286 0.0000 0.0000 0.0 0.0
7..5 0.000 449.1 156.9 0.4286 0.0000 0.0000 0.0 0.0
7..6 0.000 449.1 156.9 0.4286 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -796.248843 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 22.703350 0.000010 3.328212 0.787717 33.650421
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907992_1_921_MLBR_RS04340: 0.000004, NC_002677_1_NP_301668_1_540_ctaE: 0.000004, NZ_LVXE01000007_1_WP_010907992_1_2547_A3216_RS04130: 0.000004, NZ_LYPH01000011_1_WP_010907992_1_369_A8144_RS01760: 0.000004, NZ_CP029543_1_WP_010907992_1_939_DIJ64_RS04770: 0.000004, NZ_AP014567_1_WP_010907992_1_956_JK2ML_RS04855: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 22.70335
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 3.32821 q = 0.78772
(p1 = 0.99999) w = 33.65042
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.45177 0.61905 0.71394 0.78240 0.83619 0.88026 0.91711 0.94808 0.97375 0.99366 33.65042
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 449.0 157.0 33.6501 0.0000 0.0000 0.0 0.0
7..2 0.000 449.0 157.0 33.6501 0.0000 0.0000 0.0 0.0
7..3 0.000 449.0 157.0 33.6501 0.0000 0.0000 0.0 0.0
7..4 0.000 449.0 157.0 33.6501 0.0000 0.0000 0.0 0.0
7..5 0.000 449.0 157.0 33.6501 0.0000 0.0000 0.0 0.0
7..6 0.000 449.0 157.0 33.6501 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907992_1_921_MLBR_RS04340)
Pr(w>1) post mean +- SE for w
1 V 1.000** 33.650
2 T 1.000** 33.650
3 S 1.000** 33.650
4 T 1.000** 33.650
5 V 1.000** 33.650
6 G 1.000** 33.650
7 T 1.000** 33.650
8 L 1.000** 33.650
9 G 1.000** 33.650
10 T 1.000** 33.650
11 A 1.000** 33.650
12 I 1.000** 33.650
13 T 1.000** 33.650
14 S 1.000** 33.650
15 R 1.000** 33.650
16 V 1.000** 33.650
17 H 1.000** 33.650
18 S 1.000** 33.650
19 L 1.000** 33.650
20 N 1.000** 33.650
21 R 1.000** 33.650
22 P 1.000** 33.650
23 N 1.000** 33.650
24 M 1.000** 33.650
25 V 1.000** 33.650
26 S 1.000** 33.650
27 V 1.000** 33.650
28 G 1.000** 33.650
29 T 1.000** 33.650
30 V 1.000** 33.650
31 V 1.000** 33.650
32 W 1.000** 33.650
33 L 1.000** 33.650
34 S 1.000** 33.650
35 S 1.000** 33.650
36 E 1.000** 33.650
37 L 1.000** 33.650
38 M 1.000** 33.650
39 F 1.000** 33.650
40 F 1.000** 33.650
41 A 1.000** 33.650
42 G 1.000** 33.650
43 L 1.000** 33.650
44 F 1.000** 33.650
45 A 1.000** 33.650
46 M 1.000** 33.650
47 Y 1.000** 33.650
48 F 1.000** 33.650
49 T 1.000** 33.650
50 A 1.000** 33.650
51 R 1.000** 33.650
52 A 1.000** 33.650
53 Q 1.000** 33.650
54 A 1.000** 33.650
55 G 1.000** 33.650
56 G 1.000** 33.650
57 K 1.000** 33.650
58 W 1.000** 33.650
59 P 1.000** 33.650
60 P 1.000** 33.650
61 S 1.000** 33.650
62 T 1.000** 33.650
63 E 1.000** 33.650
64 L 1.000** 33.650
65 N 1.000** 33.650
66 L 1.000** 33.650
67 Y 1.000** 33.650
68 Q 1.000** 33.650
69 A 1.000** 33.650
70 V 1.000** 33.650
71 P 1.000** 33.650
72 V 1.000** 33.650
73 T 1.000** 33.650
74 L 1.000** 33.650
75 V 1.000** 33.650
76 L 1.000** 33.650
77 I 1.000** 33.650
78 A 1.000** 33.650
79 S 1.000** 33.650
80 S 1.000** 33.650
81 F 1.000** 33.650
82 T 1.000** 33.650
83 C 1.000** 33.650
84 Q 1.000** 33.650
85 M 1.000** 33.650
86 G 1.000** 33.650
87 V 1.000** 33.650
88 F 1.000** 33.650
89 S 1.000** 33.650
90 A 1.000** 33.650
91 E 1.000** 33.650
92 R 1.000** 33.650
93 G 1.000** 33.650
94 D 1.000** 33.650
95 V 1.000** 33.650
96 F 1.000** 33.650
97 G 1.000** 33.650
98 L 1.000** 33.650
99 R 1.000** 33.650
100 R 1.000** 33.650
101 W 1.000** 33.650
102 Y 1.000** 33.650
103 V 1.000** 33.650
104 I 1.000** 33.650
105 T 1.000** 33.650
106 L 1.000** 33.650
107 L 1.000** 33.650
108 M 1.000** 33.650
109 G 1.000** 33.650
110 L 1.000** 33.650
111 F 1.000** 33.650
112 F 1.000** 33.650
113 V 1.000** 33.650
114 L 1.000** 33.650
115 G 1.000** 33.650
116 Q 1.000** 33.650
117 G 1.000** 33.650
118 Y 1.000** 33.650
119 E 1.000** 33.650
120 Y 1.000** 33.650
121 Y 1.000** 33.650
122 H 1.000** 33.650
123 L 1.000** 33.650
124 I 1.000** 33.650
125 T 1.000** 33.650
126 H 1.000** 33.650
127 G 1.000** 33.650
128 T 1.000** 33.650
129 T 1.000** 33.650
130 I 1.000** 33.650
131 P 1.000** 33.650
132 S 1.000** 33.650
133 S 1.000** 33.650
134 A 1.000** 33.650
135 Y 1.000** 33.650
136 G 1.000** 33.650
137 S 1.000** 33.650
138 V 1.000** 33.650
139 F 1.000** 33.650
140 Y 1.000** 33.650
141 L 1.000** 33.650
142 A 1.000** 33.650
143 T 1.000** 33.650
144 G 1.000** 33.650
145 F 1.000** 33.650
146 H 1.000** 33.650
147 G 1.000** 33.650
148 L 1.000** 33.650
149 H 1.000** 33.650
150 V 1.000** 33.650
151 T 1.000** 33.650
152 G 1.000** 33.650
153 G 1.000** 33.650
154 L 1.000** 33.650
155 I 1.000** 33.650
156 A 1.000** 33.650
157 F 1.000** 33.650
158 I 1.000** 33.650
159 F 1.000** 33.650
160 L 1.000** 33.650
161 L 1.000** 33.650
162 A 1.000** 33.650
163 R 1.000** 33.650
164 T 1.000** 33.650
165 T 1.000** 33.650
166 M 1.000** 33.650
167 S 1.000** 33.650
168 K 1.000** 33.650
169 F 1.000** 33.650
170 T 1.000** 33.650
171 P 1.000** 33.650
172 A 1.000** 33.650
173 Q 1.000** 33.650
174 A 1.000** 33.650
175 T 1.000** 33.650
176 A 1.000** 33.650
177 S 1.000** 33.650
178 I 1.000** 33.650
179 V 1.000** 33.650
180 V 1.000** 33.650
181 S 1.000** 33.650
182 Y 1.000** 33.650
183 Y 1.000** 33.650
184 W 1.000** 33.650
185 H 1.000** 33.650
186 F 1.000** 33.650
187 V 1.000** 33.650
188 D 1.000** 33.650
189 I 1.000** 33.650
190 V 1.000** 33.650
191 W 1.000** 33.650
192 I 1.000** 33.650
193 A 1.000** 33.650
194 L 1.000** 33.650
195 F 1.000** 33.650
196 T 1.000** 33.650
197 V 1.000** 33.650
198 I 1.000** 33.650
199 Y 1.000** 33.650
200 F 1.000** 33.650
201 I 1.000** 33.650
202 R 1.000** 33.650
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907992_1_921_MLBR_RS04340)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -796.248917 Model 2: PositiveSelection -796.24889 Model 0: one-ratio -796.248934 Model 7: beta -796.248926 Model 8: beta&w>1 -796.248843 Model 0 vs 1 3.399999991415825E-5 Model 2 vs 1 5.400000009103678E-5 Model 8 vs 7 1.6600000003563764E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
