--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 10:22:30 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/1res/deoD/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1082.31 -1085.70 2 -1082.35 -1084.97 -------------------------------------- TOTAL -1082.33 -1085.40 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.895768 0.088666 0.384468 1.514126 0.851679 1501.00 1501.00 1.000 r(A<->C){all} 0.159037 0.019516 0.000026 0.439721 0.119704 217.64 257.81 1.001 r(A<->G){all} 0.168038 0.019223 0.000119 0.442640 0.131999 263.01 275.90 1.000 r(A<->T){all} 0.160925 0.018683 0.000007 0.441953 0.126776 194.20 240.25 1.009 r(C<->G){all} 0.173394 0.020280 0.000298 0.455375 0.138724 201.59 237.74 1.012 r(C<->T){all} 0.169690 0.019807 0.000023 0.457279 0.130953 197.83 257.80 1.000 r(G<->T){all} 0.168916 0.020677 0.000155 0.466121 0.130777 142.33 200.77 1.000 pi(A){all} 0.175859 0.000181 0.150252 0.202568 0.175906 1140.16 1320.58 1.000 pi(C){all} 0.324158 0.000270 0.290580 0.354524 0.323899 1169.50 1253.81 1.000 pi(G){all} 0.319426 0.000270 0.286415 0.350550 0.319400 1161.04 1331.02 1.000 pi(T){all} 0.180556 0.000180 0.155942 0.207413 0.179934 1063.66 1206.28 1.000 alpha{1,2} 0.425547 0.219989 0.000160 1.363022 0.271998 1043.27 1123.88 1.000 alpha{3} 0.454365 0.245710 0.000158 1.434273 0.296466 1194.51 1209.57 1.000 pinvar{all} 0.998123 0.000005 0.993807 0.999999 0.998878 1042.04 1178.70 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1042.73939 Model 2: PositiveSelection -1042.7394 Model 0: one-ratio -1042.739403 Model 7: beta -1042.73939 Model 8: beta&w>1 -1042.73939 Model 0 vs 1 2.6000000161729986E-5 Model 2 vs 1 1.9999999949504854E-5 Model 8 vs 7 0.0
>C1 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG TASANRIGSLLADIIARF >C2 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG TASANRIGSLLADIIARF >C3 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG TASANRIGSLLADIIARF >C4 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG TASANRIGSLLADIIARF >C5 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG TASANRIGSLLADIIARF >C6 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG TASANRIGSLLADIIARF CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=268 C1 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA C2 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA C3 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA C4 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA C5 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA C6 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA ************************************************** C1 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV C2 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV C3 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV C4 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV C5 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV C6 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV ************************************************** C1 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG C2 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG C3 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG C4 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG C5 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG C6 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG ************************************************** C1 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML C2 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML C3 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML C4 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML C5 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML C6 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML ************************************************** C1 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG C2 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG C3 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG C4 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG C5 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG C6 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG ************************************************** C1 TASANRIGSLLADIIARF C2 TASANRIGSLLADIIARF C3 TASANRIGSLLADIIARF C4 TASANRIGSLLADIIARF C5 TASANRIGSLLADIIARF C6 TASANRIGSLLADIIARF ****************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8040] Library Relaxation: Multi_proc [96] Relaxation Summary: [8040]--->[8040] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.498 Mb, Max= 30.824 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA C2 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA C3 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA C4 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA C5 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA C6 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA ************************************************** C1 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV C2 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV C3 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV C4 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV C5 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV C6 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV ************************************************** C1 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG C2 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG C3 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG C4 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG C5 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG C6 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG ************************************************** C1 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML C2 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML C3 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML C4 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML C5 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML C6 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML ************************************************** C1 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG C2 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG C3 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG C4 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG C5 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG C6 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG ************************************************** C1 TASANRIGSLLADIIARF C2 TASANRIGSLLADIIARF C3 TASANRIGSLLADIIARF C4 TASANRIGSLLADIIARF C5 TASANRIGSLLADIIARF C6 TASANRIGSLLADIIARF ****************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA C2 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA C3 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA C4 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA C5 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA C6 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA ************************************************** C1 GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC C2 GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC C3 GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC C4 GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC C5 GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC C6 GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC ************************************************** C1 TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC C2 TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC C3 TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC C4 TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC C5 TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC C6 TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC ************************************************** C1 GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG C2 GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG C3 GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG C4 GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG C5 GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG C6 GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG ************************************************** C1 GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG C2 GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG C3 GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG C4 GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG C5 GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG C6 GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG ************************************************** C1 TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC C2 TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC C3 TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC C4 TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC C5 TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC C6 TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC ************************************************** C1 GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT C2 GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT C3 GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT C4 GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT C5 GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT C6 GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT ************************************************** C1 CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG C2 CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG C3 CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG C4 CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG C5 CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG C6 CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG ************************************************** C1 TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC C2 TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC C3 TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC C4 TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC C5 TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC C6 TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC ************************************************** C1 ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT C2 ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT C3 ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT C4 ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT C5 ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT C6 ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT ************************************************** C1 CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC C2 CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC C3 CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC C4 CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC C5 CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC C6 CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC ************************************************** C1 CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG C2 CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG C3 CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG C4 CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG C5 CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG C6 CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG ************************************************** C1 GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG C2 GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG C3 GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG C4 GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG C5 GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG C6 GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG ************************************************** C1 GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG C2 GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG C3 GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG C4 GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG C5 GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG C6 GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG ************************************************** C1 CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG C2 CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG C3 CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG C4 CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG C5 CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG C6 CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG ************************************************** C1 ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG C2 ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG C3 ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG C4 ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG C5 ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG C6 ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG ************************************************** C1 GTTT C2 GTTT C3 GTTT C4 GTTT C5 GTTT C6 GTTT **** >C1 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG GTTT >C2 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG GTTT >C3 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG GTTT >C4 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG GTTT >C5 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG GTTT >C6 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG GTTT >C1 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG TASANRIGSLLADIIARF >C2 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG TASANRIGSLLADIIARF >C3 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG TASANRIGSLLADIIARF >C4 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG TASANRIGSLLADIIARF >C5 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG TASANRIGSLLADIIARF >C6 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG TASANRIGSLLADIIARF MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 804 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579774873 Setting output file names to "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 629664896 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9599876829 Seed = 1467342201 Swapseed = 1579774873 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1799.390545 -- -24.965149 Chain 2 -- -1799.390545 -- -24.965149 Chain 3 -- -1799.390442 -- -24.965149 Chain 4 -- -1799.390545 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1799.390545 -- -24.965149 Chain 2 -- -1799.390545 -- -24.965149 Chain 3 -- -1799.390545 -- -24.965149 Chain 4 -- -1799.390545 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1799.391] (-1799.391) (-1799.390) (-1799.391) * [-1799.391] (-1799.391) (-1799.391) (-1799.391) 500 -- [-1100.492] (-1090.199) (-1130.698) (-1091.722) * [-1096.269] (-1104.959) (-1107.543) (-1108.236) -- 0:00:00 1000 -- (-1090.037) [-1093.253] (-1102.388) (-1088.136) * [-1090.649] (-1097.901) (-1098.998) (-1102.779) -- 0:00:00 1500 -- (-1091.570) [-1090.632] (-1096.474) (-1091.816) * (-1085.927) (-1087.721) (-1093.998) [-1099.767] -- 0:00:00 2000 -- [-1089.277] (-1093.144) (-1092.888) (-1092.996) * [-1095.201] (-1098.769) (-1091.145) (-1098.690) -- 0:00:00 2500 -- (-1098.577) (-1094.131) (-1088.821) [-1089.006] * [-1093.080] (-1091.365) (-1094.780) (-1094.936) -- 0:00:00 3000 -- (-1090.319) [-1095.741] (-1091.775) (-1091.820) * [-1088.681] (-1093.829) (-1089.896) (-1089.656) -- 0:00:00 3500 -- (-1095.809) [-1089.737] (-1092.205) (-1089.632) * (-1095.362) [-1093.702] (-1088.224) (-1093.286) -- 0:00:00 4000 -- (-1089.488) (-1094.051) (-1090.653) [-1089.213] * (-1090.791) [-1086.389] (-1091.719) (-1092.347) -- 0:00:00 4500 -- (-1090.774) [-1090.798] (-1086.795) (-1089.713) * (-1092.248) (-1089.238) (-1089.610) [-1090.678] -- 0:00:00 5000 -- [-1094.894] (-1092.111) (-1093.628) (-1086.305) * (-1089.796) [-1093.783] (-1091.553) (-1092.479) -- 0:00:00 Average standard deviation of split frequencies: 0.092852 5500 -- (-1098.703) [-1091.723] (-1086.167) (-1089.015) * [-1096.200] (-1092.995) (-1087.515) (-1091.342) -- 0:00:00 6000 -- (-1094.639) (-1088.743) [-1093.183] (-1097.212) * [-1091.309] (-1088.928) (-1092.354) (-1092.889) -- 0:00:00 6500 -- (-1089.873) [-1091.369] (-1098.427) (-1092.834) * (-1094.906) (-1089.813) [-1094.306] (-1085.984) -- 0:00:00 7000 -- (-1091.638) [-1094.179] (-1092.222) (-1089.800) * (-1091.005) [-1092.004] (-1088.806) (-1094.154) -- 0:00:00 7500 -- [-1090.520] (-1094.891) (-1097.129) (-1091.219) * (-1091.684) [-1089.384] (-1091.904) (-1097.567) -- 0:00:00 8000 -- [-1095.960] (-1091.826) (-1100.953) (-1090.039) * (-1094.780) (-1087.440) [-1089.029] (-1102.791) -- 0:00:00 8500 -- (-1088.444) (-1095.451) (-1090.379) [-1085.103] * (-1093.317) (-1100.422) [-1087.810] (-1102.075) -- 0:00:00 9000 -- (-1100.761) (-1098.259) (-1098.549) [-1084.872] * [-1097.292] (-1088.790) (-1093.649) (-1092.152) -- 0:00:00 9500 -- (-1093.541) [-1091.370] (-1097.183) (-1083.457) * (-1107.133) [-1093.340] (-1093.028) (-1093.104) -- 0:00:00 10000 -- (-1087.215) (-1094.208) (-1094.207) [-1083.736] * [-1089.431] (-1093.126) (-1096.054) (-1093.601) -- 0:00:00 Average standard deviation of split frequencies: 0.072318 10500 -- (-1090.505) (-1090.658) [-1092.881] (-1083.321) * (-1094.182) [-1087.781] (-1093.534) (-1095.330) -- 0:00:00 11000 -- [-1092.335] (-1088.305) (-1088.208) (-1082.103) * (-1091.683) (-1090.055) [-1091.116] (-1092.667) -- 0:00:00 11500 -- [-1093.175] (-1091.461) (-1097.838) (-1083.778) * (-1098.830) (-1095.013) [-1087.813] (-1093.592) -- 0:00:00 12000 -- (-1092.604) (-1090.644) [-1088.898] (-1086.759) * (-1093.691) (-1088.459) (-1097.084) [-1088.272] -- 0:00:00 12500 -- (-1088.685) (-1090.458) (-1090.906) [-1084.494] * [-1092.034] (-1091.915) (-1102.565) (-1094.075) -- 0:00:00 13000 -- (-1099.255) (-1105.266) (-1091.318) [-1086.169] * (-1094.123) [-1091.832] (-1094.844) (-1094.378) -- 0:00:00 13500 -- (-1089.476) (-1103.831) (-1094.189) [-1084.693] * (-1089.700) (-1088.783) [-1088.082] (-1099.014) -- 0:00:00 14000 -- (-1092.815) (-1092.551) (-1095.543) [-1083.124] * (-1095.393) (-1092.279) (-1086.279) [-1097.864] -- 0:00:00 14500 -- [-1089.759] (-1098.099) (-1099.601) (-1082.682) * [-1092.471] (-1091.984) (-1092.805) (-1087.904) -- 0:01:07 15000 -- (-1089.795) [-1092.378] (-1083.330) (-1081.922) * (-1097.699) [-1086.303] (-1092.097) (-1090.416) -- 0:01:05 Average standard deviation of split frequencies: 0.078076 15500 -- (-1088.467) (-1101.126) [-1085.887] (-1082.402) * (-1099.445) (-1095.493) [-1089.643] (-1091.640) -- 0:01:03 16000 -- (-1093.335) (-1096.069) (-1083.831) [-1082.529] * (-1087.716) (-1096.864) (-1097.609) [-1096.728] -- 0:01:01 16500 -- (-1086.495) (-1087.584) [-1083.829] (-1083.063) * (-1092.304) [-1091.270] (-1096.297) (-1102.133) -- 0:00:59 17000 -- (-1092.245) [-1090.155] (-1083.342) (-1081.740) * (-1088.303) (-1106.483) (-1100.450) [-1087.903] -- 0:00:57 17500 -- (-1089.143) (-1092.638) (-1084.332) [-1083.707] * (-1094.231) (-1096.110) (-1088.832) [-1087.674] -- 0:00:56 18000 -- [-1089.839] (-1090.587) (-1088.431) (-1082.913) * (-1098.376) (-1096.157) (-1091.526) [-1087.237] -- 0:00:54 18500 -- (-1102.304) (-1102.232) [-1083.290] (-1082.705) * (-1095.012) (-1095.326) (-1103.430) [-1087.400] -- 0:00:53 19000 -- (-1101.308) (-1093.555) [-1082.815] (-1082.250) * (-1093.015) [-1087.637] (-1094.368) (-1090.578) -- 0:00:51 19500 -- (-1081.506) [-1090.114] (-1083.589) (-1081.805) * (-1098.149) (-1096.663) [-1088.921] (-1096.590) -- 0:00:50 20000 -- (-1085.765) [-1093.053] (-1083.639) (-1085.294) * (-1089.675) (-1092.474) [-1088.220] (-1090.215) -- 0:00:49 Average standard deviation of split frequencies: 0.051322 20500 -- [-1084.925] (-1091.731) (-1084.785) (-1084.784) * (-1096.420) (-1092.765) [-1091.566] (-1086.408) -- 0:00:47 21000 -- (-1085.591) [-1086.923] (-1084.660) (-1087.890) * (-1089.385) (-1099.866) (-1100.379) [-1091.233] -- 0:00:46 21500 -- [-1083.297] (-1093.768) (-1085.879) (-1082.110) * (-1095.259) (-1097.975) (-1093.758) [-1090.029] -- 0:00:45 22000 -- (-1083.171) (-1092.696) (-1082.965) [-1082.100] * (-1098.865) (-1086.071) (-1098.714) [-1095.061] -- 0:00:44 22500 -- (-1085.632) (-1090.152) [-1082.187] (-1086.983) * (-1089.943) (-1087.993) (-1098.566) [-1089.217] -- 0:00:43 23000 -- (-1083.928) (-1094.632) [-1083.358] (-1082.821) * [-1087.637] (-1092.991) (-1090.688) (-1092.219) -- 0:00:42 23500 -- [-1081.546] (-1091.072) (-1084.944) (-1082.016) * [-1096.471] (-1095.208) (-1091.420) (-1093.204) -- 0:00:41 24000 -- [-1081.270] (-1093.380) (-1082.616) (-1082.696) * (-1094.690) (-1094.282) (-1093.354) [-1086.874] -- 0:00:40 24500 -- [-1086.400] (-1106.081) (-1082.270) (-1087.670) * (-1090.496) (-1096.363) (-1088.419) [-1086.142] -- 0:00:39 25000 -- (-1084.147) (-1091.374) (-1083.260) [-1084.703] * (-1087.381) (-1097.848) [-1102.663] (-1088.565) -- 0:00:39 Average standard deviation of split frequencies: 0.042306 25500 -- (-1082.129) (-1086.218) [-1082.194] (-1084.920) * (-1089.774) [-1085.789] (-1087.112) (-1088.648) -- 0:00:38 26000 -- [-1082.380] (-1089.307) (-1082.195) (-1092.720) * [-1089.740] (-1083.849) (-1087.008) (-1090.650) -- 0:00:37 26500 -- [-1085.830] (-1101.808) (-1086.437) (-1087.170) * (-1095.160) (-1082.175) (-1092.186) [-1094.670] -- 0:00:36 27000 -- (-1085.872) [-1096.105] (-1086.197) (-1081.052) * [-1091.991] (-1086.842) (-1094.630) (-1099.513) -- 0:00:36 27500 -- (-1083.248) (-1099.669) (-1087.962) [-1081.730] * [-1090.324] (-1084.462) (-1086.120) (-1088.578) -- 0:00:35 28000 -- [-1084.758] (-1083.189) (-1088.056) (-1084.433) * (-1092.939) (-1082.025) [-1091.052] (-1094.225) -- 0:00:34 28500 -- (-1082.589) (-1087.325) (-1086.235) [-1083.512] * [-1093.507] (-1081.684) (-1093.189) (-1098.451) -- 0:00:34 29000 -- (-1082.483) (-1086.593) [-1084.411] (-1083.139) * [-1089.369] (-1081.315) (-1099.116) (-1090.111) -- 0:00:33 29500 -- [-1082.382] (-1082.445) (-1086.537) (-1084.033) * (-1090.623) (-1082.781) (-1101.494) [-1091.993] -- 0:00:32 30000 -- [-1080.840] (-1085.576) (-1088.448) (-1081.699) * (-1093.242) (-1081.777) (-1090.008) [-1085.129] -- 0:00:32 Average standard deviation of split frequencies: 0.041724 30500 -- (-1081.212) (-1084.388) [-1083.704] (-1085.914) * (-1091.848) [-1081.777] (-1089.665) (-1094.230) -- 0:01:03 31000 -- [-1082.142] (-1083.637) (-1087.732) (-1083.762) * (-1090.582) (-1081.368) (-1098.466) [-1089.592] -- 0:01:02 31500 -- [-1085.043] (-1081.182) (-1082.716) (-1087.895) * (-1086.851) (-1084.298) (-1089.629) [-1093.056] -- 0:01:01 32000 -- (-1083.800) [-1083.180] (-1085.216) (-1081.819) * (-1088.588) (-1081.544) [-1092.317] (-1097.073) -- 0:01:00 32500 -- (-1082.661) [-1081.498] (-1085.011) (-1084.337) * (-1101.215) [-1083.363] (-1088.330) (-1095.975) -- 0:00:59 33000 -- (-1082.284) [-1081.407] (-1083.527) (-1085.500) * [-1085.647] (-1081.384) (-1095.548) (-1093.865) -- 0:00:58 33500 -- [-1087.012] (-1083.208) (-1088.318) (-1082.643) * (-1094.156) [-1082.549] (-1098.232) (-1094.416) -- 0:00:57 34000 -- (-1084.548) (-1084.659) (-1081.621) [-1081.947] * (-1087.768) [-1082.318] (-1091.956) (-1094.881) -- 0:00:56 34500 -- (-1087.739) (-1083.698) [-1082.532] (-1082.935) * [-1097.674] (-1082.952) (-1093.263) (-1103.908) -- 0:00:55 35000 -- (-1084.038) (-1081.411) [-1082.404] (-1083.853) * (-1098.696) (-1082.113) [-1093.884] (-1094.227) -- 0:00:55 Average standard deviation of split frequencies: 0.035542 35500 -- (-1089.034) (-1083.156) [-1083.041] (-1084.085) * (-1092.765) [-1083.237] (-1091.807) (-1096.043) -- 0:00:54 36000 -- (-1085.946) [-1083.184] (-1084.254) (-1083.227) * (-1095.703) [-1084.329] (-1086.321) (-1096.227) -- 0:00:53 36500 -- [-1083.335] (-1087.862) (-1089.577) (-1083.078) * (-1094.480) (-1083.962) (-1096.281) [-1092.026] -- 0:00:52 37000 -- (-1085.506) [-1085.785] (-1083.406) (-1083.121) * (-1099.161) (-1085.876) (-1093.384) [-1088.679] -- 0:00:52 37500 -- (-1084.622) (-1082.104) (-1083.158) [-1081.964] * (-1096.742) [-1084.383] (-1100.944) (-1093.561) -- 0:00:51 38000 -- (-1082.435) (-1081.189) (-1081.795) [-1083.097] * (-1095.228) (-1083.892) (-1091.397) [-1093.289] -- 0:00:50 38500 -- (-1083.079) (-1080.895) (-1083.062) [-1081.489] * (-1092.078) (-1082.108) (-1092.623) [-1092.037] -- 0:00:49 39000 -- (-1086.110) (-1081.315) (-1087.312) [-1081.229] * [-1091.526] (-1083.201) (-1098.215) (-1096.431) -- 0:00:49 39500 -- (-1082.952) [-1082.509] (-1085.920) (-1081.514) * (-1090.531) (-1082.058) (-1088.143) [-1091.401] -- 0:00:48 40000 -- (-1082.848) (-1082.615) [-1085.952] (-1083.895) * [-1089.882] (-1082.278) (-1091.714) (-1091.136) -- 0:00:48 Average standard deviation of split frequencies: 0.031115 40500 -- [-1082.485] (-1081.592) (-1082.063) (-1086.773) * (-1092.028) (-1084.704) (-1086.404) [-1094.210] -- 0:00:47 41000 -- (-1080.969) [-1082.911] (-1082.685) (-1087.163) * (-1095.210) (-1081.347) [-1091.700] (-1088.829) -- 0:00:46 41500 -- (-1082.406) (-1083.999) [-1082.590] (-1085.289) * (-1100.261) [-1083.684] (-1087.742) (-1094.280) -- 0:00:46 42000 -- (-1082.270) (-1082.053) [-1085.693] (-1082.701) * (-1092.937) (-1084.230) (-1090.169) [-1091.442] -- 0:00:45 42500 -- (-1082.231) (-1082.624) [-1085.780] (-1083.269) * (-1086.456) [-1082.561] (-1092.419) (-1090.445) -- 0:00:45 43000 -- (-1086.904) [-1084.892] (-1086.397) (-1083.265) * (-1092.630) (-1082.896) (-1098.942) [-1087.665] -- 0:00:44 43500 -- (-1081.890) (-1084.727) [-1082.858] (-1084.821) * (-1086.567) [-1081.776] (-1096.544) (-1094.074) -- 0:00:43 44000 -- (-1081.487) (-1081.458) (-1082.618) [-1082.914] * (-1103.378) (-1083.764) (-1089.849) [-1089.616] -- 0:00:43 44500 -- (-1082.719) [-1082.578] (-1082.556) (-1083.171) * (-1087.956) (-1087.768) [-1092.719] (-1089.774) -- 0:00:42 45000 -- (-1081.080) (-1084.451) (-1082.086) [-1082.759] * (-1094.782) [-1082.433] (-1094.320) (-1094.215) -- 0:00:42 Average standard deviation of split frequencies: 0.021521 45500 -- (-1083.979) (-1084.685) (-1083.128) [-1081.459] * [-1094.186] (-1081.800) (-1093.628) (-1095.539) -- 0:00:41 46000 -- (-1086.466) (-1084.415) [-1082.994] (-1081.263) * (-1088.693) [-1081.800] (-1092.149) (-1086.489) -- 0:00:41 46500 -- (-1087.937) (-1081.359) (-1082.463) [-1081.196] * (-1090.969) (-1083.257) [-1089.457] (-1087.224) -- 0:00:41 47000 -- [-1087.509] (-1082.305) (-1081.744) (-1084.677) * (-1099.529) (-1086.024) (-1091.295) [-1092.761] -- 0:01:00 47500 -- (-1083.732) (-1083.239) [-1082.016] (-1082.997) * [-1091.152] (-1086.087) (-1094.146) (-1091.766) -- 0:01:00 48000 -- [-1084.095] (-1082.931) (-1081.835) (-1085.651) * (-1092.267) [-1082.603] (-1096.663) (-1089.216) -- 0:00:59 48500 -- (-1082.933) (-1083.326) [-1082.678] (-1084.519) * (-1102.927) [-1083.990] (-1090.661) (-1092.280) -- 0:00:58 49000 -- [-1082.930] (-1082.642) (-1082.034) (-1085.963) * (-1091.891) [-1084.142] (-1096.176) (-1091.671) -- 0:00:58 49500 -- (-1081.308) [-1081.655] (-1082.694) (-1084.472) * [-1090.649] (-1084.489) (-1085.942) (-1092.121) -- 0:00:57 50000 -- (-1082.555) (-1084.477) [-1084.363] (-1083.541) * [-1090.206] (-1082.770) (-1082.417) (-1088.785) -- 0:00:57 Average standard deviation of split frequencies: 0.020567 50500 -- (-1082.630) (-1083.476) [-1083.617] (-1082.113) * (-1093.322) (-1081.910) [-1088.740] (-1087.436) -- 0:00:56 51000 -- (-1084.392) [-1080.980] (-1082.287) (-1082.030) * (-1099.542) (-1082.589) (-1082.947) [-1091.914] -- 0:00:55 51500 -- (-1084.793) (-1083.251) [-1082.226] (-1083.209) * [-1088.480] (-1083.340) (-1084.509) (-1087.490) -- 0:00:55 52000 -- (-1082.888) (-1086.140) (-1084.740) [-1082.957] * (-1091.887) (-1084.410) [-1082.090] (-1083.789) -- 0:00:54 52500 -- (-1083.090) (-1086.117) [-1084.527] (-1084.397) * (-1106.421) (-1084.025) [-1081.762] (-1083.148) -- 0:00:54 53000 -- (-1085.030) (-1085.187) (-1083.356) [-1084.363] * (-1102.936) (-1083.163) (-1082.616) [-1082.085] -- 0:00:53 53500 -- [-1082.235] (-1087.676) (-1084.866) (-1084.397) * (-1106.288) [-1082.702] (-1083.952) (-1081.480) -- 0:00:53 54000 -- [-1083.032] (-1083.063) (-1084.021) (-1081.678) * [-1102.088] (-1081.465) (-1087.457) (-1084.097) -- 0:00:52 54500 -- (-1083.099) [-1082.547] (-1084.386) (-1082.645) * (-1091.293) [-1081.361] (-1087.377) (-1085.965) -- 0:00:52 55000 -- (-1082.327) (-1081.655) [-1083.194] (-1082.619) * (-1091.106) [-1083.174] (-1085.850) (-1091.227) -- 0:00:51 Average standard deviation of split frequencies: 0.021513 55500 -- (-1083.211) (-1081.475) [-1082.915] (-1081.454) * (-1096.649) (-1084.851) [-1089.475] (-1083.485) -- 0:00:51 56000 -- (-1084.599) [-1081.348] (-1083.640) (-1082.027) * (-1090.393) (-1088.478) [-1084.922] (-1083.673) -- 0:00:50 56500 -- (-1085.820) [-1082.309] (-1082.606) (-1081.551) * (-1100.801) (-1084.163) (-1087.123) [-1082.335] -- 0:00:50 57000 -- [-1083.802] (-1082.424) (-1082.501) (-1085.753) * (-1098.032) (-1086.692) (-1084.264) [-1083.275] -- 0:00:49 57500 -- (-1088.795) [-1083.613] (-1083.789) (-1082.082) * (-1094.605) (-1087.443) (-1084.263) [-1087.967] -- 0:00:49 58000 -- (-1082.069) (-1084.942) (-1083.216) [-1081.789] * (-1096.860) [-1087.105] (-1081.946) (-1089.435) -- 0:00:48 58500 -- (-1082.468) (-1083.563) [-1084.698] (-1082.913) * (-1100.080) [-1086.674] (-1081.200) (-1089.737) -- 0:00:48 59000 -- [-1081.017] (-1081.025) (-1081.959) (-1083.198) * (-1103.415) [-1084.272] (-1082.064) (-1082.950) -- 0:00:47 59500 -- (-1081.023) (-1082.526) [-1081.967] (-1083.233) * [-1090.710] (-1082.481) (-1082.302) (-1089.453) -- 0:00:47 60000 -- [-1081.220] (-1080.951) (-1082.349) (-1083.084) * (-1090.742) (-1082.726) (-1081.995) [-1088.925] -- 0:00:47 Average standard deviation of split frequencies: 0.022493 60500 -- (-1087.187) (-1081.468) (-1083.161) [-1081.233] * (-1100.306) (-1082.378) [-1081.840] (-1086.600) -- 0:00:46 61000 -- (-1083.096) (-1085.063) [-1081.976] (-1082.200) * (-1089.125) (-1081.472) [-1081.412] (-1082.336) -- 0:00:46 61500 -- (-1081.071) [-1084.135] (-1081.324) (-1082.022) * (-1097.095) (-1081.975) (-1083.772) [-1083.466] -- 0:00:45 62000 -- [-1084.181] (-1083.355) (-1082.114) (-1083.904) * [-1094.048] (-1081.891) (-1081.688) (-1084.159) -- 0:00:45 62500 -- [-1081.445] (-1084.356) (-1082.949) (-1084.765) * (-1100.775) (-1081.412) (-1082.424) [-1083.335] -- 0:00:45 63000 -- (-1082.151) (-1085.066) [-1082.158] (-1085.192) * (-1086.809) (-1081.412) [-1080.977] (-1081.477) -- 0:00:59 63500 -- (-1080.798) (-1082.373) [-1082.827] (-1083.713) * (-1089.918) (-1082.849) (-1084.248) [-1086.894] -- 0:00:58 64000 -- [-1081.537] (-1082.757) (-1083.410) (-1083.489) * [-1089.899] (-1084.683) (-1088.292) (-1084.274) -- 0:00:58 64500 -- (-1083.971) (-1082.254) [-1084.117] (-1083.348) * (-1085.474) (-1082.878) [-1083.510] (-1083.683) -- 0:00:58 65000 -- [-1081.031] (-1086.814) (-1082.195) (-1082.051) * (-1093.904) (-1081.562) [-1082.960] (-1085.583) -- 0:00:57 Average standard deviation of split frequencies: 0.021427 65500 -- [-1082.691] (-1083.286) (-1085.536) (-1082.716) * (-1093.283) [-1081.541] (-1082.213) (-1088.531) -- 0:00:57 66000 -- (-1085.675) (-1083.534) (-1085.571) [-1082.506] * (-1091.653) [-1080.950] (-1082.485) (-1086.276) -- 0:00:56 66500 -- (-1084.734) (-1082.101) [-1085.201] (-1082.986) * (-1088.087) [-1084.028] (-1083.115) (-1085.333) -- 0:00:56 67000 -- (-1085.770) [-1083.355] (-1082.815) (-1084.294) * (-1093.552) (-1083.092) [-1082.553] (-1085.956) -- 0:00:55 67500 -- (-1083.619) (-1083.087) (-1084.458) [-1083.711] * (-1094.173) (-1082.784) (-1082.259) [-1082.111] -- 0:00:55 68000 -- [-1082.290] (-1082.964) (-1089.236) (-1082.161) * (-1089.500) [-1083.378] (-1082.202) (-1081.956) -- 0:00:54 68500 -- (-1082.412) (-1082.455) (-1083.637) [-1085.422] * [-1090.194] (-1082.435) (-1083.575) (-1082.480) -- 0:00:54 69000 -- [-1083.143] (-1083.159) (-1083.464) (-1085.755) * (-1091.012) (-1082.380) (-1082.847) [-1081.998] -- 0:00:53 69500 -- [-1084.417] (-1081.915) (-1082.094) (-1083.851) * [-1089.833] (-1083.574) (-1082.353) (-1081.825) -- 0:00:53 70000 -- (-1082.500) (-1081.858) (-1082.501) [-1084.285] * (-1097.376) (-1084.288) [-1083.595] (-1086.276) -- 0:00:53 Average standard deviation of split frequencies: 0.020715 70500 -- (-1082.021) (-1081.957) (-1082.771) [-1084.286] * (-1089.502) (-1085.119) (-1081.684) [-1083.459] -- 0:00:52 71000 -- [-1081.423] (-1081.774) (-1081.902) (-1081.368) * [-1089.593] (-1082.708) (-1081.976) (-1085.217) -- 0:00:52 71500 -- (-1081.376) (-1082.213) [-1083.553] (-1081.299) * (-1093.061) (-1081.955) (-1081.894) [-1083.879] -- 0:00:51 72000 -- (-1081.578) (-1085.783) (-1082.210) [-1080.761] * (-1092.906) [-1081.755] (-1083.424) (-1082.236) -- 0:00:51 72500 -- (-1081.332) [-1080.948] (-1083.408) (-1083.705) * (-1097.071) (-1085.677) (-1082.237) [-1082.095] -- 0:00:51 73000 -- (-1081.365) (-1080.959) [-1083.779] (-1082.288) * (-1097.075) (-1082.113) (-1082.664) [-1081.568] -- 0:00:50 73500 -- [-1080.946] (-1083.060) (-1082.092) (-1082.066) * (-1098.907) (-1083.006) (-1081.555) [-1083.360] -- 0:00:50 74000 -- (-1081.111) (-1082.555) (-1082.063) [-1083.801] * [-1089.438] (-1081.145) (-1081.442) (-1083.298) -- 0:00:50 74500 -- [-1082.077] (-1081.703) (-1081.953) (-1083.204) * [-1091.258] (-1083.849) (-1082.253) (-1081.860) -- 0:00:49 75000 -- (-1083.263) (-1085.304) (-1082.228) [-1082.944] * (-1089.647) [-1082.115] (-1082.259) (-1085.181) -- 0:00:49 Average standard deviation of split frequencies: 0.020432 75500 -- (-1083.152) (-1083.296) [-1081.299] (-1081.838) * (-1089.916) (-1081.897) (-1083.895) [-1082.396] -- 0:00:48 76000 -- [-1081.876] (-1081.925) (-1083.085) (-1085.336) * (-1092.964) [-1084.135] (-1081.734) (-1080.885) -- 0:00:48 76500 -- (-1082.503) [-1085.721] (-1081.754) (-1085.635) * (-1093.884) [-1081.595] (-1082.974) (-1081.743) -- 0:00:48 77000 -- (-1084.957) (-1083.783) (-1082.057) [-1083.833] * (-1090.446) [-1081.507] (-1082.937) (-1082.826) -- 0:00:47 77500 -- (-1085.209) (-1082.630) (-1084.135) [-1082.294] * (-1106.072) [-1082.439] (-1083.379) (-1082.592) -- 0:00:47 78000 -- (-1083.838) (-1082.690) (-1090.275) [-1082.330] * (-1095.065) (-1081.482) (-1084.961) [-1081.197] -- 0:00:47 78500 -- (-1088.068) (-1083.005) [-1081.374] (-1084.563) * [-1098.493] (-1081.564) (-1085.570) (-1081.467) -- 0:00:46 79000 -- (-1084.215) (-1083.528) [-1082.583] (-1081.955) * (-1096.830) (-1082.136) [-1080.932] (-1080.910) -- 0:00:46 79500 -- (-1083.801) (-1083.598) [-1084.006] (-1083.340) * (-1097.448) (-1082.861) (-1080.826) [-1080.715] -- 0:00:57 80000 -- [-1081.288] (-1084.068) (-1083.043) (-1082.438) * [-1087.849] (-1083.188) (-1086.946) (-1088.276) -- 0:00:57 Average standard deviation of split frequencies: 0.022726 80500 -- (-1081.422) [-1083.529] (-1083.425) (-1083.730) * (-1095.986) (-1084.856) (-1082.432) [-1082.833] -- 0:00:57 81000 -- (-1084.098) (-1090.251) [-1081.900] (-1082.914) * [-1086.374] (-1081.502) (-1081.688) (-1082.311) -- 0:00:56 81500 -- (-1084.241) [-1082.251] (-1081.848) (-1081.991) * (-1088.122) [-1081.057] (-1081.585) (-1083.777) -- 0:00:56 82000 -- (-1081.925) [-1085.350] (-1083.328) (-1085.082) * (-1094.188) (-1084.051) (-1082.576) [-1082.904] -- 0:00:55 82500 -- (-1084.304) (-1087.188) (-1083.912) [-1084.381] * (-1091.117) (-1083.906) [-1081.176] (-1081.360) -- 0:00:55 83000 -- (-1082.061) [-1083.050] (-1083.035) (-1085.250) * [-1089.538] (-1083.326) (-1084.358) (-1084.432) -- 0:00:55 83500 -- (-1083.027) [-1083.834] (-1081.808) (-1081.196) * (-1091.919) (-1084.131) [-1083.448] (-1082.061) -- 0:00:54 84000 -- (-1084.691) (-1081.938) [-1082.233] (-1082.002) * (-1082.292) [-1085.500] (-1081.256) (-1084.113) -- 0:00:54 84500 -- (-1082.066) [-1084.708] (-1083.513) (-1081.628) * (-1083.572) [-1085.095] (-1081.634) (-1083.787) -- 0:00:54 85000 -- (-1081.746) (-1085.036) [-1085.386] (-1081.999) * (-1082.505) (-1086.588) (-1084.891) [-1082.319] -- 0:00:53 Average standard deviation of split frequencies: 0.019838 85500 -- (-1081.641) (-1083.003) (-1081.906) [-1082.233] * [-1084.249] (-1085.456) (-1082.570) (-1084.044) -- 0:00:53 86000 -- (-1081.837) (-1082.946) (-1081.196) [-1082.078] * (-1082.887) (-1083.135) [-1080.830] (-1084.273) -- 0:00:53 86500 -- (-1081.524) (-1083.056) [-1081.133] (-1083.415) * (-1081.804) (-1082.087) (-1084.128) [-1083.584] -- 0:00:52 87000 -- (-1081.751) (-1082.160) (-1082.687) [-1083.742] * (-1082.952) (-1083.291) (-1081.856) [-1081.819] -- 0:00:52 87500 -- [-1083.089] (-1083.105) (-1084.805) (-1081.509) * (-1085.470) (-1082.475) [-1081.486] (-1082.325) -- 0:00:52 88000 -- (-1081.407) (-1086.278) [-1085.013] (-1080.891) * (-1084.060) [-1082.571] (-1081.702) (-1082.180) -- 0:00:51 88500 -- [-1086.101] (-1085.644) (-1082.918) (-1081.555) * [-1081.181] (-1081.388) (-1083.468) (-1080.990) -- 0:00:51 89000 -- [-1082.796] (-1084.114) (-1083.253) (-1081.552) * [-1084.030] (-1081.140) (-1085.678) (-1081.384) -- 0:00:51 89500 -- (-1082.468) (-1085.437) (-1083.784) [-1082.555] * (-1083.727) (-1083.878) [-1082.451] (-1083.038) -- 0:00:50 90000 -- [-1083.199] (-1082.165) (-1083.815) (-1082.752) * [-1084.671] (-1084.158) (-1084.201) (-1082.047) -- 0:00:50 Average standard deviation of split frequencies: 0.020524 90500 -- (-1084.273) (-1082.374) [-1083.758] (-1083.916) * (-1082.993) [-1086.930] (-1081.882) (-1086.464) -- 0:00:50 91000 -- (-1084.089) [-1085.669] (-1081.322) (-1086.250) * [-1082.251] (-1086.859) (-1084.594) (-1087.304) -- 0:00:49 91500 -- (-1083.633) (-1084.664) [-1083.750] (-1086.549) * (-1082.559) [-1084.786] (-1083.255) (-1086.746) -- 0:00:49 92000 -- [-1082.519] (-1084.442) (-1082.354) (-1082.187) * (-1085.789) (-1082.632) (-1086.335) [-1086.182] -- 0:00:49 92500 -- (-1082.141) [-1081.632] (-1091.075) (-1082.900) * (-1083.602) (-1084.679) [-1083.147] (-1081.649) -- 0:00:49 93000 -- (-1082.881) [-1081.740] (-1089.174) (-1083.758) * [-1081.838] (-1084.272) (-1081.981) (-1081.709) -- 0:00:48 93500 -- [-1083.921] (-1081.729) (-1085.880) (-1085.485) * (-1083.269) [-1084.101] (-1084.181) (-1082.448) -- 0:00:48 94000 -- (-1087.028) [-1082.219] (-1083.926) (-1087.065) * (-1081.299) (-1083.719) (-1084.182) [-1084.203] -- 0:00:48 94500 -- (-1084.159) (-1090.770) (-1083.515) [-1085.819] * (-1082.346) (-1082.336) (-1081.864) [-1081.306] -- 0:00:47 95000 -- (-1082.279) (-1085.217) (-1085.258) [-1081.322] * (-1082.961) (-1082.062) [-1081.549] (-1085.143) -- 0:00:47 Average standard deviation of split frequencies: 0.022097 95500 -- (-1081.590) (-1082.771) [-1086.175] (-1082.862) * (-1083.395) [-1083.034] (-1081.726) (-1085.012) -- 0:00:56 96000 -- (-1083.604) (-1083.372) (-1082.921) [-1083.989] * (-1085.525) [-1088.854] (-1081.385) (-1084.766) -- 0:00:56 96500 -- (-1082.511) [-1084.019] (-1083.706) (-1083.510) * (-1083.234) (-1082.807) [-1083.314] (-1086.664) -- 0:00:56 97000 -- (-1086.021) [-1082.593] (-1082.873) (-1083.254) * (-1081.503) (-1083.096) [-1080.864] (-1083.169) -- 0:00:55 97500 -- (-1083.460) [-1083.737] (-1082.158) (-1084.763) * (-1081.906) (-1081.596) [-1082.503] (-1083.954) -- 0:00:55 98000 -- (-1082.648) [-1084.037] (-1082.328) (-1085.122) * (-1082.921) (-1084.241) [-1084.465] (-1084.564) -- 0:00:55 98500 -- [-1082.022] (-1086.100) (-1083.976) (-1086.188) * (-1082.554) (-1087.238) (-1081.942) [-1082.680] -- 0:00:54 99000 -- (-1082.123) [-1083.543] (-1082.908) (-1086.660) * (-1082.490) (-1081.879) (-1082.003) [-1082.582] -- 0:00:54 99500 -- (-1082.354) [-1084.103] (-1081.608) (-1085.800) * (-1082.934) (-1082.478) [-1082.414] (-1082.458) -- 0:00:54 100000 -- [-1083.151] (-1082.924) (-1081.564) (-1084.454) * (-1088.165) (-1082.503) [-1080.880] (-1083.083) -- 0:00:54 Average standard deviation of split frequencies: 0.019224 100500 -- (-1082.779) (-1083.719) [-1081.543] (-1083.093) * [-1086.691] (-1087.653) (-1082.762) (-1083.702) -- 0:00:53 101000 -- (-1082.532) (-1083.516) (-1082.220) [-1083.128] * [-1084.050] (-1082.427) (-1081.332) (-1083.305) -- 0:00:53 101500 -- (-1083.367) [-1082.053] (-1083.201) (-1083.826) * (-1084.056) (-1085.037) [-1081.248] (-1083.965) -- 0:00:53 102000 -- [-1081.433] (-1083.100) (-1085.309) (-1082.273) * (-1084.292) (-1084.652) [-1081.282] (-1086.471) -- 0:00:52 102500 -- (-1081.423) [-1084.520] (-1085.552) (-1080.833) * [-1084.164] (-1085.275) (-1081.429) (-1083.527) -- 0:00:52 103000 -- (-1084.812) [-1085.344] (-1082.864) (-1081.685) * (-1084.455) (-1086.312) [-1081.990] (-1083.197) -- 0:00:52 103500 -- (-1084.339) [-1084.123] (-1083.896) (-1081.912) * (-1083.117) (-1083.335) [-1085.018] (-1083.362) -- 0:00:51 104000 -- (-1083.420) (-1083.727) [-1086.303] (-1082.060) * (-1083.849) (-1083.431) (-1084.905) [-1082.980] -- 0:00:51 104500 -- (-1083.478) [-1084.465] (-1085.664) (-1083.374) * (-1082.370) (-1085.353) [-1082.840] (-1083.731) -- 0:00:51 105000 -- (-1085.241) (-1084.153) [-1084.180] (-1082.720) * (-1088.081) (-1087.485) (-1083.167) [-1083.202] -- 0:00:51 Average standard deviation of split frequencies: 0.017321 105500 -- (-1082.292) [-1083.198] (-1083.226) (-1081.658) * (-1084.588) (-1084.755) (-1085.256) [-1082.362] -- 0:00:50 106000 -- (-1083.496) [-1083.904] (-1085.733) (-1081.301) * (-1088.867) (-1085.142) [-1082.384] (-1085.495) -- 0:00:50 106500 -- (-1085.997) (-1088.716) (-1083.419) [-1081.322] * (-1085.236) (-1085.100) [-1082.166] (-1087.197) -- 0:00:50 107000 -- (-1083.551) (-1082.029) (-1083.255) [-1081.269] * [-1083.479] (-1085.736) (-1086.098) (-1084.907) -- 0:00:50 107500 -- (-1084.804) (-1081.828) (-1092.846) [-1083.142] * (-1083.622) [-1087.740] (-1082.892) (-1084.320) -- 0:00:49 108000 -- [-1085.505] (-1082.915) (-1082.321) (-1081.823) * (-1086.404) [-1087.744] (-1084.372) (-1084.967) -- 0:00:49 108500 -- (-1081.844) (-1082.461) [-1082.101] (-1083.274) * (-1084.827) (-1086.285) [-1086.782] (-1085.901) -- 0:00:49 109000 -- [-1081.757] (-1084.073) (-1082.032) (-1082.643) * (-1081.397) (-1083.624) (-1087.707) [-1084.754] -- 0:00:49 109500 -- [-1082.091] (-1083.870) (-1087.032) (-1082.792) * (-1081.873) (-1086.020) [-1085.088] (-1084.716) -- 0:00:48 110000 -- (-1081.845) (-1083.142) (-1085.622) [-1081.563] * (-1086.693) [-1083.293] (-1084.912) (-1081.121) -- 0:00:48 Average standard deviation of split frequencies: 0.019056 110500 -- (-1080.840) (-1082.085) (-1084.834) [-1082.938] * (-1083.312) [-1082.760] (-1082.106) (-1082.555) -- 0:00:48 111000 -- [-1083.702] (-1083.022) (-1083.031) (-1082.219) * (-1082.314) [-1082.609] (-1085.898) (-1083.361) -- 0:00:48 111500 -- (-1085.217) [-1082.381] (-1084.396) (-1087.631) * (-1084.996) (-1083.075) (-1085.937) [-1082.264] -- 0:00:55 112000 -- (-1085.221) (-1083.481) (-1084.972) [-1082.874] * (-1088.428) (-1083.421) (-1086.733) [-1083.062] -- 0:00:55 112500 -- (-1082.722) (-1084.816) (-1087.227) [-1083.782] * [-1084.912] (-1082.718) (-1085.228) (-1086.224) -- 0:00:55 113000 -- (-1081.346) (-1084.633) [-1083.330] (-1085.076) * (-1081.724) (-1083.027) (-1084.314) [-1082.089] -- 0:00:54 113500 -- (-1081.038) (-1083.276) (-1085.816) [-1084.807] * (-1083.119) (-1083.836) [-1082.854] (-1081.722) -- 0:00:54 114000 -- (-1080.747) [-1084.725] (-1083.694) (-1084.459) * (-1084.720) (-1084.136) (-1082.956) [-1084.803] -- 0:00:54 114500 -- (-1081.286) (-1084.890) [-1082.935] (-1085.019) * (-1087.677) (-1084.068) (-1083.040) [-1085.996] -- 0:00:54 115000 -- [-1082.288] (-1083.998) (-1084.967) (-1083.216) * (-1087.003) (-1082.584) [-1083.210] (-1088.587) -- 0:00:53 Average standard deviation of split frequencies: 0.022244 115500 -- [-1083.653] (-1085.210) (-1089.408) (-1088.112) * (-1082.831) (-1082.997) [-1081.253] (-1086.166) -- 0:00:53 116000 -- (-1083.447) (-1083.678) (-1090.841) [-1082.497] * (-1082.273) (-1085.293) [-1081.516] (-1082.453) -- 0:00:53 116500 -- (-1086.922) [-1082.622] (-1083.110) (-1085.571) * (-1082.291) (-1082.523) [-1082.420] (-1082.508) -- 0:00:53 117000 -- (-1086.377) (-1085.626) [-1088.427] (-1083.013) * (-1083.502) [-1082.446] (-1082.885) (-1082.302) -- 0:00:52 117500 -- (-1083.045) (-1082.095) (-1083.738) [-1081.592] * (-1084.275) [-1081.186] (-1083.344) (-1083.224) -- 0:00:52 118000 -- [-1085.113] (-1084.754) (-1084.758) (-1083.867) * (-1081.484) (-1082.321) [-1083.541] (-1081.974) -- 0:00:52 118500 -- (-1085.986) (-1085.166) (-1084.083) [-1083.583] * [-1081.350] (-1081.189) (-1084.891) (-1086.448) -- 0:00:52 119000 -- (-1080.616) (-1085.467) [-1083.339] (-1083.458) * [-1081.353] (-1082.100) (-1085.070) (-1084.822) -- 0:00:51 119500 -- (-1082.462) [-1083.985] (-1084.116) (-1086.735) * (-1085.953) [-1084.274] (-1084.778) (-1086.234) -- 0:00:51 120000 -- (-1081.003) (-1082.797) (-1086.712) [-1082.570] * [-1082.281] (-1080.879) (-1083.812) (-1085.106) -- 0:00:51 Average standard deviation of split frequencies: 0.021384 120500 -- [-1082.356] (-1083.156) (-1086.291) (-1085.297) * [-1083.132] (-1081.965) (-1083.382) (-1083.963) -- 0:00:51 121000 -- (-1084.315) [-1082.783] (-1085.573) (-1087.210) * (-1082.430) (-1084.136) [-1084.366] (-1082.431) -- 0:00:50 121500 -- (-1085.524) (-1083.327) [-1083.358] (-1082.790) * [-1082.353] (-1082.802) (-1085.612) (-1083.666) -- 0:00:50 122000 -- [-1082.394] (-1082.098) (-1091.447) (-1083.113) * (-1081.549) (-1090.134) [-1081.889] (-1084.239) -- 0:00:50 122500 -- (-1082.558) (-1081.411) [-1081.046] (-1085.587) * [-1082.290] (-1084.648) (-1082.048) (-1082.494) -- 0:00:50 123000 -- [-1083.653] (-1082.003) (-1083.520) (-1083.811) * (-1084.500) (-1085.261) [-1080.955] (-1082.740) -- 0:00:49 123500 -- [-1083.912] (-1082.725) (-1083.223) (-1086.162) * (-1083.673) [-1082.071] (-1085.831) (-1082.926) -- 0:00:49 124000 -- (-1085.056) [-1081.610] (-1085.511) (-1085.234) * [-1082.986] (-1083.529) (-1088.119) (-1081.566) -- 0:00:49 124500 -- [-1084.049] (-1081.328) (-1083.169) (-1087.301) * (-1084.160) (-1083.674) [-1081.513] (-1088.095) -- 0:00:49 125000 -- (-1082.878) [-1081.697] (-1081.310) (-1086.498) * (-1082.903) (-1084.945) (-1082.454) [-1083.125] -- 0:00:49 Average standard deviation of split frequencies: 0.021513 125500 -- (-1084.755) (-1083.813) (-1083.624) [-1083.178] * [-1085.538] (-1084.329) (-1081.586) (-1089.163) -- 0:00:48 126000 -- [-1080.953] (-1083.437) (-1082.783) (-1081.286) * [-1081.493] (-1084.296) (-1081.931) (-1095.149) -- 0:00:48 126500 -- (-1082.171) (-1083.631) (-1083.046) [-1081.258] * (-1083.081) (-1085.029) [-1084.068] (-1086.721) -- 0:00:48 127000 -- [-1083.520] (-1081.490) (-1082.546) (-1081.366) * [-1081.919] (-1082.507) (-1082.929) (-1085.540) -- 0:00:48 127500 -- (-1084.891) (-1081.283) [-1082.640] (-1082.224) * (-1081.108) (-1083.648) (-1084.043) [-1082.675] -- 0:00:54 128000 -- (-1083.358) (-1081.704) (-1082.136) [-1082.894] * (-1083.376) (-1083.253) (-1083.278) [-1083.198] -- 0:00:54 128500 -- [-1082.484] (-1081.409) (-1084.399) (-1083.029) * [-1084.358] (-1082.399) (-1082.938) (-1089.589) -- 0:00:54 129000 -- (-1082.014) [-1081.162] (-1082.971) (-1088.013) * (-1081.865) (-1084.701) [-1082.098] (-1082.177) -- 0:00:54 129500 -- (-1081.033) (-1083.371) (-1085.463) [-1083.399] * (-1085.903) [-1083.949] (-1084.583) (-1082.339) -- 0:00:53 130000 -- [-1082.559] (-1081.619) (-1082.445) (-1082.001) * (-1081.747) (-1084.056) [-1082.450] (-1082.213) -- 0:00:53 Average standard deviation of split frequencies: 0.019041 130500 -- [-1083.295] (-1083.335) (-1083.826) (-1082.236) * (-1088.767) (-1084.495) [-1082.008] (-1084.004) -- 0:00:53 131000 -- (-1082.096) [-1081.847] (-1084.923) (-1081.830) * [-1084.741] (-1086.612) (-1081.130) (-1084.729) -- 0:00:53 131500 -- (-1082.056) (-1083.141) (-1084.892) [-1082.418] * (-1084.525) (-1083.848) (-1081.498) [-1081.907] -- 0:00:52 132000 -- (-1088.154) [-1082.357] (-1083.025) (-1081.328) * (-1085.409) [-1084.077] (-1086.459) (-1082.075) -- 0:00:52 132500 -- (-1083.219) (-1083.177) [-1082.412] (-1081.665) * [-1081.803] (-1084.489) (-1081.537) (-1084.364) -- 0:00:52 133000 -- (-1081.826) [-1083.370] (-1083.120) (-1081.233) * (-1082.026) (-1084.656) (-1082.325) [-1082.451] -- 0:00:52 133500 -- [-1087.833] (-1084.865) (-1084.123) (-1081.557) * (-1081.081) (-1085.213) (-1083.162) [-1083.420] -- 0:00:51 134000 -- [-1081.319] (-1083.787) (-1082.227) (-1086.357) * [-1082.600] (-1083.194) (-1083.309) (-1084.562) -- 0:00:51 134500 -- (-1081.317) (-1081.370) (-1083.059) [-1083.970] * (-1085.050) (-1082.748) [-1082.394] (-1083.935) -- 0:00:51 135000 -- (-1084.137) (-1081.219) (-1082.570) [-1086.427] * (-1081.292) (-1086.390) [-1082.399] (-1082.399) -- 0:00:51 Average standard deviation of split frequencies: 0.019166 135500 -- [-1085.207] (-1081.008) (-1082.522) (-1082.331) * (-1082.832) [-1081.359] (-1081.966) (-1081.579) -- 0:00:51 136000 -- (-1083.872) [-1081.577] (-1082.875) (-1082.304) * (-1084.219) [-1083.734] (-1083.771) (-1082.811) -- 0:00:50 136500 -- (-1082.218) (-1081.820) [-1081.501] (-1082.625) * (-1083.039) (-1086.886) (-1081.260) [-1081.764] -- 0:00:50 137000 -- (-1084.983) (-1081.631) [-1081.025] (-1081.703) * (-1082.416) (-1088.109) (-1085.623) [-1081.027] -- 0:00:50 137500 -- (-1082.753) (-1084.473) (-1081.528) [-1082.812] * (-1084.113) (-1086.817) [-1087.754] (-1080.855) -- 0:00:50 138000 -- (-1086.659) (-1087.273) [-1081.309] (-1084.844) * (-1084.148) (-1083.851) (-1085.254) [-1081.040] -- 0:00:49 138500 -- [-1081.968] (-1082.236) (-1082.732) (-1083.604) * (-1086.216) (-1085.100) (-1082.801) [-1083.332] -- 0:00:49 139000 -- [-1086.176] (-1082.624) (-1084.356) (-1081.384) * (-1083.239) (-1082.061) [-1084.088] (-1081.992) -- 0:00:49 139500 -- [-1083.411] (-1083.027) (-1086.134) (-1082.439) * [-1083.278] (-1083.399) (-1082.844) (-1083.664) -- 0:00:49 140000 -- (-1083.529) (-1082.829) [-1082.823] (-1085.103) * (-1081.208) [-1083.079] (-1087.304) (-1080.976) -- 0:00:49 Average standard deviation of split frequencies: 0.018333 140500 -- (-1083.084) [-1082.982] (-1081.011) (-1082.296) * [-1082.204] (-1084.783) (-1085.098) (-1080.838) -- 0:00:48 141000 -- (-1083.688) [-1084.525] (-1082.333) (-1083.330) * [-1081.850] (-1081.610) (-1087.911) (-1081.449) -- 0:00:48 141500 -- (-1083.670) (-1085.384) (-1082.260) [-1083.652] * (-1083.982) [-1084.865] (-1083.648) (-1081.252) -- 0:00:48 142000 -- [-1083.890] (-1086.341) (-1084.216) (-1084.813) * (-1088.594) (-1084.703) [-1082.566] (-1081.047) -- 0:00:48 142500 -- (-1083.825) [-1092.785] (-1082.747) (-1083.352) * (-1084.826) [-1081.904] (-1082.341) (-1082.360) -- 0:00:48 143000 -- (-1088.658) (-1083.039) [-1084.444] (-1084.132) * (-1086.020) [-1083.367] (-1082.915) (-1082.057) -- 0:00:47 143500 -- (-1084.142) [-1082.564] (-1081.631) (-1083.012) * (-1083.926) (-1082.703) [-1082.644] (-1083.594) -- 0:00:53 144000 -- [-1088.680] (-1083.411) (-1083.337) (-1091.336) * (-1085.371) [-1085.502] (-1082.662) (-1081.693) -- 0:00:53 144500 -- (-1083.895) (-1081.802) (-1081.867) [-1081.349] * (-1090.750) [-1082.791] (-1082.416) (-1083.196) -- 0:00:53 145000 -- (-1082.387) (-1085.241) (-1081.927) [-1081.349] * [-1085.283] (-1081.983) (-1084.023) (-1083.200) -- 0:00:53 Average standard deviation of split frequencies: 0.017164 145500 -- (-1084.331) (-1083.619) (-1083.161) [-1081.409] * (-1084.173) [-1083.291] (-1081.220) (-1081.919) -- 0:00:52 146000 -- (-1084.307) [-1085.214] (-1084.688) (-1085.133) * [-1085.122] (-1084.107) (-1084.149) (-1081.945) -- 0:00:52 146500 -- (-1085.686) (-1089.278) [-1082.737] (-1085.631) * (-1081.546) (-1083.981) [-1081.855] (-1082.390) -- 0:00:52 147000 -- (-1082.536) (-1085.702) [-1085.948] (-1083.134) * [-1083.474] (-1082.264) (-1081.567) (-1083.669) -- 0:00:52 147500 -- (-1081.348) [-1085.507] (-1084.336) (-1083.512) * (-1082.388) (-1083.774) (-1082.606) [-1081.743] -- 0:00:52 148000 -- (-1082.307) [-1082.789] (-1083.330) (-1084.086) * (-1083.165) (-1085.586) (-1081.923) [-1081.761] -- 0:00:51 148500 -- (-1088.779) (-1084.475) (-1083.104) [-1084.612] * (-1080.927) (-1082.977) [-1081.401] (-1085.099) -- 0:00:51 149000 -- (-1087.624) (-1086.241) [-1082.604] (-1081.438) * (-1083.488) (-1082.209) [-1083.124] (-1086.573) -- 0:00:51 149500 -- (-1084.600) [-1081.319] (-1083.708) (-1083.393) * (-1083.191) (-1088.517) [-1085.213] (-1083.431) -- 0:00:51 150000 -- [-1084.078] (-1082.890) (-1083.285) (-1083.497) * [-1081.640] (-1084.771) (-1084.567) (-1084.013) -- 0:00:51 Average standard deviation of split frequencies: 0.019925 150500 -- (-1084.763) [-1081.582] (-1083.445) (-1082.819) * (-1085.642) (-1082.279) (-1082.091) [-1082.595] -- 0:00:50 151000 -- (-1085.739) (-1084.860) (-1083.055) [-1081.945] * (-1085.441) [-1086.013] (-1081.054) (-1084.153) -- 0:00:50 151500 -- (-1082.849) (-1083.860) [-1086.342] (-1084.240) * [-1083.674] (-1084.850) (-1082.859) (-1085.529) -- 0:00:50 152000 -- (-1082.672) (-1085.164) (-1084.667) [-1082.292] * [-1083.145] (-1084.401) (-1081.604) (-1086.239) -- 0:00:50 152500 -- (-1082.859) [-1084.816] (-1083.823) (-1082.470) * [-1083.186] (-1084.112) (-1081.604) (-1083.484) -- 0:00:50 153000 -- (-1082.153) (-1081.120) [-1082.055] (-1083.298) * (-1081.690) [-1081.739] (-1081.696) (-1083.145) -- 0:00:49 153500 -- [-1083.606] (-1081.459) (-1082.103) (-1086.960) * (-1081.721) [-1081.658] (-1083.344) (-1083.147) -- 0:00:49 154000 -- [-1084.103] (-1081.090) (-1083.722) (-1084.576) * (-1081.647) [-1081.939] (-1080.825) (-1085.776) -- 0:00:49 154500 -- (-1083.371) (-1080.915) [-1083.156] (-1083.343) * (-1084.377) [-1081.283] (-1080.825) (-1083.609) -- 0:00:49 155000 -- (-1084.500) [-1083.646] (-1084.591) (-1082.480) * (-1083.689) (-1086.763) (-1082.589) [-1083.923] -- 0:00:49 Average standard deviation of split frequencies: 0.019197 155500 -- [-1081.984] (-1082.814) (-1086.924) (-1081.500) * (-1081.845) [-1082.538] (-1082.573) (-1083.813) -- 0:00:48 156000 -- (-1086.288) (-1085.383) (-1084.437) [-1081.203] * [-1086.599] (-1086.953) (-1081.745) (-1083.873) -- 0:00:48 156500 -- (-1084.049) (-1083.795) [-1083.241] (-1093.820) * [-1085.067] (-1088.009) (-1083.080) (-1086.080) -- 0:00:48 157000 -- [-1081.589] (-1083.824) (-1087.006) (-1082.703) * (-1083.580) (-1083.355) [-1081.558] (-1084.986) -- 0:00:48 157500 -- (-1082.479) (-1083.408) (-1082.642) [-1082.634] * (-1084.033) [-1082.446] (-1083.013) (-1084.971) -- 0:00:48 158000 -- (-1086.121) (-1083.802) [-1083.738] (-1086.170) * (-1081.450) (-1082.228) [-1081.684] (-1083.719) -- 0:00:47 158500 -- (-1082.134) [-1082.487] (-1085.089) (-1083.139) * (-1082.383) (-1082.065) [-1083.689] (-1081.602) -- 0:00:47 159000 -- [-1082.320] (-1085.991) (-1083.078) (-1083.956) * (-1081.590) (-1083.721) (-1083.227) [-1084.641] -- 0:00:52 159500 -- (-1083.226) (-1081.608) (-1085.116) [-1082.613] * [-1081.589] (-1082.879) (-1081.442) (-1081.722) -- 0:00:52 160000 -- (-1084.955) [-1083.915] (-1082.582) (-1082.057) * (-1081.719) (-1082.377) [-1081.438] (-1087.033) -- 0:00:52 Average standard deviation of split frequencies: 0.018640 160500 -- (-1087.713) (-1083.427) (-1087.461) [-1081.578] * (-1081.664) (-1082.516) (-1081.835) [-1081.384] -- 0:00:52 161000 -- (-1083.881) [-1083.175] (-1083.703) (-1082.248) * (-1083.062) [-1082.276] (-1085.110) (-1081.221) -- 0:00:52 161500 -- [-1084.544] (-1084.994) (-1083.477) (-1081.502) * (-1083.132) (-1085.939) [-1082.582] (-1082.134) -- 0:00:51 162000 -- (-1084.379) (-1086.731) [-1083.006] (-1081.563) * (-1081.013) (-1081.600) [-1084.139] (-1081.393) -- 0:00:51 162500 -- (-1083.532) [-1085.666] (-1082.966) (-1083.496) * [-1081.941] (-1081.865) (-1081.573) (-1082.909) -- 0:00:51 163000 -- [-1083.091] (-1083.484) (-1083.058) (-1088.247) * (-1081.501) (-1081.322) (-1081.819) [-1082.123] -- 0:00:51 163500 -- [-1081.974] (-1083.557) (-1082.460) (-1082.220) * (-1081.064) (-1081.168) (-1085.775) [-1082.493] -- 0:00:51 164000 -- (-1081.254) [-1084.822] (-1082.071) (-1081.800) * (-1083.375) (-1085.273) (-1086.226) [-1082.111] -- 0:00:50 164500 -- (-1081.527) [-1088.052] (-1087.114) (-1084.183) * (-1083.416) [-1084.761] (-1084.042) (-1083.860) -- 0:00:50 165000 -- (-1086.160) (-1084.442) (-1087.009) [-1084.790] * (-1084.441) [-1082.197] (-1083.239) (-1081.558) -- 0:00:50 Average standard deviation of split frequencies: 0.016092 165500 -- [-1082.938] (-1083.980) (-1083.575) (-1082.852) * [-1084.361] (-1085.686) (-1082.666) (-1083.397) -- 0:00:50 166000 -- [-1082.845] (-1083.978) (-1083.636) (-1082.388) * [-1084.055] (-1084.376) (-1085.989) (-1082.660) -- 0:00:50 166500 -- [-1085.522] (-1082.661) (-1081.955) (-1083.248) * (-1083.621) (-1083.099) (-1084.017) [-1081.694] -- 0:00:50 167000 -- (-1085.128) (-1083.223) (-1081.258) [-1082.861] * (-1081.266) (-1085.525) (-1085.687) [-1083.995] -- 0:00:49 167500 -- (-1082.483) (-1082.891) (-1083.299) [-1082.397] * (-1081.893) [-1083.290] (-1086.391) (-1084.386) -- 0:00:49 168000 -- [-1082.684] (-1081.870) (-1083.573) (-1083.279) * (-1082.754) (-1088.237) (-1085.265) [-1083.974] -- 0:00:49 168500 -- [-1082.853] (-1083.731) (-1086.538) (-1081.571) * (-1089.482) (-1083.725) [-1086.734] (-1083.299) -- 0:00:49 169000 -- [-1082.946] (-1081.875) (-1085.140) (-1082.920) * (-1082.361) (-1082.543) [-1082.449] (-1082.654) -- 0:00:49 169500 -- (-1084.502) [-1081.368] (-1085.698) (-1082.102) * [-1082.190] (-1083.462) (-1082.539) (-1082.954) -- 0:00:48 170000 -- (-1082.892) [-1081.628] (-1083.176) (-1085.415) * (-1081.933) (-1081.753) [-1083.852] (-1082.951) -- 0:00:48 Average standard deviation of split frequencies: 0.017800 170500 -- (-1084.274) (-1082.723) [-1083.708] (-1081.994) * (-1081.993) (-1081.284) [-1081.917] (-1082.904) -- 0:00:48 171000 -- (-1081.978) (-1082.707) [-1082.272] (-1083.126) * (-1081.833) (-1082.340) [-1082.021] (-1084.784) -- 0:00:48 171500 -- [-1082.413] (-1083.955) (-1086.670) (-1082.496) * [-1083.489] (-1082.411) (-1084.181) (-1084.964) -- 0:00:48 172000 -- [-1083.944] (-1086.384) (-1083.829) (-1082.584) * (-1087.139) (-1084.912) [-1083.431] (-1082.696) -- 0:00:48 172500 -- (-1084.001) (-1085.525) [-1083.535] (-1085.016) * [-1082.123] (-1083.479) (-1084.353) (-1083.600) -- 0:00:47 173000 -- (-1084.210) (-1084.476) [-1082.562] (-1083.801) * (-1082.343) [-1083.082] (-1082.663) (-1086.767) -- 0:00:47 173500 -- (-1081.656) (-1083.094) (-1084.374) [-1082.324] * (-1083.488) (-1085.919) (-1083.408) [-1083.522] -- 0:00:47 174000 -- (-1085.324) (-1081.226) [-1087.218] (-1087.400) * (-1083.373) (-1085.383) [-1082.639] (-1083.179) -- 0:00:47 174500 -- (-1090.367) (-1085.315) [-1084.298] (-1085.484) * (-1083.792) (-1082.329) (-1083.842) [-1082.223] -- 0:00:47 175000 -- (-1081.604) [-1082.838] (-1086.447) (-1082.754) * (-1082.887) (-1083.524) (-1084.839) [-1082.357] -- 0:00:47 Average standard deviation of split frequencies: 0.018154 175500 -- [-1083.444] (-1082.345) (-1084.330) (-1084.145) * [-1082.887] (-1081.363) (-1082.428) (-1084.910) -- 0:00:51 176000 -- (-1085.127) (-1085.005) [-1083.879] (-1081.503) * (-1081.528) [-1081.940] (-1084.168) (-1083.681) -- 0:00:51 176500 -- [-1081.974] (-1085.654) (-1084.063) (-1081.783) * (-1082.204) (-1081.530) (-1082.110) [-1085.227] -- 0:00:51 177000 -- (-1081.960) (-1085.530) (-1085.978) [-1081.649] * (-1082.183) (-1082.021) [-1082.026] (-1083.270) -- 0:00:51 177500 -- (-1081.280) (-1082.170) (-1081.545) [-1081.759] * [-1082.783] (-1083.120) (-1081.863) (-1082.331) -- 0:00:50 178000 -- (-1080.716) (-1085.610) (-1083.882) [-1082.081] * [-1083.516] (-1082.232) (-1081.907) (-1086.220) -- 0:00:50 178500 -- (-1081.524) (-1086.686) [-1084.401] (-1083.275) * [-1082.059] (-1082.489) (-1081.154) (-1082.214) -- 0:00:50 179000 -- (-1083.560) [-1082.716] (-1082.557) (-1083.838) * (-1082.809) [-1083.231] (-1082.764) (-1082.938) -- 0:00:50 179500 -- (-1082.669) [-1082.366] (-1081.890) (-1083.593) * [-1083.134] (-1082.250) (-1083.174) (-1081.920) -- 0:00:50 180000 -- (-1083.472) [-1082.363] (-1083.361) (-1082.943) * [-1084.467] (-1087.958) (-1082.433) (-1083.392) -- 0:00:50 Average standard deviation of split frequencies: 0.019032 180500 -- (-1084.793) (-1084.213) [-1082.206] (-1086.781) * (-1086.405) (-1081.787) [-1083.955] (-1082.085) -- 0:00:49 181000 -- (-1083.040) (-1085.548) (-1081.177) [-1084.943] * (-1082.020) [-1082.154] (-1085.403) (-1085.173) -- 0:00:49 181500 -- (-1080.909) (-1084.364) [-1081.394] (-1082.082) * (-1082.463) (-1085.577) (-1084.781) [-1082.839] -- 0:00:49 182000 -- (-1083.332) [-1083.897] (-1083.158) (-1082.103) * (-1082.426) (-1085.122) [-1084.351] (-1082.767) -- 0:00:49 182500 -- (-1083.140) (-1086.065) [-1082.357] (-1084.128) * (-1089.074) (-1086.433) (-1081.605) [-1081.277] -- 0:00:49 183000 -- (-1084.479) (-1085.567) (-1081.613) [-1082.110] * [-1083.843] (-1085.861) (-1081.730) (-1082.567) -- 0:00:49 183500 -- [-1082.059] (-1087.578) (-1083.746) (-1081.778) * [-1080.874] (-1082.907) (-1084.728) (-1082.284) -- 0:00:48 184000 -- (-1083.730) [-1082.438] (-1082.451) (-1084.024) * [-1083.624] (-1081.467) (-1084.524) (-1082.922) -- 0:00:48 184500 -- [-1082.279] (-1081.948) (-1084.392) (-1081.970) * [-1082.009] (-1081.900) (-1083.403) (-1083.381) -- 0:00:48 185000 -- [-1082.029] (-1082.317) (-1083.530) (-1081.371) * (-1082.118) [-1083.088] (-1085.728) (-1082.958) -- 0:00:48 Average standard deviation of split frequencies: 0.018188 185500 -- (-1083.167) [-1083.633] (-1082.247) (-1081.464) * [-1082.273] (-1087.810) (-1082.047) (-1081.729) -- 0:00:48 186000 -- (-1081.305) [-1083.325] (-1082.603) (-1083.850) * (-1081.780) (-1082.794) (-1083.179) [-1082.414] -- 0:00:48 186500 -- (-1081.305) (-1081.556) [-1080.768] (-1082.567) * (-1082.645) [-1086.304] (-1082.844) (-1085.728) -- 0:00:47 187000 -- (-1081.513) [-1081.188] (-1080.745) (-1082.731) * [-1084.311] (-1087.290) (-1081.440) (-1084.289) -- 0:00:47 187500 -- [-1082.956] (-1083.117) (-1080.792) (-1086.898) * (-1083.604) (-1081.090) [-1081.647] (-1086.257) -- 0:00:47 188000 -- [-1081.407] (-1081.486) (-1084.050) (-1083.043) * (-1082.427) (-1081.453) [-1081.572] (-1082.931) -- 0:00:47 188500 -- [-1082.816] (-1082.375) (-1080.784) (-1086.097) * [-1082.866] (-1084.495) (-1081.761) (-1083.468) -- 0:00:47 189000 -- (-1082.956) (-1082.180) (-1083.365) [-1088.044] * (-1082.498) [-1081.444] (-1081.531) (-1083.312) -- 0:00:47 189500 -- (-1082.135) (-1085.062) [-1082.162] (-1082.055) * (-1081.493) (-1083.003) [-1081.144] (-1084.026) -- 0:00:47 190000 -- (-1082.477) (-1082.496) [-1084.563] (-1082.544) * (-1081.890) [-1081.178] (-1081.503) (-1081.898) -- 0:00:46 Average standard deviation of split frequencies: 0.019092 190500 -- (-1082.003) [-1081.598] (-1084.656) (-1084.970) * (-1085.684) (-1081.279) [-1081.593] (-1090.258) -- 0:00:46 191000 -- [-1082.840] (-1081.977) (-1085.019) (-1083.178) * (-1086.543) (-1085.500) [-1082.162] (-1084.144) -- 0:00:46 191500 -- [-1080.895] (-1084.016) (-1086.322) (-1086.608) * [-1082.955] (-1083.904) (-1081.848) (-1087.363) -- 0:00:50 192000 -- (-1082.111) [-1082.032] (-1083.988) (-1090.304) * (-1085.906) (-1085.126) [-1083.664] (-1083.066) -- 0:00:50 192500 -- [-1082.135] (-1084.243) (-1083.704) (-1087.530) * (-1085.155) [-1087.484] (-1082.313) (-1082.808) -- 0:00:50 193000 -- (-1084.661) [-1085.524] (-1085.255) (-1084.060) * (-1086.342) (-1083.849) (-1081.604) [-1083.782] -- 0:00:50 193500 -- (-1083.973) [-1086.626] (-1085.651) (-1082.100) * [-1083.209] (-1083.152) (-1081.246) (-1082.080) -- 0:00:50 194000 -- (-1081.492) (-1081.207) [-1083.233] (-1081.609) * (-1082.400) (-1088.416) [-1081.939] (-1082.984) -- 0:00:49 194500 -- (-1080.711) (-1081.150) (-1087.497) [-1081.752] * [-1082.493] (-1081.660) (-1082.694) (-1086.610) -- 0:00:49 195000 -- [-1081.848] (-1081.237) (-1085.520) (-1082.443) * (-1083.430) (-1082.117) [-1083.310] (-1094.242) -- 0:00:49 Average standard deviation of split frequencies: 0.019241 195500 -- (-1080.831) (-1081.822) [-1082.486] (-1083.758) * (-1083.653) [-1082.892] (-1086.051) (-1083.707) -- 0:00:49 196000 -- (-1081.310) (-1081.985) (-1081.462) [-1082.680] * [-1081.978] (-1083.389) (-1087.456) (-1081.775) -- 0:00:49 196500 -- [-1082.843] (-1086.143) (-1081.558) (-1086.667) * (-1083.059) (-1082.663) [-1083.476] (-1083.163) -- 0:00:49 197000 -- (-1083.001) (-1081.639) [-1085.582] (-1081.438) * (-1085.442) (-1082.604) [-1082.605] (-1092.702) -- 0:00:48 197500 -- [-1083.314] (-1082.462) (-1081.679) (-1082.764) * (-1084.121) (-1082.286) (-1082.279) [-1085.696] -- 0:00:48 198000 -- [-1085.482] (-1086.273) (-1084.468) (-1082.209) * (-1083.424) [-1081.851] (-1081.697) (-1083.176) -- 0:00:48 198500 -- (-1085.710) (-1083.495) (-1082.915) [-1082.031] * (-1083.233) [-1082.178] (-1081.864) (-1082.305) -- 0:00:48 199000 -- (-1086.684) [-1081.148] (-1084.033) (-1081.129) * (-1084.793) (-1081.568) (-1083.841) [-1081.974] -- 0:00:48 199500 -- (-1081.668) [-1084.443] (-1082.436) (-1081.868) * (-1085.427) (-1082.118) (-1081.835) [-1085.163] -- 0:00:48 200000 -- (-1081.520) [-1083.102] (-1082.099) (-1084.116) * [-1082.679] (-1081.273) (-1082.078) (-1084.535) -- 0:00:48 Average standard deviation of split frequencies: 0.016444 200500 -- (-1080.774) (-1086.784) [-1084.607] (-1083.810) * [-1084.921] (-1082.548) (-1083.358) (-1083.903) -- 0:00:47 201000 -- (-1088.731) (-1086.074) (-1082.189) [-1083.216] * (-1081.865) (-1082.300) [-1086.040] (-1088.387) -- 0:00:47 201500 -- (-1083.397) [-1083.725] (-1082.505) (-1086.785) * (-1081.972) [-1084.063] (-1081.654) (-1083.289) -- 0:00:47 202000 -- (-1082.228) (-1086.920) (-1084.047) [-1081.146] * (-1081.865) [-1082.358] (-1083.402) (-1082.503) -- 0:00:47 202500 -- (-1086.382) (-1082.830) (-1085.044) [-1081.490] * (-1081.089) [-1082.614] (-1080.942) (-1082.519) -- 0:00:47 203000 -- (-1083.432) (-1081.877) (-1083.098) [-1081.622] * (-1081.407) [-1082.627] (-1081.572) (-1082.011) -- 0:00:47 203500 -- (-1082.671) (-1080.823) (-1083.208) [-1083.535] * (-1081.627) (-1082.509) [-1084.464] (-1084.750) -- 0:00:46 204000 -- (-1082.426) (-1081.347) (-1086.796) [-1082.176] * (-1082.133) (-1082.887) [-1085.042] (-1083.338) -- 0:00:46 204500 -- (-1082.692) (-1086.221) [-1086.791] (-1086.746) * [-1083.434] (-1084.598) (-1084.090) (-1082.720) -- 0:00:46 205000 -- (-1082.677) (-1083.544) (-1082.831) [-1085.768] * (-1083.636) (-1082.068) (-1082.087) [-1086.944] -- 0:00:46 Average standard deviation of split frequencies: 0.015898 205500 -- [-1082.173] (-1083.448) (-1082.287) (-1087.618) * (-1081.044) [-1082.022] (-1083.517) (-1085.239) -- 0:00:46 206000 -- (-1082.399) [-1082.516] (-1082.659) (-1087.481) * (-1081.902) [-1085.634] (-1084.600) (-1084.967) -- 0:00:46 206500 -- (-1081.105) (-1082.922) [-1085.612] (-1087.047) * [-1082.596] (-1084.166) (-1082.191) (-1083.610) -- 0:00:46 207000 -- [-1084.597] (-1086.543) (-1084.096) (-1084.817) * (-1085.365) (-1082.847) [-1084.745] (-1082.369) -- 0:00:45 207500 -- (-1081.448) (-1082.548) [-1085.035] (-1085.735) * (-1087.974) (-1081.839) (-1082.246) [-1082.332] -- 0:00:49 208000 -- (-1081.671) [-1085.032] (-1085.657) (-1085.279) * [-1082.499] (-1081.837) (-1082.523) (-1083.721) -- 0:00:49 208500 -- (-1081.630) [-1082.404] (-1083.948) (-1087.967) * (-1081.494) [-1081.276] (-1083.257) (-1082.613) -- 0:00:49 209000 -- [-1081.266] (-1081.638) (-1081.940) (-1084.589) * [-1082.331] (-1084.871) (-1082.960) (-1086.007) -- 0:00:49 209500 -- (-1081.624) [-1086.357] (-1082.194) (-1083.056) * [-1081.811] (-1084.409) (-1084.887) (-1082.180) -- 0:00:49 210000 -- (-1081.633) (-1084.826) [-1082.999] (-1083.213) * [-1081.693] (-1084.442) (-1085.175) (-1085.842) -- 0:00:48 Average standard deviation of split frequencies: 0.017280 210500 -- (-1083.173) [-1081.785] (-1083.620) (-1083.236) * (-1084.364) (-1086.476) [-1083.304] (-1082.820) -- 0:00:48 211000 -- (-1082.255) (-1082.820) [-1081.750] (-1087.197) * (-1081.616) (-1082.954) [-1082.606] (-1086.657) -- 0:00:48 211500 -- [-1083.907] (-1082.192) (-1087.693) (-1084.348) * (-1081.541) [-1084.132] (-1081.357) (-1082.877) -- 0:00:48 212000 -- [-1087.079] (-1084.928) (-1083.073) (-1083.289) * (-1083.185) (-1083.071) [-1084.384] (-1084.793) -- 0:00:48 212500 -- (-1081.296) (-1088.381) [-1081.952] (-1082.929) * (-1081.376) (-1082.911) [-1083.598] (-1083.611) -- 0:00:48 213000 -- [-1081.315] (-1086.541) (-1085.195) (-1084.662) * [-1081.088] (-1082.429) (-1083.749) (-1087.327) -- 0:00:48 213500 -- (-1082.000) (-1084.566) [-1087.267] (-1082.777) * (-1082.480) (-1085.119) (-1084.296) [-1082.152] -- 0:00:47 214000 -- (-1084.964) (-1084.746) (-1082.350) [-1086.386] * (-1084.348) [-1083.285] (-1083.873) (-1081.940) -- 0:00:47 214500 -- (-1083.576) (-1083.796) [-1082.823] (-1081.517) * (-1083.291) (-1083.660) (-1086.165) [-1082.033] -- 0:00:47 215000 -- (-1083.112) (-1084.505) (-1082.987) [-1082.248] * (-1084.332) (-1086.549) (-1086.636) [-1081.249] -- 0:00:47 Average standard deviation of split frequencies: 0.016611 215500 -- [-1082.068] (-1083.837) (-1081.583) (-1081.136) * [-1081.838] (-1082.885) (-1086.821) (-1081.513) -- 0:00:47 216000 -- (-1083.277) (-1081.290) (-1082.849) [-1081.803] * (-1082.902) [-1083.506] (-1091.861) (-1082.676) -- 0:00:47 216500 -- (-1081.928) [-1081.065] (-1082.566) (-1082.976) * (-1086.458) [-1082.855] (-1084.847) (-1082.147) -- 0:00:47 217000 -- (-1081.798) (-1082.344) [-1082.140] (-1084.382) * (-1088.391) [-1085.851] (-1084.333) (-1083.414) -- 0:00:46 217500 -- (-1084.269) (-1080.847) (-1082.655) [-1082.713] * (-1080.913) (-1083.637) (-1082.726) [-1083.752] -- 0:00:46 218000 -- [-1083.242] (-1081.003) (-1085.084) (-1082.685) * (-1081.419) [-1082.666] (-1080.891) (-1084.358) -- 0:00:46 218500 -- (-1082.105) (-1087.037) (-1082.179) [-1083.041] * (-1084.169) (-1084.292) (-1081.718) [-1083.410] -- 0:00:46 219000 -- [-1084.161] (-1086.040) (-1082.054) (-1083.070) * (-1084.102) (-1083.762) (-1082.446) [-1084.861] -- 0:00:46 219500 -- [-1081.555] (-1083.858) (-1082.442) (-1083.963) * (-1082.066) [-1081.835] (-1081.549) (-1082.693) -- 0:00:46 220000 -- (-1086.798) [-1084.088] (-1080.998) (-1083.239) * [-1083.663] (-1083.340) (-1083.075) (-1081.109) -- 0:00:46 Average standard deviation of split frequencies: 0.015457 220500 -- [-1083.436] (-1084.049) (-1081.055) (-1083.506) * (-1086.884) (-1084.092) (-1081.933) [-1082.408] -- 0:00:45 221000 -- (-1083.666) (-1082.236) [-1082.335] (-1084.770) * (-1084.402) (-1086.473) (-1081.694) [-1083.537] -- 0:00:45 221500 -- (-1081.515) (-1083.402) [-1081.709] (-1083.952) * (-1082.546) (-1084.534) (-1081.872) [-1081.871] -- 0:00:45 222000 -- (-1083.452) (-1084.011) (-1082.321) [-1081.270] * (-1085.293) [-1084.757] (-1084.702) (-1089.121) -- 0:00:45 222500 -- (-1083.235) (-1084.067) (-1082.568) [-1081.126] * [-1086.279] (-1084.545) (-1082.264) (-1086.174) -- 0:00:45 223000 -- (-1081.974) (-1083.895) (-1083.608) [-1082.371] * (-1081.463) (-1083.925) (-1082.778) [-1082.366] -- 0:00:45 223500 -- (-1082.978) (-1085.450) (-1083.519) [-1082.507] * (-1083.348) (-1084.991) (-1090.493) [-1082.118] -- 0:00:45 224000 -- (-1081.772) [-1081.563] (-1084.540) (-1082.741) * (-1085.571) (-1081.001) (-1095.740) [-1081.440] -- 0:00:48 224500 -- (-1082.183) [-1082.612] (-1084.849) (-1082.656) * (-1081.504) (-1081.626) (-1089.513) [-1081.691] -- 0:00:48 225000 -- (-1081.529) (-1081.392) (-1084.235) [-1080.732] * (-1082.135) [-1081.959] (-1084.565) (-1083.380) -- 0:00:48 Average standard deviation of split frequencies: 0.013674 225500 -- [-1080.899] (-1081.731) (-1081.877) (-1080.727) * (-1082.726) [-1080.935] (-1084.885) (-1082.365) -- 0:00:48 226000 -- (-1086.454) [-1082.785] (-1085.889) (-1080.894) * (-1082.276) [-1081.315] (-1085.017) (-1082.577) -- 0:00:47 226500 -- [-1081.541] (-1083.412) (-1085.805) (-1080.880) * [-1082.291] (-1082.227) (-1083.926) (-1084.421) -- 0:00:47 227000 -- [-1081.176] (-1084.704) (-1085.348) (-1080.881) * [-1081.229] (-1081.884) (-1085.676) (-1083.103) -- 0:00:47 227500 -- (-1081.262) [-1084.203] (-1088.909) (-1081.271) * [-1083.002] (-1082.424) (-1086.199) (-1084.946) -- 0:00:47 228000 -- (-1081.129) (-1081.523) (-1083.911) [-1081.319] * (-1082.920) [-1082.640] (-1083.981) (-1082.716) -- 0:00:47 228500 -- [-1083.675] (-1081.827) (-1080.964) (-1083.509) * (-1084.304) (-1082.969) (-1084.544) [-1081.603] -- 0:00:47 229000 -- (-1084.984) (-1084.010) (-1082.528) [-1083.759] * (-1083.026) (-1082.740) [-1082.363] (-1087.579) -- 0:00:47 229500 -- (-1083.602) [-1081.720] (-1083.191) (-1081.793) * (-1081.929) (-1085.817) (-1083.203) [-1083.892] -- 0:00:47 230000 -- (-1082.775) [-1083.236] (-1082.643) (-1082.065) * (-1084.384) (-1081.689) (-1084.090) [-1082.745] -- 0:00:46 Average standard deviation of split frequencies: 0.012035 230500 -- [-1084.207] (-1082.592) (-1082.539) (-1082.042) * [-1083.492] (-1081.616) (-1083.254) (-1086.224) -- 0:00:46 231000 -- (-1083.625) [-1082.510] (-1085.056) (-1081.318) * (-1086.299) (-1082.209) (-1082.229) [-1087.681] -- 0:00:46 231500 -- (-1081.798) [-1085.514] (-1082.505) (-1082.014) * (-1082.715) (-1083.097) [-1082.750] (-1083.224) -- 0:00:46 232000 -- (-1081.592) [-1083.176] (-1081.565) (-1081.728) * (-1081.841) (-1085.541) (-1082.159) [-1082.161] -- 0:00:46 232500 -- (-1082.841) [-1084.185] (-1081.920) (-1084.313) * (-1081.280) (-1082.920) [-1082.231] (-1081.258) -- 0:00:46 233000 -- (-1084.647) [-1085.070] (-1084.294) (-1084.913) * (-1081.593) (-1090.791) [-1082.095] (-1081.388) -- 0:00:46 233500 -- (-1083.752) (-1084.285) [-1083.840] (-1084.702) * (-1086.454) (-1084.678) [-1085.482] (-1083.679) -- 0:00:45 234000 -- (-1083.542) [-1086.349] (-1081.370) (-1089.005) * (-1083.639) (-1083.975) [-1082.500] (-1086.858) -- 0:00:45 234500 -- (-1084.347) (-1087.123) [-1082.586] (-1081.820) * (-1081.873) (-1082.960) [-1082.173] (-1082.143) -- 0:00:45 235000 -- (-1081.925) [-1088.578] (-1082.249) (-1081.996) * (-1081.635) (-1081.959) (-1081.744) [-1083.222] -- 0:00:45 Average standard deviation of split frequencies: 0.012429 235500 -- (-1085.938) (-1085.664) (-1081.761) [-1082.273] * (-1081.429) (-1082.199) (-1083.240) [-1081.677] -- 0:00:45 236000 -- (-1086.325) [-1083.419] (-1087.571) (-1084.775) * (-1087.372) (-1086.759) [-1081.377] (-1082.274) -- 0:00:45 236500 -- [-1081.822] (-1083.612) (-1084.984) (-1083.506) * (-1085.593) [-1086.436] (-1082.244) (-1082.537) -- 0:00:45 237000 -- [-1081.792] (-1084.002) (-1088.202) (-1086.511) * [-1082.538] (-1083.465) (-1082.839) (-1082.959) -- 0:00:45 237500 -- [-1082.153] (-1082.853) (-1084.784) (-1084.136) * [-1081.644] (-1086.669) (-1081.599) (-1082.645) -- 0:00:44 238000 -- [-1082.610] (-1084.357) (-1083.358) (-1082.334) * (-1082.469) [-1083.093] (-1081.621) (-1081.950) -- 0:00:44 238500 -- (-1081.116) [-1085.367] (-1081.575) (-1085.402) * (-1080.831) [-1083.126] (-1081.669) (-1081.990) -- 0:00:44 239000 -- (-1081.356) [-1087.082] (-1081.385) (-1084.869) * (-1081.130) [-1081.387] (-1086.400) (-1081.493) -- 0:00:44 239500 -- [-1082.732] (-1083.507) (-1082.943) (-1084.394) * [-1081.168] (-1083.180) (-1082.933) (-1082.435) -- 0:00:44 240000 -- (-1084.463) (-1080.815) [-1082.795] (-1082.689) * (-1083.007) (-1081.575) [-1084.133] (-1083.504) -- 0:00:47 Average standard deviation of split frequencies: 0.012674 240500 -- (-1084.595) (-1081.746) [-1083.798] (-1082.896) * (-1082.381) (-1081.982) [-1087.065] (-1084.381) -- 0:00:47 241000 -- (-1084.811) (-1083.274) (-1083.804) [-1083.672] * (-1087.164) [-1084.303] (-1087.610) (-1084.999) -- 0:00:47 241500 -- (-1084.357) (-1085.482) [-1082.033] (-1083.251) * (-1081.484) (-1086.911) (-1086.697) [-1086.468] -- 0:00:47 242000 -- (-1083.600) [-1081.197] (-1083.187) (-1083.764) * [-1081.836] (-1083.297) (-1090.249) (-1086.629) -- 0:00:46 242500 -- (-1082.459) (-1082.368) [-1083.182] (-1083.783) * [-1083.653] (-1083.291) (-1084.913) (-1086.011) -- 0:00:46 243000 -- (-1083.945) [-1082.398] (-1081.793) (-1081.439) * (-1082.948) [-1085.035] (-1085.597) (-1084.610) -- 0:00:46 243500 -- (-1081.504) [-1082.252] (-1081.617) (-1083.426) * (-1084.027) (-1083.340) (-1083.144) [-1080.952] -- 0:00:46 244000 -- (-1081.802) (-1082.196) (-1082.132) [-1082.595] * [-1083.840] (-1084.007) (-1083.430) (-1081.722) -- 0:00:46 244500 -- (-1084.428) (-1091.550) (-1082.650) [-1082.232] * (-1083.824) (-1082.102) (-1082.812) [-1082.425] -- 0:00:46 245000 -- (-1082.084) (-1089.693) (-1085.933) [-1082.841] * (-1081.883) [-1082.412] (-1085.448) (-1084.055) -- 0:00:46 Average standard deviation of split frequencies: 0.011723 245500 -- (-1081.549) (-1087.523) (-1084.246) [-1082.515] * (-1081.283) [-1082.410] (-1084.712) (-1082.534) -- 0:00:46 246000 -- (-1080.987) (-1087.993) [-1084.226] (-1083.661) * [-1081.209] (-1084.894) (-1083.510) (-1081.982) -- 0:00:45 246500 -- (-1085.990) (-1083.696) [-1080.666] (-1083.402) * (-1081.136) [-1082.263] (-1082.994) (-1085.903) -- 0:00:45 247000 -- [-1082.441] (-1083.613) (-1081.372) (-1081.143) * (-1080.956) (-1081.910) (-1083.265) [-1085.204] -- 0:00:45 247500 -- (-1085.393) [-1081.747] (-1083.762) (-1081.807) * (-1082.398) (-1083.291) [-1082.690] (-1082.633) -- 0:00:45 248000 -- (-1082.883) (-1081.355) [-1083.481] (-1081.212) * [-1081.982] (-1082.729) (-1082.391) (-1082.542) -- 0:00:45 248500 -- (-1080.882) (-1080.626) [-1083.530] (-1083.200) * (-1086.762) (-1083.112) (-1081.714) [-1082.288] -- 0:00:45 249000 -- (-1080.868) (-1082.875) [-1082.917] (-1081.714) * (-1085.272) (-1082.173) (-1085.330) [-1082.298] -- 0:00:45 249500 -- (-1083.661) [-1082.924] (-1084.278) (-1081.763) * (-1081.401) [-1081.609] (-1082.498) (-1084.182) -- 0:00:45 250000 -- (-1082.479) (-1081.901) [-1081.226] (-1084.264) * (-1086.614) (-1085.372) (-1082.038) [-1086.408] -- 0:00:45 Average standard deviation of split frequencies: 0.012390 250500 -- (-1083.130) (-1084.704) [-1083.326] (-1085.763) * [-1084.954] (-1090.222) (-1081.860) (-1088.723) -- 0:00:44 251000 -- [-1084.771] (-1083.758) (-1082.523) (-1084.744) * [-1085.675] (-1085.903) (-1082.040) (-1085.048) -- 0:00:44 251500 -- (-1081.652) (-1084.333) (-1081.519) [-1086.891] * (-1083.191) (-1086.985) [-1081.505] (-1084.708) -- 0:00:44 252000 -- [-1083.381] (-1090.039) (-1081.976) (-1086.607) * (-1085.507) (-1087.069) [-1083.071] (-1087.465) -- 0:00:44 252500 -- (-1086.324) (-1085.986) [-1082.401] (-1081.952) * [-1081.810] (-1086.338) (-1083.940) (-1088.968) -- 0:00:44 253000 -- (-1086.128) (-1081.501) [-1083.848] (-1083.268) * (-1084.751) [-1081.894] (-1084.292) (-1086.102) -- 0:00:44 253500 -- [-1081.557] (-1082.602) (-1081.716) (-1084.343) * (-1081.977) [-1084.037] (-1083.680) (-1085.907) -- 0:00:44 254000 -- [-1083.373] (-1087.749) (-1082.169) (-1085.161) * [-1081.489] (-1083.203) (-1084.194) (-1088.597) -- 0:00:44 254500 -- (-1084.370) (-1083.442) [-1082.816] (-1081.768) * (-1085.530) (-1083.515) (-1083.073) [-1082.732] -- 0:00:43 255000 -- (-1082.894) [-1081.253] (-1081.341) (-1081.798) * (-1086.109) [-1082.974] (-1081.794) (-1082.752) -- 0:00:43 Average standard deviation of split frequencies: 0.012782 255500 -- (-1083.803) (-1083.299) [-1081.421] (-1083.079) * (-1084.757) (-1082.768) [-1084.121] (-1085.157) -- 0:00:43 256000 -- (-1083.677) (-1083.194) (-1082.754) [-1088.310] * (-1082.481) (-1084.342) [-1085.000] (-1084.491) -- 0:00:43 256500 -- (-1087.582) [-1081.288] (-1084.120) (-1082.896) * (-1085.586) (-1083.170) [-1085.447] (-1082.101) -- 0:00:46 257000 -- [-1083.843] (-1081.587) (-1083.041) (-1083.898) * (-1091.981) (-1085.206) (-1085.027) [-1081.853] -- 0:00:46 257500 -- (-1083.054) (-1082.247) [-1081.496] (-1086.554) * [-1084.956] (-1083.052) (-1083.972) (-1083.438) -- 0:00:46 258000 -- (-1083.271) (-1083.331) [-1082.596] (-1083.614) * [-1082.192] (-1081.748) (-1087.581) (-1083.462) -- 0:00:46 258500 -- [-1082.701] (-1084.151) (-1081.606) (-1083.104) * (-1082.722) (-1083.490) [-1084.651] (-1083.410) -- 0:00:45 259000 -- (-1082.214) (-1083.093) (-1082.806) [-1082.624] * (-1081.958) (-1083.982) (-1086.360) [-1084.904] -- 0:00:45 259500 -- [-1081.755] (-1083.163) (-1081.320) (-1084.789) * [-1082.487] (-1084.647) (-1083.882) (-1081.718) -- 0:00:45 260000 -- [-1083.415] (-1083.203) (-1083.769) (-1083.372) * (-1082.499) (-1083.252) [-1083.785] (-1082.303) -- 0:00:45 Average standard deviation of split frequencies: 0.012234 260500 -- [-1081.260] (-1082.678) (-1083.802) (-1087.551) * (-1082.696) (-1083.797) [-1084.890] (-1085.491) -- 0:00:45 261000 -- (-1081.262) (-1083.273) (-1083.720) [-1083.478] * (-1084.960) (-1083.830) (-1084.731) [-1083.904] -- 0:00:45 261500 -- (-1081.517) (-1087.615) (-1088.242) [-1081.801] * (-1084.175) (-1084.694) (-1083.055) [-1081.436] -- 0:00:45 262000 -- (-1082.141) (-1082.260) (-1081.587) [-1081.390] * (-1083.228) (-1083.268) [-1081.797] (-1081.980) -- 0:00:45 262500 -- [-1081.934] (-1081.572) (-1081.613) (-1081.371) * (-1082.438) [-1087.259] (-1082.773) (-1085.593) -- 0:00:44 263000 -- [-1081.938] (-1081.575) (-1083.473) (-1081.456) * (-1083.966) [-1084.256] (-1084.811) (-1084.261) -- 0:00:44 263500 -- (-1085.754) [-1081.891] (-1082.141) (-1081.429) * [-1081.478] (-1084.502) (-1081.542) (-1084.512) -- 0:00:44 264000 -- (-1083.692) [-1086.898] (-1081.661) (-1084.259) * (-1081.463) (-1083.824) (-1081.835) [-1082.303] -- 0:00:44 264500 -- (-1088.648) [-1082.151] (-1083.707) (-1082.819) * [-1081.111] (-1083.927) (-1082.765) (-1083.641) -- 0:00:44 265000 -- (-1086.674) [-1081.731] (-1085.130) (-1083.475) * (-1081.585) (-1084.160) (-1083.849) [-1082.478] -- 0:00:44 Average standard deviation of split frequencies: 0.012822 265500 -- (-1081.963) [-1086.714] (-1083.162) (-1084.010) * (-1081.918) (-1083.202) (-1085.580) [-1081.702] -- 0:00:44 266000 -- (-1081.374) (-1082.561) [-1081.539] (-1083.923) * (-1084.625) (-1087.472) [-1083.860] (-1081.700) -- 0:00:44 266500 -- (-1081.502) (-1081.220) (-1083.551) [-1082.550] * (-1081.281) [-1089.194] (-1083.859) (-1081.667) -- 0:00:44 267000 -- (-1081.505) (-1083.284) (-1085.791) [-1083.380] * [-1083.504] (-1083.872) (-1081.317) (-1082.147) -- 0:00:43 267500 -- (-1083.206) [-1081.234] (-1082.972) (-1081.628) * [-1084.718] (-1083.780) (-1081.600) (-1082.585) -- 0:00:43 268000 -- (-1082.757) (-1081.752) (-1082.563) [-1082.785] * (-1085.302) (-1083.733) [-1081.238] (-1082.056) -- 0:00:43 268500 -- (-1083.110) (-1081.009) (-1083.630) [-1083.676] * [-1082.030] (-1083.141) (-1083.015) (-1083.267) -- 0:00:43 269000 -- (-1082.524) (-1081.157) [-1083.145] (-1083.065) * (-1082.195) (-1083.141) (-1083.842) [-1083.481] -- 0:00:43 269500 -- [-1082.867] (-1083.293) (-1085.219) (-1085.602) * [-1082.223] (-1082.569) (-1086.433) (-1084.703) -- 0:00:43 270000 -- (-1083.388) (-1083.493) (-1088.856) [-1081.507] * [-1082.080] (-1087.584) (-1084.222) (-1081.509) -- 0:00:43 Average standard deviation of split frequencies: 0.013836 270500 -- (-1082.432) [-1081.618] (-1081.970) (-1083.495) * (-1082.173) [-1086.169] (-1084.704) (-1081.444) -- 0:00:43 271000 -- (-1081.214) (-1082.506) [-1084.412] (-1082.888) * (-1081.423) [-1082.347] (-1082.612) (-1083.058) -- 0:00:43 271500 -- (-1082.706) [-1081.630] (-1086.387) (-1082.069) * (-1084.529) (-1084.074) [-1083.247] (-1082.162) -- 0:00:42 272000 -- [-1082.164] (-1082.558) (-1087.396) (-1082.257) * (-1083.654) (-1082.498) (-1086.893) [-1081.443] -- 0:00:42 272500 -- [-1087.297] (-1082.070) (-1084.904) (-1082.111) * (-1082.746) (-1082.654) [-1081.203] (-1081.503) -- 0:00:45 273000 -- (-1083.697) (-1082.402) (-1083.942) [-1083.553] * (-1081.802) (-1083.672) [-1081.414] (-1081.838) -- 0:00:45 273500 -- (-1083.939) (-1081.321) [-1082.608] (-1084.695) * (-1081.372) [-1086.138] (-1081.428) (-1081.487) -- 0:00:45 274000 -- (-1085.669) (-1082.819) [-1082.608] (-1083.577) * (-1081.550) (-1083.080) (-1081.285) [-1081.817] -- 0:00:45 274500 -- (-1083.973) [-1081.767] (-1086.563) (-1082.611) * (-1082.090) (-1082.855) [-1081.505] (-1083.389) -- 0:00:44 275000 -- (-1083.469) (-1083.205) (-1084.894) [-1082.075] * [-1083.670] (-1086.946) (-1084.853) (-1084.504) -- 0:00:44 Average standard deviation of split frequencies: 0.013563 275500 -- [-1081.079] (-1081.707) (-1088.553) (-1081.146) * (-1089.301) (-1085.038) (-1084.180) [-1084.160] -- 0:00:44 276000 -- (-1082.677) [-1082.635] (-1084.458) (-1083.353) * (-1083.244) [-1083.188] (-1082.215) (-1083.568) -- 0:00:44 276500 -- (-1081.664) [-1083.458] (-1081.672) (-1081.985) * (-1083.614) (-1085.396) (-1083.333) [-1081.602] -- 0:00:44 277000 -- (-1081.376) (-1085.143) [-1081.419] (-1082.878) * (-1084.762) (-1083.153) (-1083.722) [-1085.331] -- 0:00:44 277500 -- (-1081.712) [-1082.729] (-1082.877) (-1084.241) * (-1085.278) (-1085.079) [-1083.647] (-1083.194) -- 0:00:44 278000 -- [-1081.733] (-1086.461) (-1082.533) (-1082.779) * [-1082.691] (-1085.613) (-1083.042) (-1085.854) -- 0:00:44 278500 -- (-1086.796) (-1081.032) (-1083.125) [-1082.242] * [-1083.052] (-1082.030) (-1083.072) (-1083.672) -- 0:00:44 279000 -- [-1085.149] (-1081.111) (-1084.268) (-1081.578) * (-1082.573) (-1083.768) [-1081.861] (-1084.100) -- 0:00:43 279500 -- (-1081.693) (-1084.098) (-1083.312) [-1082.033] * (-1082.394) [-1084.901] (-1082.351) (-1083.297) -- 0:00:43 280000 -- (-1085.083) (-1082.987) (-1086.084) [-1083.230] * (-1083.909) [-1085.801] (-1081.879) (-1082.713) -- 0:00:43 Average standard deviation of split frequencies: 0.012943 280500 -- (-1082.635) (-1083.921) [-1086.077] (-1082.723) * (-1084.353) [-1081.378] (-1083.452) (-1086.228) -- 0:00:43 281000 -- [-1085.142] (-1083.474) (-1086.452) (-1081.298) * (-1086.395) (-1082.848) [-1085.576] (-1086.185) -- 0:00:43 281500 -- [-1084.185] (-1084.304) (-1083.499) (-1082.419) * [-1084.755] (-1081.910) (-1084.811) (-1086.346) -- 0:00:43 282000 -- (-1084.388) (-1083.719) (-1083.871) [-1082.355] * (-1083.655) [-1082.125] (-1083.677) (-1082.758) -- 0:00:43 282500 -- [-1083.295] (-1082.015) (-1083.706) (-1081.792) * (-1084.678) (-1083.918) [-1083.616] (-1086.475) -- 0:00:43 283000 -- (-1083.576) (-1084.403) (-1084.004) [-1083.304] * [-1085.234] (-1082.890) (-1082.817) (-1084.801) -- 0:00:43 283500 -- [-1082.820] (-1083.944) (-1081.737) (-1086.287) * (-1085.051) (-1083.612) (-1083.042) [-1083.121] -- 0:00:42 284000 -- [-1081.340] (-1082.161) (-1081.350) (-1083.709) * [-1082.422] (-1082.899) (-1083.795) (-1083.535) -- 0:00:42 284500 -- [-1081.676] (-1081.972) (-1083.079) (-1083.558) * (-1081.865) (-1083.576) (-1083.033) [-1083.515] -- 0:00:42 285000 -- (-1086.079) [-1085.450] (-1083.857) (-1086.771) * (-1080.980) (-1086.706) (-1085.021) [-1080.764] -- 0:00:42 Average standard deviation of split frequencies: 0.012701 285500 -- (-1083.327) [-1083.096] (-1081.508) (-1085.265) * [-1082.102] (-1084.053) (-1082.955) (-1080.764) -- 0:00:42 286000 -- (-1082.216) [-1083.274] (-1083.056) (-1081.392) * [-1083.431] (-1081.059) (-1086.871) (-1084.514) -- 0:00:42 286500 -- (-1087.225) [-1083.908] (-1082.140) (-1080.621) * (-1083.028) [-1082.319] (-1085.414) (-1083.991) -- 0:00:42 287000 -- [-1082.996] (-1085.964) (-1082.918) (-1080.618) * (-1084.172) (-1081.260) (-1083.350) [-1083.712] -- 0:00:42 287500 -- (-1083.043) (-1087.444) [-1083.251] (-1083.398) * (-1085.106) (-1082.979) [-1084.362] (-1081.551) -- 0:00:42 288000 -- [-1082.662] (-1082.583) (-1083.319) (-1083.994) * [-1083.135] (-1080.825) (-1081.386) (-1084.696) -- 0:00:42 288500 -- (-1082.448) (-1081.585) (-1083.086) [-1083.555] * (-1085.131) [-1081.901] (-1083.270) (-1081.742) -- 0:00:41 289000 -- (-1082.483) (-1083.100) (-1082.336) [-1083.660] * (-1085.406) (-1081.867) (-1086.053) [-1081.990] -- 0:00:44 289500 -- (-1081.144) (-1087.269) (-1082.425) [-1082.977] * [-1082.232] (-1083.621) (-1083.925) (-1081.247) -- 0:00:44 290000 -- (-1084.109) (-1086.445) [-1081.151] (-1082.498) * [-1083.261] (-1083.083) (-1084.000) (-1082.571) -- 0:00:44 Average standard deviation of split frequencies: 0.013833 290500 -- (-1083.635) (-1084.213) (-1081.884) [-1082.534] * (-1083.294) (-1083.342) (-1082.293) [-1081.537] -- 0:00:43 291000 -- (-1081.422) (-1083.420) [-1081.570] (-1082.394) * (-1083.042) [-1082.488] (-1081.466) (-1081.438) -- 0:00:43 291500 -- (-1084.254) (-1084.082) [-1081.020] (-1082.282) * (-1089.327) [-1082.445] (-1081.351) (-1083.240) -- 0:00:43 292000 -- (-1083.284) (-1084.114) (-1081.326) [-1081.477] * (-1084.258) [-1081.744] (-1082.567) (-1083.600) -- 0:00:43 292500 -- (-1083.257) [-1081.453] (-1081.939) (-1083.050) * [-1084.776] (-1085.573) (-1085.883) (-1081.430) -- 0:00:43 293000 -- (-1081.930) (-1081.863) [-1081.425] (-1082.445) * [-1083.441] (-1084.324) (-1081.677) (-1082.413) -- 0:00:43 293500 -- [-1082.433] (-1083.548) (-1083.737) (-1081.295) * (-1084.521) [-1082.582] (-1082.705) (-1082.714) -- 0:00:43 294000 -- (-1082.185) [-1082.851] (-1085.445) (-1081.967) * (-1084.557) [-1083.715] (-1082.652) (-1081.655) -- 0:00:43 294500 -- (-1081.412) (-1081.584) (-1086.205) [-1082.272] * (-1084.679) [-1082.880] (-1081.877) (-1081.738) -- 0:00:43 295000 -- (-1082.930) (-1082.504) (-1087.084) [-1082.310] * [-1083.676] (-1090.889) (-1086.724) (-1081.211) -- 0:00:43 Average standard deviation of split frequencies: 0.013677 295500 -- (-1087.869) (-1088.317) (-1081.529) [-1081.074] * [-1082.587] (-1090.169) (-1087.691) (-1082.067) -- 0:00:42 296000 -- (-1088.076) (-1083.820) [-1085.367] (-1081.112) * (-1083.953) (-1083.503) [-1087.037] (-1083.894) -- 0:00:42 296500 -- [-1085.157] (-1083.612) (-1082.057) (-1082.240) * [-1082.533] (-1083.511) (-1088.473) (-1080.937) -- 0:00:42 297000 -- (-1082.989) (-1085.559) (-1082.955) [-1084.965] * (-1082.284) (-1083.720) (-1084.626) [-1083.516] -- 0:00:42 297500 -- (-1084.239) (-1084.566) (-1083.087) [-1081.672] * (-1081.693) (-1083.926) [-1085.030] (-1082.969) -- 0:00:42 298000 -- [-1084.441] (-1083.006) (-1085.041) (-1084.865) * (-1083.001) (-1081.985) [-1081.854] (-1081.860) -- 0:00:42 298500 -- (-1083.864) (-1085.560) (-1086.550) [-1081.823] * (-1080.687) [-1081.201] (-1082.628) (-1081.858) -- 0:00:42 299000 -- [-1081.137] (-1082.911) (-1087.335) (-1081.997) * (-1081.477) (-1082.169) (-1082.621) [-1083.908] -- 0:00:42 299500 -- (-1083.730) [-1080.950] (-1081.403) (-1083.693) * [-1081.423] (-1087.045) (-1087.116) (-1081.407) -- 0:00:42 300000 -- (-1084.679) (-1082.284) [-1083.326] (-1083.041) * (-1081.635) (-1080.699) [-1085.578] (-1084.442) -- 0:00:42 Average standard deviation of split frequencies: 0.015483 300500 -- [-1083.749] (-1082.595) (-1081.186) (-1086.236) * (-1080.842) (-1081.880) (-1084.051) [-1084.816] -- 0:00:41 301000 -- (-1081.777) [-1083.115] (-1081.743) (-1086.181) * (-1082.641) (-1081.914) [-1081.904] (-1088.413) -- 0:00:41 301500 -- (-1082.798) [-1081.731] (-1081.507) (-1083.216) * [-1083.733] (-1080.872) (-1081.908) (-1086.055) -- 0:00:41 302000 -- (-1083.199) (-1083.205) (-1085.581) [-1083.272] * (-1082.373) (-1081.759) [-1081.515] (-1082.872) -- 0:00:41 302500 -- (-1081.839) (-1081.902) [-1085.630] (-1083.022) * (-1081.122) (-1081.913) (-1081.517) [-1084.066] -- 0:00:41 303000 -- [-1082.672] (-1081.298) (-1081.011) (-1085.380) * (-1083.660) (-1084.872) (-1082.016) [-1084.745] -- 0:00:41 303500 -- (-1082.854) (-1081.326) (-1083.238) [-1082.608] * (-1082.947) (-1080.833) (-1083.918) [-1083.644] -- 0:00:41 304000 -- (-1081.676) (-1082.502) [-1081.625] (-1080.938) * (-1081.402) [-1083.669] (-1082.551) (-1085.351) -- 0:00:41 304500 -- [-1082.023] (-1082.342) (-1081.494) (-1081.588) * [-1084.823] (-1083.847) (-1083.874) (-1084.259) -- 0:00:41 305000 -- (-1083.468) (-1082.277) (-1081.806) [-1081.296] * (-1083.789) (-1084.796) (-1081.941) [-1083.217] -- 0:00:41 Average standard deviation of split frequencies: 0.015043 305500 -- (-1087.194) (-1082.078) [-1081.723] (-1081.092) * [-1083.865] (-1084.697) (-1086.215) (-1082.489) -- 0:00:43 306000 -- (-1086.157) (-1081.139) [-1084.793] (-1081.365) * [-1085.272] (-1084.883) (-1082.234) (-1087.557) -- 0:00:43 306500 -- (-1083.323) (-1085.862) (-1082.089) [-1081.059] * (-1082.649) [-1084.527] (-1081.331) (-1085.027) -- 0:00:42 307000 -- (-1082.665) (-1082.833) [-1081.659] (-1082.216) * (-1084.350) (-1083.606) [-1081.840] (-1082.399) -- 0:00:42 307500 -- (-1086.767) (-1082.525) [-1082.689] (-1082.944) * (-1081.593) [-1086.182] (-1083.511) (-1082.547) -- 0:00:42 308000 -- (-1081.832) (-1082.997) (-1085.182) [-1082.696] * (-1082.907) [-1082.318] (-1085.192) (-1086.179) -- 0:00:42 308500 -- (-1081.386) (-1082.386) (-1083.485) [-1085.449] * [-1082.031] (-1084.964) (-1086.511) (-1081.484) -- 0:00:42 309000 -- (-1081.748) (-1082.403) (-1083.191) [-1084.287] * [-1081.202] (-1084.644) (-1084.600) (-1084.244) -- 0:00:42 309500 -- [-1082.070] (-1083.260) (-1082.341) (-1083.753) * (-1081.078) (-1084.317) (-1082.969) [-1083.840] -- 0:00:42 310000 -- [-1083.591] (-1085.227) (-1085.016) (-1082.719) * (-1083.749) [-1088.704] (-1083.751) (-1083.938) -- 0:00:42 Average standard deviation of split frequencies: 0.015079 310500 -- (-1083.865) [-1081.783] (-1081.891) (-1086.141) * (-1082.405) [-1082.833] (-1081.817) (-1081.933) -- 0:00:42 311000 -- (-1082.936) (-1083.572) [-1084.049] (-1083.027) * [-1082.555] (-1083.556) (-1081.692) (-1081.961) -- 0:00:42 311500 -- [-1085.143] (-1083.847) (-1083.496) (-1083.301) * (-1083.609) [-1081.878] (-1083.266) (-1085.306) -- 0:00:41 312000 -- (-1086.430) (-1084.370) (-1082.036) [-1083.544] * (-1084.336) [-1081.790] (-1081.849) (-1082.906) -- 0:00:41 312500 -- (-1081.035) [-1083.977] (-1081.690) (-1083.226) * (-1086.363) [-1083.218] (-1084.052) (-1081.921) -- 0:00:41 313000 -- (-1080.889) (-1082.813) [-1081.834] (-1081.834) * (-1082.393) (-1082.816) (-1084.636) [-1081.367] -- 0:00:41 313500 -- (-1083.754) (-1085.587) (-1083.686) [-1082.353] * (-1083.888) (-1082.949) (-1084.777) [-1084.914] -- 0:00:41 314000 -- (-1085.405) (-1083.746) [-1090.018] (-1084.901) * (-1083.680) [-1083.892] (-1083.407) (-1082.355) -- 0:00:41 314500 -- (-1082.721) (-1082.439) [-1084.529] (-1086.681) * (-1081.112) (-1083.216) (-1082.857) [-1083.943] -- 0:00:41 315000 -- [-1083.880] (-1083.707) (-1090.286) (-1082.088) * (-1081.530) (-1083.956) (-1081.782) [-1083.231] -- 0:00:41 Average standard deviation of split frequencies: 0.014825 315500 -- [-1082.022] (-1081.972) (-1087.719) (-1081.851) * [-1082.222] (-1082.789) (-1082.474) (-1084.845) -- 0:00:41 316000 -- [-1082.983] (-1081.707) (-1086.860) (-1082.548) * (-1081.391) [-1082.181] (-1082.322) (-1085.679) -- 0:00:41 316500 -- [-1081.963] (-1081.939) (-1081.647) (-1082.609) * [-1085.288] (-1082.846) (-1084.666) (-1084.536) -- 0:00:41 317000 -- [-1083.546] (-1081.183) (-1090.429) (-1082.399) * (-1083.516) (-1084.081) [-1085.148] (-1081.135) -- 0:00:40 317500 -- (-1081.651) (-1082.146) (-1082.789) [-1083.191] * [-1083.119] (-1086.573) (-1085.275) (-1081.482) -- 0:00:40 318000 -- (-1082.653) (-1083.739) [-1081.973] (-1084.037) * [-1083.002] (-1089.861) (-1081.714) (-1083.133) -- 0:00:40 318500 -- (-1087.114) (-1084.391) [-1081.428] (-1082.237) * (-1086.289) (-1082.274) [-1085.028] (-1082.694) -- 0:00:40 319000 -- (-1082.903) [-1087.462] (-1081.441) (-1083.142) * (-1083.191) [-1084.310] (-1083.499) (-1083.642) -- 0:00:40 319500 -- (-1091.163) (-1083.107) [-1083.376] (-1084.022) * (-1081.795) [-1081.447] (-1084.552) (-1081.585) -- 0:00:40 320000 -- (-1082.061) (-1082.304) [-1089.084] (-1084.569) * (-1082.509) (-1085.366) [-1083.250] (-1083.948) -- 0:00:40 Average standard deviation of split frequencies: 0.014517 320500 -- (-1084.777) (-1081.400) [-1082.436] (-1083.126) * (-1081.245) (-1081.346) [-1082.867] (-1083.663) -- 0:00:40 321000 -- (-1083.978) [-1080.863] (-1083.821) (-1082.691) * [-1081.861] (-1081.982) (-1082.405) (-1082.502) -- 0:00:40 321500 -- (-1090.200) (-1082.516) (-1082.022) [-1081.060] * (-1081.722) (-1082.200) [-1082.764] (-1082.329) -- 0:00:40 322000 -- (-1089.254) (-1081.493) [-1082.200] (-1082.470) * (-1081.741) (-1081.668) (-1085.566) [-1082.846] -- 0:00:42 322500 -- [-1082.621] (-1080.984) (-1081.097) (-1082.670) * [-1081.703] (-1081.674) (-1082.610) (-1082.474) -- 0:00:42 323000 -- (-1081.881) [-1082.456] (-1082.356) (-1082.463) * [-1082.663] (-1085.580) (-1084.225) (-1081.852) -- 0:00:41 323500 -- (-1082.375) [-1083.703] (-1084.947) (-1084.438) * [-1083.736] (-1083.210) (-1082.472) (-1085.139) -- 0:00:41 324000 -- (-1081.927) (-1084.615) (-1083.434) [-1084.750] * (-1083.365) (-1082.744) (-1082.289) [-1081.374] -- 0:00:41 324500 -- (-1083.753) (-1083.516) (-1082.883) [-1082.210] * (-1083.164) (-1081.788) (-1081.820) [-1085.058] -- 0:00:41 325000 -- (-1082.194) (-1084.975) (-1083.201) [-1082.189] * (-1086.104) (-1081.938) [-1084.586] (-1082.566) -- 0:00:41 Average standard deviation of split frequencies: 0.014375 325500 -- (-1085.524) (-1086.018) [-1084.582] (-1081.293) * [-1084.938] (-1084.954) (-1081.806) (-1082.114) -- 0:00:41 326000 -- (-1081.376) (-1082.620) [-1081.124] (-1082.533) * (-1085.334) (-1084.743) (-1082.914) [-1081.994] -- 0:00:41 326500 -- (-1088.661) (-1080.938) [-1081.746] (-1085.708) * (-1083.202) (-1086.674) [-1081.966] (-1081.994) -- 0:00:41 327000 -- [-1085.489] (-1081.363) (-1085.303) (-1082.539) * [-1086.564] (-1083.692) (-1080.686) (-1082.954) -- 0:00:41 327500 -- (-1082.199) [-1083.244] (-1088.212) (-1082.730) * (-1083.485) [-1088.458] (-1081.397) (-1081.699) -- 0:00:41 328000 -- (-1082.188) [-1084.046] (-1084.686) (-1084.568) * [-1083.332] (-1082.116) (-1086.804) (-1086.514) -- 0:00:40 328500 -- (-1084.202) (-1084.991) (-1082.749) [-1083.581] * (-1083.172) [-1081.670] (-1082.517) (-1091.133) -- 0:00:40 329000 -- (-1085.282) (-1086.657) [-1083.745] (-1084.107) * [-1083.411] (-1081.684) (-1083.068) (-1090.078) -- 0:00:40 329500 -- (-1085.083) [-1084.770] (-1081.436) (-1083.648) * (-1083.534) (-1088.148) [-1082.941] (-1087.287) -- 0:00:40 330000 -- (-1084.355) [-1085.358] (-1082.877) (-1081.267) * (-1083.206) (-1086.346) [-1082.678] (-1084.930) -- 0:00:40 Average standard deviation of split frequencies: 0.014843 330500 -- (-1082.648) (-1084.784) (-1082.713) [-1081.506] * (-1082.412) [-1087.050] (-1083.542) (-1086.138) -- 0:00:40 331000 -- (-1087.337) (-1082.501) [-1081.506] (-1082.004) * [-1081.582] (-1081.985) (-1084.557) (-1084.017) -- 0:00:40 331500 -- (-1085.730) (-1082.836) [-1081.321] (-1089.012) * [-1082.253] (-1083.569) (-1083.111) (-1083.313) -- 0:00:40 332000 -- (-1083.280) (-1084.947) [-1081.295] (-1082.314) * (-1082.249) [-1081.365] (-1085.753) (-1083.260) -- 0:00:40 332500 -- (-1083.347) (-1084.619) (-1081.703) [-1086.308] * (-1082.218) (-1083.433) [-1082.993] (-1085.621) -- 0:00:40 333000 -- (-1084.891) [-1087.690] (-1082.961) (-1091.016) * (-1083.388) [-1081.165] (-1081.094) (-1082.856) -- 0:00:40 333500 -- (-1084.394) (-1084.860) (-1082.525) [-1084.017] * (-1085.660) (-1084.130) [-1080.992] (-1082.967) -- 0:00:39 334000 -- [-1083.107] (-1081.333) (-1082.857) (-1084.854) * (-1085.434) (-1082.177) (-1081.253) [-1083.677] -- 0:00:39 334500 -- (-1081.405) (-1084.435) (-1082.773) [-1083.873] * (-1084.675) (-1081.995) (-1081.557) [-1083.423] -- 0:00:39 335000 -- [-1081.350] (-1083.196) (-1085.657) (-1081.765) * (-1082.703) [-1081.793] (-1083.570) (-1083.013) -- 0:00:39 Average standard deviation of split frequencies: 0.014907 335500 -- [-1081.290] (-1084.819) (-1085.022) (-1082.312) * (-1085.681) (-1081.915) [-1084.761] (-1082.490) -- 0:00:39 336000 -- (-1083.217) (-1081.133) (-1080.870) [-1089.278] * (-1084.279) (-1082.118) (-1083.806) [-1080.907] -- 0:00:39 336500 -- (-1088.725) (-1083.716) (-1082.016) [-1082.748] * (-1086.642) (-1082.431) [-1082.017] (-1081.050) -- 0:00:39 337000 -- (-1082.471) (-1085.070) [-1081.630] (-1082.570) * (-1085.279) (-1081.061) [-1083.969] (-1081.214) -- 0:00:39 337500 -- (-1082.542) (-1082.456) [-1081.746] (-1081.624) * (-1083.516) (-1086.643) [-1082.042] (-1081.648) -- 0:00:39 338000 -- (-1082.439) (-1088.330) (-1082.479) [-1081.279] * (-1081.894) (-1083.663) (-1084.230) [-1082.265] -- 0:00:41 338500 -- [-1083.350] (-1082.046) (-1080.909) (-1085.527) * (-1083.927) (-1082.962) (-1084.332) [-1082.712] -- 0:00:41 339000 -- (-1085.113) [-1087.214] (-1081.429) (-1083.983) * (-1083.164) (-1082.985) (-1081.740) [-1083.724] -- 0:00:40 339500 -- (-1081.655) [-1082.428] (-1085.890) (-1084.985) * (-1083.525) (-1082.864) (-1081.933) [-1083.538] -- 0:00:40 340000 -- [-1081.642] (-1087.015) (-1084.024) (-1081.884) * (-1081.382) (-1082.720) (-1080.905) [-1081.653] -- 0:00:40 Average standard deviation of split frequencies: 0.014789 340500 -- (-1081.991) [-1081.732] (-1083.942) (-1083.632) * (-1082.964) (-1086.391) [-1084.749] (-1083.560) -- 0:00:40 341000 -- (-1082.855) [-1081.903] (-1083.820) (-1084.723) * (-1082.839) [-1086.050] (-1082.151) (-1084.688) -- 0:00:40 341500 -- [-1082.021] (-1082.320) (-1082.008) (-1084.911) * [-1081.728] (-1083.098) (-1083.988) (-1082.033) -- 0:00:40 342000 -- [-1084.693] (-1081.705) (-1082.873) (-1086.997) * (-1082.441) [-1080.955] (-1082.353) (-1085.714) -- 0:00:40 342500 -- (-1084.661) (-1081.845) [-1082.801] (-1084.509) * (-1081.390) (-1080.804) (-1083.465) [-1085.286] -- 0:00:40 343000 -- (-1084.553) (-1082.299) [-1086.964] (-1085.239) * (-1080.741) (-1082.524) (-1082.009) [-1082.514] -- 0:00:40 343500 -- (-1085.417) (-1083.557) (-1083.770) [-1082.938] * (-1080.741) [-1082.336] (-1083.483) (-1083.291) -- 0:00:40 344000 -- (-1084.365) (-1087.332) (-1082.612) [-1083.623] * [-1081.714] (-1083.687) (-1085.869) (-1083.941) -- 0:00:40 344500 -- [-1083.713] (-1087.229) (-1083.461) (-1082.065) * (-1081.348) (-1087.426) (-1085.830) [-1083.579] -- 0:00:39 345000 -- (-1087.635) (-1083.960) (-1083.394) [-1084.987] * (-1081.992) (-1082.671) (-1088.779) [-1083.780] -- 0:00:39 Average standard deviation of split frequencies: 0.014391 345500 -- [-1083.039] (-1082.660) (-1083.127) (-1089.102) * (-1081.847) [-1083.211] (-1085.105) (-1081.026) -- 0:00:39 346000 -- (-1083.697) (-1085.357) (-1082.409) [-1084.955] * (-1082.533) (-1086.784) (-1086.725) [-1081.588] -- 0:00:39 346500 -- (-1082.647) (-1085.653) [-1083.045] (-1084.220) * (-1086.013) (-1084.126) [-1081.417] (-1083.418) -- 0:00:39 347000 -- (-1083.855) (-1091.077) (-1082.624) [-1083.084] * (-1082.187) (-1082.904) [-1082.085] (-1082.859) -- 0:00:39 347500 -- (-1083.019) (-1085.244) (-1081.534) [-1082.364] * (-1082.274) (-1082.456) [-1082.438] (-1084.190) -- 0:00:39 348000 -- (-1082.534) (-1085.913) [-1081.381] (-1082.914) * (-1084.277) (-1082.487) (-1081.597) [-1083.959] -- 0:00:39 348500 -- (-1085.731) (-1084.788) [-1081.539] (-1081.794) * (-1085.297) (-1081.893) (-1083.571) [-1081.987] -- 0:00:39 349000 -- [-1089.242] (-1084.385) (-1084.907) (-1083.902) * (-1082.644) (-1082.588) (-1082.846) [-1084.034] -- 0:00:39 349500 -- [-1082.866] (-1090.652) (-1087.041) (-1084.315) * [-1081.568] (-1081.633) (-1084.783) (-1083.125) -- 0:00:39 350000 -- (-1083.389) (-1082.734) [-1083.463] (-1083.484) * [-1081.533] (-1082.672) (-1082.718) (-1082.836) -- 0:00:39 Average standard deviation of split frequencies: 0.013611 350500 -- (-1082.455) [-1082.141] (-1082.708) (-1083.705) * (-1081.258) [-1083.405] (-1086.210) (-1083.353) -- 0:00:38 351000 -- (-1081.965) [-1081.678] (-1081.746) (-1085.568) * (-1083.565) (-1084.054) [-1084.952] (-1082.739) -- 0:00:38 351500 -- (-1083.611) (-1081.456) (-1081.889) [-1088.501] * [-1082.751] (-1084.594) (-1081.839) (-1086.678) -- 0:00:38 352000 -- (-1085.865) (-1081.937) (-1081.872) [-1087.595] * (-1080.864) (-1086.978) [-1086.053] (-1086.267) -- 0:00:38 352500 -- (-1084.336) (-1083.697) [-1081.502] (-1088.520) * [-1081.944] (-1088.765) (-1086.615) (-1083.064) -- 0:00:38 353000 -- (-1084.160) [-1083.810] (-1084.470) (-1087.615) * (-1082.654) [-1088.602] (-1083.478) (-1082.901) -- 0:00:38 353500 -- [-1081.942] (-1083.647) (-1082.769) (-1085.921) * (-1082.086) (-1084.011) [-1086.558] (-1082.388) -- 0:00:38 354000 -- (-1082.016) (-1086.329) [-1087.156] (-1082.646) * (-1083.538) (-1082.477) (-1081.430) [-1082.855] -- 0:00:38 354500 -- [-1084.999] (-1084.182) (-1082.874) (-1083.479) * (-1083.019) (-1083.112) [-1081.957] (-1081.963) -- 0:00:40 355000 -- (-1083.199) [-1082.926] (-1083.443) (-1084.925) * (-1083.517) (-1082.882) [-1082.131] (-1081.262) -- 0:00:39 Average standard deviation of split frequencies: 0.014318 355500 -- (-1082.297) (-1082.845) [-1082.151] (-1087.395) * (-1082.028) (-1082.925) (-1083.344) [-1085.363] -- 0:00:39 356000 -- [-1082.778] (-1082.260) (-1082.149) (-1085.941) * (-1084.939) [-1082.428] (-1082.371) (-1086.412) -- 0:00:39 356500 -- (-1084.627) (-1081.632) (-1084.757) [-1083.044] * (-1087.294) [-1084.239] (-1084.075) (-1083.408) -- 0:00:39 357000 -- (-1085.296) (-1084.999) [-1082.439] (-1088.533) * (-1087.385) (-1084.378) (-1083.041) [-1082.770] -- 0:00:39 357500 -- (-1082.108) (-1083.183) (-1082.852) [-1083.942] * (-1085.085) [-1084.595] (-1082.045) (-1082.041) -- 0:00:39 358000 -- (-1083.957) (-1083.586) (-1093.848) [-1083.555] * (-1083.496) [-1084.835] (-1082.757) (-1081.579) -- 0:00:39 358500 -- (-1085.257) [-1081.216] (-1085.639) (-1082.460) * (-1083.409) [-1084.527] (-1081.302) (-1083.165) -- 0:00:39 359000 -- (-1084.508) (-1082.623) [-1085.205] (-1083.910) * (-1081.385) (-1084.395) (-1082.444) [-1083.654] -- 0:00:39 359500 -- (-1083.557) [-1082.418] (-1082.256) (-1084.422) * (-1081.321) (-1083.195) [-1083.215] (-1082.806) -- 0:00:39 360000 -- (-1082.016) [-1081.906] (-1083.432) (-1084.593) * (-1083.558) (-1085.132) [-1088.646] (-1088.086) -- 0:00:39 Average standard deviation of split frequencies: 0.015113 360500 -- (-1082.020) (-1083.067) [-1083.774] (-1084.276) * (-1085.474) (-1086.649) (-1084.301) [-1089.201] -- 0:00:39 361000 -- (-1082.084) (-1084.479) [-1081.834] (-1084.276) * [-1083.845] (-1082.574) (-1082.700) (-1082.352) -- 0:00:38 361500 -- (-1082.171) [-1083.107] (-1082.370) (-1084.385) * [-1084.266] (-1084.415) (-1082.640) (-1082.987) -- 0:00:38 362000 -- (-1084.615) (-1083.668) (-1082.035) [-1086.526] * (-1085.682) [-1082.131] (-1085.346) (-1082.991) -- 0:00:38 362500 -- [-1086.575] (-1081.515) (-1082.143) (-1081.478) * (-1081.186) (-1082.949) (-1081.328) [-1085.680] -- 0:00:38 363000 -- [-1082.556] (-1081.600) (-1083.313) (-1081.213) * [-1083.425] (-1082.700) (-1083.257) (-1087.980) -- 0:00:38 363500 -- [-1084.292] (-1081.731) (-1083.332) (-1081.882) * (-1081.548) (-1081.740) (-1086.244) [-1083.784] -- 0:00:38 364000 -- (-1086.776) (-1081.934) [-1082.371] (-1082.094) * (-1082.787) (-1084.693) (-1084.179) [-1083.406] -- 0:00:38 364500 -- (-1083.230) (-1083.100) (-1080.768) [-1085.128] * (-1082.965) (-1081.455) (-1085.312) [-1080.981] -- 0:00:38 365000 -- (-1083.270) (-1083.946) [-1082.960] (-1081.841) * (-1082.312) (-1086.335) (-1082.560) [-1082.742] -- 0:00:38 Average standard deviation of split frequencies: 0.014698 365500 -- [-1083.169] (-1084.141) (-1081.322) (-1082.637) * [-1081.009] (-1086.082) (-1083.537) (-1083.031) -- 0:00:38 366000 -- (-1083.931) (-1084.612) [-1085.374] (-1082.602) * [-1082.143] (-1085.218) (-1082.017) (-1082.816) -- 0:00:38 366500 -- (-1085.867) (-1084.922) [-1082.710] (-1085.690) * (-1081.375) (-1086.338) [-1081.970] (-1082.415) -- 0:00:38 367000 -- (-1084.837) (-1082.011) (-1083.180) [-1086.910] * (-1081.282) [-1082.215] (-1082.363) (-1088.416) -- 0:00:37 367500 -- [-1084.017] (-1085.971) (-1085.109) (-1081.716) * [-1081.255] (-1081.956) (-1086.558) (-1082.060) -- 0:00:37 368000 -- (-1082.909) (-1083.218) (-1081.521) [-1081.753] * (-1083.898) (-1084.826) [-1083.599] (-1081.880) -- 0:00:37 368500 -- (-1083.073) [-1081.675] (-1083.608) (-1081.551) * (-1082.183) [-1083.897] (-1082.837) (-1082.161) -- 0:00:37 369000 -- (-1082.776) [-1082.298] (-1084.341) (-1081.616) * (-1084.505) (-1081.510) [-1082.036] (-1085.642) -- 0:00:37 369500 -- (-1082.602) (-1083.328) (-1083.802) [-1084.654] * (-1087.921) (-1081.560) (-1083.285) [-1082.790] -- 0:00:39 370000 -- [-1081.932] (-1083.542) (-1083.148) (-1084.922) * (-1087.440) (-1080.935) [-1082.423] (-1082.588) -- 0:00:39 Average standard deviation of split frequencies: 0.013990 370500 -- [-1081.756] (-1084.505) (-1083.186) (-1086.240) * (-1082.415) (-1080.976) [-1083.651] (-1082.569) -- 0:00:39 371000 -- (-1082.838) (-1081.504) (-1088.265) [-1084.100] * (-1082.868) [-1081.647] (-1083.341) (-1083.008) -- 0:00:38 371500 -- (-1082.869) [-1082.997] (-1083.118) (-1082.700) * (-1085.667) [-1081.402] (-1085.126) (-1084.327) -- 0:00:38 372000 -- (-1084.517) (-1084.139) [-1082.039] (-1085.717) * (-1082.405) (-1081.749) (-1086.572) [-1082.149] -- 0:00:38 372500 -- [-1082.588] (-1082.778) (-1080.777) (-1085.332) * (-1083.893) (-1087.605) (-1086.741) [-1082.370] -- 0:00:38 373000 -- [-1083.292] (-1091.483) (-1081.808) (-1084.928) * (-1082.215) [-1085.871] (-1085.483) (-1082.357) -- 0:00:38 373500 -- (-1081.711) (-1082.379) [-1081.633] (-1095.154) * (-1084.258) (-1086.719) (-1083.251) [-1084.782] -- 0:00:38 374000 -- (-1081.498) (-1081.232) (-1081.708) [-1083.405] * (-1085.983) (-1084.863) (-1083.058) [-1084.957] -- 0:00:38 374500 -- (-1081.957) (-1085.120) [-1082.536] (-1081.939) * (-1084.350) (-1087.043) (-1087.625) [-1083.568] -- 0:00:38 375000 -- (-1083.694) [-1085.191] (-1082.660) (-1083.223) * (-1082.402) (-1089.902) (-1082.594) [-1082.898] -- 0:00:38 Average standard deviation of split frequencies: 0.014012 375500 -- (-1081.290) (-1088.280) [-1086.728] (-1086.649) * (-1082.138) (-1082.419) (-1080.894) [-1082.733] -- 0:00:38 376000 -- [-1081.283] (-1081.376) (-1083.806) (-1084.374) * (-1082.305) (-1085.242) [-1081.982] (-1084.168) -- 0:00:38 376500 -- (-1081.743) (-1082.234) [-1082.920] (-1085.376) * [-1083.073] (-1082.011) (-1084.755) (-1084.323) -- 0:00:38 377000 -- (-1084.677) [-1082.666] (-1084.208) (-1084.425) * (-1083.121) (-1084.712) [-1084.400] (-1083.454) -- 0:00:38 377500 -- (-1086.196) (-1086.449) (-1083.835) [-1084.570] * (-1082.064) (-1081.581) [-1083.385] (-1081.586) -- 0:00:37 378000 -- (-1082.804) [-1083.739] (-1084.506) (-1084.861) * (-1085.829) (-1083.401) (-1085.041) [-1085.684] -- 0:00:37 378500 -- (-1080.989) (-1082.224) [-1084.461] (-1084.585) * (-1085.146) (-1084.790) (-1083.415) [-1081.269] -- 0:00:37 379000 -- (-1083.448) (-1084.302) [-1082.445] (-1085.775) * (-1081.750) (-1084.565) [-1081.895] (-1082.211) -- 0:00:37 379500 -- [-1084.035] (-1087.142) (-1082.128) (-1082.067) * [-1080.998] (-1083.333) (-1082.619) (-1081.812) -- 0:00:37 380000 -- (-1082.553) (-1084.249) (-1081.851) [-1081.521] * (-1081.053) (-1083.499) [-1082.500] (-1083.174) -- 0:00:37 Average standard deviation of split frequencies: 0.014059 380500 -- (-1087.362) (-1083.723) [-1082.042] (-1081.743) * (-1082.582) (-1086.030) (-1086.640) [-1084.307] -- 0:00:37 381000 -- (-1082.880) (-1082.901) (-1087.735) [-1084.540] * [-1081.919] (-1086.021) (-1083.385) (-1085.869) -- 0:00:37 381500 -- (-1081.762) (-1083.248) [-1085.222] (-1084.862) * (-1081.919) (-1087.234) [-1081.664] (-1083.630) -- 0:00:37 382000 -- (-1080.996) (-1082.761) (-1082.501) [-1081.377] * (-1085.400) [-1081.354] (-1083.560) (-1088.631) -- 0:00:37 382500 -- (-1081.657) (-1084.128) (-1082.462) [-1081.931] * (-1085.780) [-1083.465] (-1084.749) (-1088.038) -- 0:00:37 383000 -- [-1081.494] (-1085.048) (-1081.980) (-1085.160) * (-1083.370) (-1094.391) (-1085.951) [-1084.200] -- 0:00:37 383500 -- [-1081.759] (-1086.036) (-1082.640) (-1084.277) * [-1081.667] (-1084.280) (-1086.918) (-1084.335) -- 0:00:36 384000 -- (-1083.849) (-1085.756) [-1082.584] (-1084.388) * [-1083.932] (-1085.402) (-1085.553) (-1084.178) -- 0:00:36 384500 -- [-1086.206] (-1087.458) (-1082.662) (-1084.409) * (-1085.725) [-1085.044] (-1084.536) (-1086.059) -- 0:00:36 385000 -- (-1083.063) (-1083.554) (-1081.725) [-1084.025] * (-1086.011) (-1086.699) (-1084.702) [-1085.338] -- 0:00:36 Average standard deviation of split frequencies: 0.013793 385500 -- (-1084.461) (-1084.496) (-1083.324) [-1082.417] * (-1083.651) (-1082.443) [-1083.879] (-1091.581) -- 0:00:38 386000 -- (-1084.481) [-1084.683] (-1082.505) (-1083.281) * (-1081.331) (-1081.177) [-1084.053] (-1084.674) -- 0:00:38 386500 -- [-1084.802] (-1082.356) (-1085.363) (-1083.030) * [-1082.938] (-1085.031) (-1085.181) (-1081.873) -- 0:00:38 387000 -- (-1082.205) (-1085.321) (-1085.086) [-1083.685] * [-1083.060] (-1083.942) (-1085.377) (-1081.974) -- 0:00:38 387500 -- (-1082.074) (-1084.276) (-1084.436) [-1088.990] * (-1081.993) (-1085.776) [-1083.245] (-1085.110) -- 0:00:37 388000 -- (-1084.599) (-1083.812) (-1082.914) [-1081.991] * (-1082.616) (-1082.650) [-1082.127] (-1080.925) -- 0:00:37 388500 -- [-1081.461] (-1082.678) (-1083.800) (-1082.266) * (-1082.893) (-1085.167) [-1081.145] (-1081.399) -- 0:00:37 389000 -- [-1083.667] (-1082.606) (-1083.026) (-1082.266) * (-1089.062) (-1083.288) (-1081.038) [-1081.177] -- 0:00:37 389500 -- [-1083.930] (-1083.254) (-1083.581) (-1083.707) * (-1083.897) (-1088.332) [-1082.902] (-1087.314) -- 0:00:37 390000 -- [-1081.905] (-1083.162) (-1082.613) (-1082.938) * (-1087.657) (-1085.615) [-1084.453] (-1088.946) -- 0:00:37 Average standard deviation of split frequencies: 0.013557 390500 -- (-1086.280) (-1084.447) (-1081.525) [-1083.425] * (-1083.650) (-1088.916) [-1081.580] (-1086.212) -- 0:00:37 391000 -- (-1086.546) [-1082.839] (-1082.377) (-1084.323) * (-1085.293) (-1082.950) [-1082.509] (-1084.995) -- 0:00:37 391500 -- (-1084.202) [-1083.636] (-1081.110) (-1082.477) * (-1083.736) [-1082.915] (-1085.384) (-1082.370) -- 0:00:37 392000 -- (-1085.461) (-1082.403) (-1081.033) [-1082.505] * (-1083.346) (-1082.990) [-1082.296] (-1084.193) -- 0:00:37 392500 -- (-1083.853) (-1087.040) (-1082.465) [-1084.172] * (-1087.136) [-1082.521] (-1082.138) (-1083.017) -- 0:00:37 393000 -- (-1081.674) (-1085.922) [-1086.760] (-1086.675) * (-1086.940) [-1082.589] (-1085.346) (-1082.076) -- 0:00:37 393500 -- [-1083.928] (-1084.055) (-1084.048) (-1084.383) * (-1084.823) [-1083.853] (-1092.081) (-1083.018) -- 0:00:36 394000 -- (-1084.454) (-1082.433) (-1083.682) [-1082.618] * (-1083.055) [-1082.457] (-1085.861) (-1084.694) -- 0:00:36 394500 -- [-1083.083] (-1082.290) (-1082.779) (-1081.398) * [-1083.043] (-1081.574) (-1086.491) (-1086.308) -- 0:00:36 395000 -- (-1082.583) [-1082.734] (-1081.763) (-1081.219) * (-1083.437) [-1082.227] (-1082.782) (-1082.994) -- 0:00:36 Average standard deviation of split frequencies: 0.012814 395500 -- (-1083.454) [-1083.047] (-1082.080) (-1083.507) * [-1081.416] (-1085.429) (-1080.905) (-1085.566) -- 0:00:36 396000 -- (-1084.519) (-1081.409) [-1081.477] (-1084.443) * (-1081.436) [-1083.173] (-1085.296) (-1083.304) -- 0:00:36 396500 -- (-1083.953) (-1082.522) [-1081.511] (-1086.733) * [-1081.044] (-1083.458) (-1084.778) (-1081.452) -- 0:00:36 397000 -- (-1082.611) [-1083.352] (-1087.655) (-1084.497) * (-1082.515) (-1080.837) [-1081.524] (-1083.089) -- 0:00:36 397500 -- (-1082.076) [-1081.702] (-1086.230) (-1083.295) * (-1088.497) [-1082.572] (-1081.658) (-1083.416) -- 0:00:36 398000 -- [-1081.312] (-1081.822) (-1084.516) (-1082.926) * [-1087.922] (-1085.112) (-1081.820) (-1082.283) -- 0:00:36 398500 -- (-1080.993) (-1081.578) [-1083.468] (-1083.007) * (-1083.708) (-1084.882) (-1083.114) [-1081.754] -- 0:00:36 399000 -- (-1083.069) [-1080.720] (-1086.851) (-1083.175) * (-1082.576) (-1086.256) (-1084.652) [-1082.021] -- 0:00:36 399500 -- (-1083.442) [-1082.386] (-1084.150) (-1084.359) * (-1081.824) [-1083.521] (-1084.417) (-1081.818) -- 0:00:36 400000 -- (-1085.812) (-1086.031) [-1084.965] (-1081.438) * (-1081.882) (-1082.419) (-1082.985) [-1081.851] -- 0:00:36 Average standard deviation of split frequencies: 0.013150 400500 -- (-1084.027) (-1086.824) [-1084.648] (-1082.416) * (-1082.091) [-1084.702] (-1084.520) (-1081.441) -- 0:00:35 401000 -- [-1083.600] (-1085.411) (-1086.193) (-1084.531) * (-1081.750) (-1084.689) [-1082.750] (-1082.125) -- 0:00:35 401500 -- (-1082.497) [-1081.517] (-1083.689) (-1084.169) * (-1083.417) [-1084.557] (-1081.363) (-1085.233) -- 0:00:35 402000 -- [-1083.771] (-1081.992) (-1083.296) (-1089.552) * (-1081.940) [-1082.139] (-1081.663) (-1084.959) -- 0:00:37 402500 -- [-1084.503] (-1081.349) (-1084.485) (-1082.627) * (-1081.684) (-1081.598) [-1082.287] (-1084.525) -- 0:00:37 403000 -- (-1084.192) (-1082.934) (-1081.646) [-1080.734] * (-1081.032) (-1082.874) (-1081.225) [-1086.077] -- 0:00:37 403500 -- (-1087.454) [-1080.700] (-1081.613) (-1083.266) * [-1081.032] (-1081.066) (-1082.317) (-1084.227) -- 0:00:36 404000 -- (-1086.076) [-1080.712] (-1081.790) (-1083.568) * [-1082.170] (-1082.434) (-1083.075) (-1084.158) -- 0:00:36 404500 -- (-1085.836) (-1081.022) [-1082.201] (-1087.344) * [-1082.554] (-1092.702) (-1085.236) (-1082.151) -- 0:00:36 405000 -- (-1085.921) [-1081.708] (-1084.917) (-1087.355) * (-1083.339) [-1084.490] (-1086.228) (-1082.878) -- 0:00:36 Average standard deviation of split frequencies: 0.012294 405500 -- (-1084.340) (-1081.703) (-1082.783) [-1084.658] * (-1085.951) (-1083.584) [-1082.587] (-1086.207) -- 0:00:36 406000 -- (-1082.803) (-1081.991) [-1081.745] (-1084.190) * (-1084.066) [-1083.183] (-1084.232) (-1083.838) -- 0:00:36 406500 -- [-1081.800] (-1085.684) (-1085.424) (-1086.350) * (-1081.627) [-1080.920] (-1083.740) (-1082.871) -- 0:00:36 407000 -- (-1082.428) (-1084.346) (-1081.604) [-1083.825] * (-1080.710) [-1084.278] (-1081.633) (-1085.570) -- 0:00:36 407500 -- (-1083.012) [-1081.203] (-1082.408) (-1082.817) * (-1081.502) (-1083.276) [-1084.216] (-1085.832) -- 0:00:36 408000 -- (-1082.165) [-1083.200] (-1082.501) (-1081.137) * (-1082.516) (-1084.408) (-1082.976) [-1084.972] -- 0:00:36 408500 -- (-1083.330) [-1082.214] (-1080.830) (-1082.428) * (-1083.124) [-1084.405] (-1083.293) (-1085.865) -- 0:00:36 409000 -- (-1082.917) [-1082.866] (-1084.500) (-1083.824) * [-1085.745] (-1082.797) (-1083.763) (-1083.617) -- 0:00:36 409500 -- [-1082.920] (-1083.368) (-1085.272) (-1084.704) * (-1083.966) [-1080.877] (-1083.209) (-1083.363) -- 0:00:36 410000 -- (-1083.282) (-1082.629) [-1083.029] (-1082.126) * (-1084.873) (-1084.794) [-1084.381] (-1087.207) -- 0:00:35 Average standard deviation of split frequencies: 0.012019 410500 -- [-1084.050] (-1084.622) (-1083.267) (-1086.770) * (-1082.920) (-1085.453) [-1084.225] (-1083.934) -- 0:00:35 411000 -- [-1083.411] (-1081.634) (-1084.094) (-1081.498) * (-1082.547) (-1083.859) (-1084.861) [-1082.478] -- 0:00:35 411500 -- (-1084.327) [-1081.398] (-1083.930) (-1082.439) * [-1082.085] (-1083.574) (-1082.800) (-1084.002) -- 0:00:35 412000 -- (-1088.051) [-1083.193] (-1081.432) (-1082.455) * (-1084.270) [-1082.764] (-1082.881) (-1083.282) -- 0:00:35 412500 -- (-1085.650) (-1083.760) (-1083.762) [-1081.480] * (-1084.867) [-1082.718] (-1082.121) (-1082.919) -- 0:00:35 413000 -- (-1081.867) (-1081.550) (-1088.384) [-1085.024] * (-1088.409) (-1081.838) [-1083.426] (-1084.575) -- 0:00:35 413500 -- (-1081.990) [-1081.677] (-1084.845) (-1089.341) * (-1081.592) [-1082.401] (-1082.351) (-1082.608) -- 0:00:35 414000 -- (-1082.548) (-1080.768) (-1081.759) [-1083.422] * (-1088.484) (-1082.695) (-1088.479) [-1082.089] -- 0:00:35 414500 -- (-1081.564) (-1084.049) [-1082.796] (-1085.845) * (-1083.879) (-1082.423) (-1083.207) [-1082.825] -- 0:00:35 415000 -- [-1081.083] (-1080.673) (-1084.194) (-1081.728) * (-1082.831) (-1090.024) (-1083.186) [-1083.675] -- 0:00:35 Average standard deviation of split frequencies: 0.013102 415500 -- (-1086.443) (-1080.975) [-1082.427] (-1084.214) * (-1081.030) [-1086.172] (-1081.774) (-1082.390) -- 0:00:35 416000 -- (-1082.151) [-1082.343] (-1082.036) (-1081.366) * (-1081.436) [-1082.948] (-1081.695) (-1081.935) -- 0:00:35 416500 -- (-1086.243) [-1081.787] (-1083.352) (-1080.840) * [-1081.219] (-1081.599) (-1081.719) (-1081.790) -- 0:00:35 417000 -- (-1081.331) [-1085.219] (-1085.487) (-1083.381) * (-1081.790) (-1080.754) (-1084.657) [-1081.870] -- 0:00:34 417500 -- (-1081.934) (-1083.408) [-1084.244] (-1085.780) * [-1082.083] (-1082.960) (-1081.772) (-1082.711) -- 0:00:34 418000 -- (-1082.280) (-1087.489) (-1081.692) [-1081.599] * (-1081.790) (-1085.709) [-1081.076] (-1084.854) -- 0:00:34 418500 -- (-1082.361) (-1083.310) [-1083.211] (-1087.466) * [-1081.757] (-1086.976) (-1082.733) (-1082.815) -- 0:00:34 419000 -- [-1083.189] (-1085.728) (-1086.415) (-1085.261) * (-1081.591) (-1085.700) [-1082.699] (-1081.325) -- 0:00:36 419500 -- (-1081.622) (-1085.650) (-1082.414) [-1081.339] * [-1080.880] (-1081.918) (-1084.426) (-1082.502) -- 0:00:35 420000 -- (-1081.791) [-1084.106] (-1082.342) (-1081.448) * (-1080.683) [-1082.103] (-1087.266) (-1081.973) -- 0:00:35 Average standard deviation of split frequencies: 0.013027 420500 -- [-1082.824] (-1088.328) (-1081.704) (-1081.768) * (-1083.682) (-1081.654) (-1082.811) [-1081.341] -- 0:00:35 421000 -- [-1081.472] (-1082.713) (-1086.022) (-1082.088) * (-1081.479) (-1082.260) [-1082.630] (-1083.633) -- 0:00:35 421500 -- (-1081.184) (-1081.499) (-1082.695) [-1084.271] * (-1082.087) (-1081.447) [-1082.404] (-1083.417) -- 0:00:35 422000 -- [-1081.495] (-1082.169) (-1082.914) (-1081.332) * (-1082.645) (-1084.023) (-1081.450) [-1082.085] -- 0:00:35 422500 -- [-1081.416] (-1083.945) (-1081.943) (-1083.264) * (-1080.786) (-1084.632) (-1086.739) [-1083.157] -- 0:00:35 423000 -- (-1083.511) (-1082.470) [-1081.130] (-1080.862) * (-1084.036) [-1083.581] (-1084.722) (-1084.107) -- 0:00:35 423500 -- (-1082.805) (-1085.392) (-1081.250) [-1082.960] * (-1082.491) (-1082.217) [-1084.232] (-1082.055) -- 0:00:35 424000 -- (-1084.048) (-1082.243) (-1083.191) [-1082.216] * (-1081.383) [-1086.265] (-1083.040) (-1083.895) -- 0:00:35 424500 -- [-1081.123] (-1087.331) (-1086.030) (-1082.645) * (-1084.133) (-1084.596) (-1082.819) [-1082.157] -- 0:00:35 425000 -- (-1081.840) (-1085.676) [-1081.596] (-1086.300) * (-1085.589) (-1084.690) [-1083.531] (-1081.974) -- 0:00:35 Average standard deviation of split frequencies: 0.011652 425500 -- (-1084.669) (-1083.175) (-1083.898) [-1081.502] * [-1083.540] (-1083.583) (-1081.024) (-1083.949) -- 0:00:35 426000 -- (-1087.197) (-1083.313) [-1081.688] (-1081.689) * (-1087.492) [-1080.963] (-1082.067) (-1085.818) -- 0:00:35 426500 -- [-1083.511] (-1083.515) (-1081.463) (-1082.778) * (-1081.049) (-1082.522) [-1084.158] (-1082.909) -- 0:00:34 427000 -- (-1082.573) (-1081.580) (-1082.078) [-1082.611] * (-1081.850) (-1084.931) [-1082.925] (-1082.226) -- 0:00:34 427500 -- [-1082.677] (-1084.165) (-1082.095) (-1082.459) * (-1081.779) (-1082.901) (-1082.221) [-1082.468] -- 0:00:34 428000 -- (-1083.622) (-1083.583) [-1081.382] (-1081.117) * [-1081.664] (-1083.073) (-1081.760) (-1082.594) -- 0:00:34 428500 -- [-1081.344] (-1082.436) (-1087.156) (-1087.452) * (-1081.451) (-1081.399) [-1081.636] (-1084.458) -- 0:00:34 429000 -- (-1081.866) (-1081.910) [-1082.373] (-1084.032) * (-1081.398) (-1081.574) [-1082.096] (-1091.497) -- 0:00:34 429500 -- (-1082.289) (-1082.760) (-1083.303) [-1082.989] * (-1083.947) [-1083.885] (-1081.559) (-1084.691) -- 0:00:34 430000 -- (-1082.753) (-1082.715) [-1081.778] (-1086.531) * (-1082.230) (-1083.887) (-1082.043) [-1086.602] -- 0:00:34 Average standard deviation of split frequencies: 0.011912 430500 -- [-1082.706] (-1083.141) (-1082.882) (-1084.395) * (-1081.967) (-1082.744) (-1082.092) [-1083.615] -- 0:00:34 431000 -- (-1087.133) [-1082.596] (-1084.010) (-1084.140) * [-1082.515] (-1082.751) (-1086.327) (-1084.650) -- 0:00:34 431500 -- (-1086.813) (-1086.697) [-1082.546] (-1084.031) * (-1082.660) [-1083.758] (-1089.873) (-1083.914) -- 0:00:34 432000 -- (-1081.136) (-1088.039) [-1083.981] (-1083.184) * (-1085.472) [-1083.644] (-1081.675) (-1086.102) -- 0:00:34 432500 -- (-1084.107) (-1087.498) [-1085.759] (-1081.795) * (-1082.889) (-1085.691) [-1082.018] (-1081.927) -- 0:00:34 433000 -- (-1085.129) [-1087.417] (-1083.349) (-1081.379) * (-1082.298) (-1085.242) [-1081.931] (-1081.637) -- 0:00:34 433500 -- (-1083.015) [-1081.676] (-1084.605) (-1082.157) * (-1085.745) [-1085.453] (-1083.385) (-1081.593) -- 0:00:33 434000 -- (-1082.509) (-1081.382) [-1083.019] (-1087.215) * [-1083.314] (-1084.123) (-1082.692) (-1084.675) -- 0:00:33 434500 -- [-1082.342] (-1080.875) (-1082.401) (-1083.788) * (-1082.514) (-1081.247) [-1082.414] (-1083.160) -- 0:00:33 435000 -- (-1084.502) (-1081.048) (-1085.373) [-1086.157] * (-1081.518) (-1081.979) [-1081.337] (-1083.474) -- 0:00:33 Average standard deviation of split frequencies: 0.011257 435500 -- (-1085.152) (-1080.808) (-1082.685) [-1081.844] * [-1080.843] (-1083.266) (-1081.681) (-1082.566) -- 0:00:34 436000 -- [-1084.619] (-1081.877) (-1080.761) (-1083.399) * (-1081.466) (-1087.420) [-1081.991] (-1081.945) -- 0:00:34 436500 -- (-1091.874) [-1084.559] (-1082.228) (-1084.304) * (-1081.883) (-1086.024) [-1082.014] (-1081.506) -- 0:00:34 437000 -- (-1090.453) (-1085.040) (-1085.138) [-1084.621] * (-1081.865) (-1082.211) [-1081.769] (-1083.606) -- 0:00:34 437500 -- (-1085.873) (-1082.787) (-1083.128) [-1086.637] * [-1081.064] (-1081.953) (-1084.681) (-1086.746) -- 0:00:34 438000 -- [-1086.745] (-1084.369) (-1084.475) (-1084.837) * [-1081.868] (-1081.745) (-1081.851) (-1085.678) -- 0:00:34 438500 -- (-1090.224) [-1083.993] (-1084.290) (-1085.711) * (-1082.079) [-1084.700] (-1081.146) (-1083.603) -- 0:00:34 439000 -- [-1084.131] (-1083.448) (-1082.623) (-1085.325) * (-1083.188) [-1086.360] (-1082.992) (-1086.541) -- 0:00:34 439500 -- [-1084.756] (-1081.738) (-1083.158) (-1082.956) * [-1083.491] (-1088.315) (-1084.765) (-1090.179) -- 0:00:34 440000 -- (-1089.309) [-1084.144] (-1083.014) (-1083.174) * (-1082.298) (-1082.819) (-1085.529) [-1087.064] -- 0:00:34 Average standard deviation of split frequencies: 0.010635 440500 -- (-1086.578) [-1081.030] (-1083.362) (-1082.330) * (-1084.230) (-1080.694) (-1081.936) [-1084.744] -- 0:00:34 441000 -- (-1082.471) (-1081.775) [-1081.770] (-1084.992) * (-1083.928) [-1080.694] (-1083.724) (-1085.143) -- 0:00:34 441500 -- (-1083.424) (-1083.325) [-1082.495] (-1082.323) * (-1083.720) (-1080.934) (-1085.810) [-1085.707] -- 0:00:34 442000 -- (-1092.000) (-1083.953) (-1084.895) [-1082.160] * (-1082.541) [-1084.087] (-1082.780) (-1086.041) -- 0:00:34 442500 -- (-1083.700) (-1084.979) [-1084.146] (-1085.710) * [-1081.260] (-1081.054) (-1083.267) (-1082.764) -- 0:00:34 443000 -- (-1084.463) (-1085.294) [-1083.175] (-1092.088) * [-1083.170] (-1083.640) (-1086.495) (-1081.746) -- 0:00:33 443500 -- (-1087.243) (-1082.623) [-1085.473] (-1084.348) * (-1082.297) (-1082.227) (-1084.000) [-1082.416] -- 0:00:33 444000 -- (-1082.886) (-1082.469) [-1082.962] (-1082.819) * (-1082.622) [-1084.988] (-1083.053) (-1083.851) -- 0:00:33 444500 -- (-1085.965) (-1081.844) [-1081.126] (-1082.975) * (-1089.676) (-1085.194) (-1082.498) [-1083.875] -- 0:00:33 445000 -- (-1082.184) (-1083.198) [-1081.319] (-1082.315) * (-1083.257) (-1088.182) [-1084.401] (-1084.930) -- 0:00:33 Average standard deviation of split frequencies: 0.010259 445500 -- (-1085.086) (-1085.308) [-1082.235] (-1083.568) * (-1083.087) (-1081.770) (-1082.067) [-1082.287] -- 0:00:33 446000 -- (-1086.537) (-1082.862) (-1081.354) [-1081.138] * (-1083.994) [-1083.678] (-1083.483) (-1081.164) -- 0:00:33 446500 -- (-1081.571) (-1083.072) (-1081.977) [-1084.671] * (-1082.506) [-1082.842] (-1081.671) (-1082.690) -- 0:00:33 447000 -- (-1084.405) (-1084.424) [-1084.162] (-1090.229) * (-1082.507) (-1081.650) (-1088.376) [-1081.507] -- 0:00:33 447500 -- (-1084.596) (-1082.459) [-1083.558] (-1093.617) * (-1086.119) [-1081.484] (-1084.954) (-1081.282) -- 0:00:33 448000 -- (-1085.926) (-1085.193) (-1082.429) [-1091.279] * (-1086.991) (-1087.413) [-1081.926] (-1082.995) -- 0:00:33 448500 -- (-1084.288) [-1082.704] (-1084.626) (-1082.845) * (-1084.311) (-1082.845) [-1082.625] (-1082.404) -- 0:00:33 449000 -- [-1083.056] (-1083.223) (-1084.765) (-1081.591) * (-1085.603) (-1082.159) [-1081.075] (-1084.473) -- 0:00:33 449500 -- [-1082.444] (-1084.966) (-1082.356) (-1082.305) * (-1084.943) (-1083.411) [-1082.751] (-1083.237) -- 0:00:33 450000 -- (-1081.442) (-1084.072) (-1081.555) [-1082.147] * (-1083.856) (-1082.351) (-1081.478) [-1083.756] -- 0:00:33 Average standard deviation of split frequencies: 0.009906 450500 -- (-1081.120) (-1082.240) (-1083.817) [-1081.209] * (-1084.145) (-1080.961) (-1083.333) [-1085.505] -- 0:00:32 451000 -- (-1084.501) (-1082.586) [-1084.244] (-1081.303) * [-1082.064] (-1082.557) (-1085.204) (-1082.491) -- 0:00:32 451500 -- [-1083.929] (-1087.257) (-1084.853) (-1083.834) * (-1082.090) [-1084.284] (-1084.805) (-1081.035) -- 0:00:34 452000 -- (-1082.130) [-1084.280] (-1085.116) (-1082.932) * (-1082.977) [-1082.597] (-1083.819) (-1080.938) -- 0:00:33 452500 -- (-1083.037) [-1082.629] (-1083.927) (-1081.955) * (-1084.021) [-1084.522] (-1082.631) (-1082.743) -- 0:00:33 453000 -- (-1082.110) [-1084.069] (-1084.146) (-1081.389) * [-1085.173] (-1083.289) (-1083.805) (-1082.897) -- 0:00:33 453500 -- (-1084.056) (-1084.111) (-1083.335) [-1083.588] * (-1089.026) (-1083.899) [-1082.053] (-1082.491) -- 0:00:33 454000 -- (-1081.379) [-1082.186] (-1086.943) (-1082.721) * (-1083.809) (-1084.011) (-1083.170) [-1082.075] -- 0:00:33 454500 -- [-1084.496] (-1085.660) (-1084.791) (-1082.230) * (-1082.744) (-1084.352) [-1083.574] (-1082.728) -- 0:00:33 455000 -- (-1087.818) (-1083.879) (-1083.602) [-1081.437] * [-1084.758] (-1086.852) (-1082.031) (-1082.071) -- 0:00:33 Average standard deviation of split frequencies: 0.009950 455500 -- (-1091.886) (-1084.848) [-1086.082] (-1080.967) * (-1084.686) (-1082.235) [-1081.262] (-1083.261) -- 0:00:33 456000 -- (-1086.359) [-1084.402] (-1083.222) (-1081.467) * (-1081.503) (-1081.164) [-1087.383] (-1082.511) -- 0:00:33 456500 -- (-1081.099) [-1085.119] (-1082.174) (-1089.255) * (-1081.470) (-1082.945) [-1085.284] (-1083.253) -- 0:00:33 457000 -- [-1080.802] (-1081.991) (-1081.662) (-1089.026) * (-1081.415) (-1083.971) [-1082.758] (-1082.694) -- 0:00:33 457500 -- [-1080.803] (-1083.933) (-1083.314) (-1084.840) * (-1082.167) (-1083.164) (-1083.699) [-1086.379] -- 0:00:33 458000 -- (-1082.664) [-1081.112] (-1082.869) (-1086.215) * (-1081.418) (-1081.986) [-1083.279] (-1082.770) -- 0:00:33 458500 -- (-1083.893) [-1081.741] (-1086.031) (-1084.676) * [-1083.534] (-1082.693) (-1082.414) (-1083.762) -- 0:00:33 459000 -- (-1084.382) [-1082.565] (-1085.008) (-1084.043) * (-1086.120) (-1082.774) [-1085.009] (-1086.224) -- 0:00:33 459500 -- [-1084.344] (-1082.789) (-1084.614) (-1084.310) * (-1086.865) (-1082.106) [-1081.779] (-1088.032) -- 0:00:32 460000 -- [-1085.796] (-1084.210) (-1086.854) (-1083.590) * (-1084.169) [-1084.711] (-1083.099) (-1086.630) -- 0:00:32 Average standard deviation of split frequencies: 0.010361 460500 -- (-1085.073) (-1084.048) [-1081.253] (-1082.953) * (-1085.882) [-1082.390] (-1085.923) (-1085.726) -- 0:00:32 461000 -- (-1084.380) (-1084.338) [-1085.877] (-1083.116) * (-1083.509) (-1080.849) (-1082.038) [-1081.535] -- 0:00:32 461500 -- [-1081.626] (-1082.236) (-1083.545) (-1083.926) * [-1084.103] (-1081.472) (-1084.569) (-1081.631) -- 0:00:32 462000 -- (-1082.727) [-1081.559] (-1083.273) (-1083.650) * (-1082.895) [-1081.472] (-1087.915) (-1083.715) -- 0:00:32 462500 -- (-1082.698) (-1086.144) [-1083.872] (-1081.504) * (-1086.902) [-1084.208] (-1080.961) (-1082.441) -- 0:00:32 463000 -- (-1082.602) (-1081.879) [-1081.011] (-1083.294) * [-1088.590] (-1082.882) (-1083.142) (-1084.217) -- 0:00:32 463500 -- (-1085.625) (-1082.279) [-1084.491] (-1081.392) * [-1082.847] (-1083.559) (-1082.404) (-1084.685) -- 0:00:32 464000 -- (-1087.387) [-1082.524] (-1083.764) (-1083.757) * (-1081.898) [-1083.903] (-1085.015) (-1083.850) -- 0:00:32 464500 -- [-1082.591] (-1083.359) (-1083.839) (-1081.180) * (-1083.925) [-1086.872] (-1086.776) (-1083.610) -- 0:00:32 465000 -- (-1082.291) [-1083.828] (-1083.324) (-1088.661) * [-1082.516] (-1084.054) (-1083.267) (-1085.029) -- 0:00:32 Average standard deviation of split frequencies: 0.010175 465500 -- (-1082.832) [-1082.499] (-1083.699) (-1087.035) * (-1082.910) (-1084.491) [-1081.380] (-1084.446) -- 0:00:32 466000 -- (-1082.004) [-1081.757] (-1081.732) (-1081.962) * (-1082.320) [-1083.740] (-1081.617) (-1086.311) -- 0:00:32 466500 -- (-1084.336) [-1081.763] (-1084.627) (-1082.964) * (-1081.224) (-1082.730) (-1083.356) [-1081.360] -- 0:00:32 467000 -- (-1087.771) (-1087.126) [-1085.087] (-1081.533) * (-1082.952) [-1081.654] (-1084.216) (-1081.767) -- 0:00:31 467500 -- (-1083.473) (-1089.380) (-1088.134) [-1086.112] * (-1084.963) (-1085.560) (-1083.609) [-1082.928] -- 0:00:33 468000 -- (-1082.421) [-1083.541] (-1084.047) (-1083.359) * (-1083.986) [-1081.971] (-1084.925) (-1083.314) -- 0:00:32 468500 -- (-1085.033) (-1083.232) [-1085.281] (-1084.266) * (-1083.760) (-1082.526) (-1083.192) [-1082.374] -- 0:00:32 469000 -- (-1083.530) [-1082.732] (-1082.244) (-1085.667) * (-1084.688) [-1083.384] (-1081.948) (-1081.598) -- 0:00:32 469500 -- [-1082.055] (-1088.448) (-1081.278) (-1082.629) * [-1084.608] (-1083.640) (-1085.629) (-1080.981) -- 0:00:32 470000 -- [-1081.591] (-1088.450) (-1082.056) (-1083.957) * (-1083.814) (-1082.771) (-1084.421) [-1081.319] -- 0:00:32 Average standard deviation of split frequencies: 0.010016 470500 -- (-1083.293) (-1087.323) (-1081.117) [-1086.494] * (-1082.205) (-1083.373) (-1087.549) [-1080.729] -- 0:00:32 471000 -- (-1082.497) (-1083.063) (-1081.206) [-1086.253] * (-1086.404) (-1083.927) (-1084.854) [-1082.531] -- 0:00:32 471500 -- (-1082.119) [-1081.291] (-1081.949) (-1083.851) * [-1082.874] (-1083.172) (-1083.679) (-1081.605) -- 0:00:32 472000 -- (-1084.430) [-1081.396] (-1083.210) (-1084.973) * [-1082.063] (-1082.003) (-1082.737) (-1082.735) -- 0:00:32 472500 -- (-1086.446) (-1083.504) [-1081.802] (-1082.596) * (-1083.432) [-1082.901] (-1081.986) (-1084.817) -- 0:00:32 473000 -- (-1082.833) (-1084.280) (-1082.099) [-1082.624] * (-1083.372) (-1083.876) [-1081.144] (-1083.518) -- 0:00:32 473500 -- (-1084.838) (-1083.506) (-1081.873) [-1082.056] * (-1081.968) (-1083.460) [-1082.139] (-1083.508) -- 0:00:32 474000 -- [-1084.429] (-1081.577) (-1081.351) (-1082.569) * (-1087.047) (-1081.817) (-1082.500) [-1083.955] -- 0:00:32 474500 -- (-1085.439) [-1083.770] (-1083.302) (-1086.772) * (-1086.268) [-1081.402] (-1082.283) (-1084.710) -- 0:00:32 475000 -- (-1085.446) [-1081.451] (-1083.138) (-1086.224) * (-1084.955) (-1081.763) (-1081.662) [-1084.163] -- 0:00:32 Average standard deviation of split frequencies: 0.010370 475500 -- (-1084.260) (-1083.487) [-1081.442] (-1082.903) * (-1082.794) (-1081.833) [-1082.180] (-1083.535) -- 0:00:31 476000 -- (-1084.544) (-1082.491) [-1082.939] (-1084.782) * [-1083.235] (-1084.535) (-1084.705) (-1090.615) -- 0:00:31 476500 -- (-1082.348) (-1082.116) [-1081.947] (-1082.311) * (-1084.234) [-1086.051] (-1081.846) (-1084.720) -- 0:00:31 477000 -- (-1082.071) (-1085.175) [-1082.591] (-1082.607) * (-1084.484) (-1082.758) [-1082.474] (-1081.224) -- 0:00:31 477500 -- (-1082.373) [-1084.200] (-1081.429) (-1083.275) * (-1081.939) (-1082.063) (-1081.846) [-1082.099] -- 0:00:31 478000 -- [-1082.735] (-1084.347) (-1081.832) (-1082.800) * [-1083.058] (-1084.321) (-1084.807) (-1082.193) -- 0:00:31 478500 -- (-1083.530) (-1082.282) [-1081.229] (-1081.781) * [-1083.690] (-1086.347) (-1083.376) (-1083.152) -- 0:00:31 479000 -- (-1081.608) [-1083.020] (-1081.299) (-1082.143) * (-1081.760) (-1084.177) (-1085.028) [-1082.291] -- 0:00:31 479500 -- (-1082.044) (-1081.917) (-1086.094) [-1082.433] * (-1083.882) [-1084.099] (-1081.369) (-1082.141) -- 0:00:31 480000 -- (-1083.711) (-1083.488) [-1081.450] (-1082.072) * [-1082.162] (-1082.093) (-1084.532) (-1083.172) -- 0:00:31 Average standard deviation of split frequencies: 0.010903 480500 -- (-1084.328) (-1081.219) (-1082.660) [-1081.931] * (-1082.134) [-1083.561] (-1081.955) (-1084.088) -- 0:00:31 481000 -- (-1083.211) [-1081.654] (-1084.230) (-1082.051) * (-1083.311) (-1087.094) (-1081.016) [-1081.928] -- 0:00:31 481500 -- (-1082.872) [-1087.818] (-1081.588) (-1082.511) * [-1087.264] (-1081.987) (-1083.870) (-1081.507) -- 0:00:31 482000 -- (-1083.913) [-1082.838] (-1082.605) (-1083.532) * (-1082.589) [-1081.462] (-1081.277) (-1081.405) -- 0:00:31 482500 -- (-1084.485) [-1083.467] (-1082.310) (-1081.512) * [-1084.876] (-1084.347) (-1081.208) (-1083.329) -- 0:00:31 483000 -- [-1081.008] (-1085.318) (-1082.024) (-1083.087) * (-1081.923) (-1082.832) (-1081.498) [-1081.564] -- 0:00:31 483500 -- (-1087.193) [-1086.070] (-1081.298) (-1083.260) * (-1083.350) (-1081.690) (-1088.313) [-1081.273] -- 0:00:30 484000 -- (-1083.609) [-1082.716] (-1087.212) (-1083.864) * [-1082.820] (-1084.331) (-1083.517) (-1081.663) -- 0:00:31 484500 -- [-1083.152] (-1084.492) (-1083.967) (-1083.618) * (-1082.557) [-1084.532] (-1082.822) (-1082.183) -- 0:00:31 485000 -- (-1083.852) (-1088.657) (-1083.494) [-1083.216] * (-1081.301) (-1081.985) (-1081.450) [-1081.860] -- 0:00:31 Average standard deviation of split frequencies: 0.010784 485500 -- [-1084.929] (-1083.278) (-1083.657) (-1089.846) * (-1081.305) (-1084.670) [-1082.383] (-1081.760) -- 0:00:31 486000 -- [-1085.657] (-1083.914) (-1080.867) (-1081.981) * (-1081.724) (-1084.386) [-1081.905] (-1083.226) -- 0:00:31 486500 -- (-1084.096) (-1082.683) [-1081.419] (-1087.255) * [-1081.736] (-1082.268) (-1085.079) (-1084.120) -- 0:00:31 487000 -- (-1082.444) (-1083.514) [-1082.610] (-1089.580) * [-1081.205] (-1084.526) (-1084.004) (-1084.619) -- 0:00:31 487500 -- [-1082.257] (-1085.006) (-1081.805) (-1084.107) * (-1081.205) (-1083.822) (-1087.401) [-1084.113] -- 0:00:31 488000 -- (-1081.698) (-1085.075) [-1088.486] (-1086.485) * (-1082.931) (-1084.846) [-1084.737] (-1082.091) -- 0:00:31 488500 -- [-1085.270] (-1085.280) (-1084.169) (-1084.463) * [-1082.981] (-1081.710) (-1084.504) (-1082.286) -- 0:00:31 489000 -- (-1080.927) [-1081.651] (-1084.110) (-1083.742) * (-1086.539) [-1086.382] (-1088.815) (-1087.075) -- 0:00:31 489500 -- [-1081.014] (-1081.837) (-1085.008) (-1083.651) * (-1083.689) [-1083.488] (-1082.546) (-1082.643) -- 0:00:31 490000 -- (-1081.746) [-1081.580] (-1083.729) (-1085.518) * (-1082.733) [-1082.785] (-1081.833) (-1081.480) -- 0:00:31 Average standard deviation of split frequencies: 0.010568 490500 -- (-1083.075) (-1084.839) [-1082.609] (-1086.645) * (-1085.367) [-1084.916] (-1083.440) (-1081.553) -- 0:00:31 491000 -- (-1081.064) (-1082.318) (-1081.959) [-1082.498] * [-1083.501] (-1082.242) (-1081.580) (-1084.224) -- 0:00:31 491500 -- [-1081.167] (-1081.895) (-1081.632) (-1081.743) * (-1081.649) [-1082.242] (-1084.029) (-1085.069) -- 0:00:31 492000 -- [-1082.717] (-1082.442) (-1082.504) (-1083.614) * (-1082.661) [-1083.439] (-1086.467) (-1084.556) -- 0:00:30 492500 -- (-1082.282) (-1081.991) (-1082.162) [-1082.286] * (-1082.757) (-1083.457) (-1084.994) [-1083.298] -- 0:00:30 493000 -- (-1082.283) (-1086.011) (-1082.341) [-1082.534] * (-1084.576) (-1081.708) [-1082.273] (-1083.733) -- 0:00:30 493500 -- (-1081.710) (-1084.987) [-1084.157] (-1084.429) * [-1080.740] (-1085.611) (-1081.499) (-1082.916) -- 0:00:30 494000 -- (-1084.263) (-1085.694) [-1081.201] (-1083.240) * (-1081.442) (-1081.653) [-1080.737] (-1082.043) -- 0:00:30 494500 -- (-1083.694) (-1085.793) [-1081.847] (-1081.500) * (-1083.079) (-1084.738) (-1081.294) [-1084.108] -- 0:00:30 495000 -- [-1083.611] (-1084.653) (-1084.938) (-1081.246) * [-1081.559] (-1083.821) (-1080.821) (-1082.618) -- 0:00:30 Average standard deviation of split frequencies: 0.010622 495500 -- [-1084.936] (-1082.140) (-1085.182) (-1084.700) * (-1081.503) [-1083.077] (-1082.883) (-1085.723) -- 0:00:30 496000 -- (-1081.743) (-1092.917) (-1088.867) [-1082.589] * (-1085.946) [-1083.623] (-1081.395) (-1083.106) -- 0:00:30 496500 -- [-1082.589] (-1086.438) (-1081.249) (-1084.023) * [-1084.437] (-1081.340) (-1084.089) (-1084.937) -- 0:00:30 497000 -- [-1082.287] (-1086.458) (-1082.757) (-1082.281) * (-1083.798) (-1081.281) [-1082.949] (-1087.450) -- 0:00:30 497500 -- (-1084.536) [-1085.655] (-1085.575) (-1082.189) * (-1081.959) (-1081.290) (-1081.666) [-1081.674] -- 0:00:30 498000 -- (-1082.641) [-1084.753] (-1082.870) (-1086.127) * (-1082.043) [-1084.449] (-1082.346) (-1081.835) -- 0:00:30 498500 -- [-1082.009] (-1083.698) (-1081.662) (-1082.838) * [-1085.285] (-1085.408) (-1081.256) (-1082.070) -- 0:00:30 499000 -- (-1081.614) (-1085.024) [-1081.461] (-1083.384) * [-1084.607] (-1086.786) (-1084.585) (-1081.592) -- 0:00:30 499500 -- (-1082.357) [-1082.108] (-1087.205) (-1081.976) * [-1083.531] (-1087.319) (-1083.081) (-1081.202) -- 0:00:30 500000 -- (-1082.966) (-1081.888) (-1084.311) [-1084.892] * (-1081.752) (-1087.750) (-1082.688) [-1081.503] -- 0:00:31 Average standard deviation of split frequencies: 0.010911 500500 -- (-1082.643) (-1082.094) (-1085.410) [-1081.965] * (-1081.842) (-1083.702) [-1083.255] (-1083.093) -- 0:00:30 501000 -- (-1086.749) (-1084.285) (-1082.613) [-1082.681] * [-1082.380] (-1086.344) (-1082.282) (-1084.891) -- 0:00:30 501500 -- (-1083.839) (-1085.245) [-1081.511] (-1086.707) * (-1084.697) (-1083.190) [-1081.333] (-1082.724) -- 0:00:30 502000 -- (-1082.262) (-1081.562) [-1081.520] (-1082.901) * (-1082.127) [-1081.519] (-1082.505) (-1089.285) -- 0:00:30 502500 -- (-1082.080) (-1081.195) (-1082.785) [-1081.665] * [-1082.779] (-1085.567) (-1082.549) (-1087.207) -- 0:00:30 503000 -- [-1081.287] (-1081.406) (-1084.566) (-1084.673) * (-1083.248) [-1085.121] (-1083.148) (-1082.495) -- 0:00:30 503500 -- (-1081.538) [-1082.605] (-1083.850) (-1084.663) * [-1083.979] (-1082.631) (-1082.596) (-1082.769) -- 0:00:30 504000 -- (-1083.021) (-1086.794) [-1082.675] (-1081.755) * (-1081.800) [-1081.943] (-1083.574) (-1082.402) -- 0:00:30 504500 -- [-1084.169] (-1083.530) (-1083.105) (-1082.318) * (-1084.346