>C1
VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
TASANRIGSLLADIIARF
>C2
VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
TASANRIGSLLADIIARF
>C3
VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
TASANRIGSLLADIIARF
>C4
VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
TASANRIGSLLADIIARF
>C5
VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
TASANRIGSLLADIIARF
>C6
VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
TASANRIGSLLADIIARF
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=268
C1 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
C2 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
C3 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
C4 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
C5 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
C6 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
**************************************************
C1 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
C2 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
C3 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
C4 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
C5 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
C6 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
**************************************************
C1 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
C2 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
C3 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
C4 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
C5 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
C6 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
**************************************************
C1 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
C2 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
C3 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
C4 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
C5 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
C6 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
**************************************************
C1 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
C2 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
C3 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
C4 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
C5 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
C6 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
**************************************************
C1 TASANRIGSLLADIIARF
C2 TASANRIGSLLADIIARF
C3 TASANRIGSLLADIIARF
C4 TASANRIGSLLADIIARF
C5 TASANRIGSLLADIIARF
C6 TASANRIGSLLADIIARF
******************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8040]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8040]--->[8040]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.498 Mb, Max= 30.824 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
C2 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
C3 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
C4 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
C5 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
C6 VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
**************************************************
C1 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
C2 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
C3 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
C4 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
C5 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
C6 VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
**************************************************
C1 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
C2 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
C3 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
C4 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
C5 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
C6 VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
**************************************************
C1 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
C2 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
C3 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
C4 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
C5 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
C6 THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
**************************************************
C1 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
C2 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
C3 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
C4 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
C5 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
C6 GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
**************************************************
C1 TASANRIGSLLADIIARF
C2 TASANRIGSLLADIIARF
C3 TASANRIGSLLADIIARF
C4 TASANRIGSLLADIIARF
C5 TASANRIGSLLADIIARF
C6 TASANRIGSLLADIIARF
******************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA
C2 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA
C3 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA
C4 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA
C5 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA
C6 GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA
**************************************************
C1 GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC
C2 GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC
C3 GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC
C4 GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC
C5 GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC
C6 GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC
**************************************************
C1 TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC
C2 TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC
C3 TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC
C4 TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC
C5 TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC
C6 TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC
**************************************************
C1 GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG
C2 GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG
C3 GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG
C4 GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG
C5 GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG
C6 GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG
**************************************************
C1 GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG
C2 GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG
C3 GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG
C4 GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG
C5 GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG
C6 GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG
**************************************************
C1 TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC
C2 TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC
C3 TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC
C4 TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC
C5 TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC
C6 TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC
**************************************************
C1 GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT
C2 GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT
C3 GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT
C4 GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT
C5 GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT
C6 GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT
**************************************************
C1 CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG
C2 CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG
C3 CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG
C4 CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG
C5 CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG
C6 CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG
**************************************************
C1 TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC
C2 TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC
C3 TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC
C4 TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC
C5 TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC
C6 TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC
**************************************************
C1 ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT
C2 ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT
C3 ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT
C4 ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT
C5 ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT
C6 ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT
**************************************************
C1 CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC
C2 CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC
C3 CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC
C4 CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC
C5 CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC
C6 CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC
**************************************************
C1 CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG
C2 CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG
C3 CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG
C4 CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG
C5 CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG
C6 CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG
**************************************************
C1 GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG
C2 GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG
C3 GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG
C4 GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG
C5 GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG
C6 GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG
**************************************************
C1 GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG
C2 GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG
C3 GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG
C4 GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG
C5 GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG
C6 GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG
**************************************************
C1 CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG
C2 CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG
C3 CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG
C4 CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG
C5 CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG
C6 CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG
**************************************************
C1 ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG
C2 ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG
C3 ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG
C4 ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG
C5 ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG
C6 ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG
**************************************************
C1 GTTT
C2 GTTT
C3 GTTT
C4 GTTT
C5 GTTT
C6 GTTT
****
>C1
GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA
GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC
TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC
GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG
GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG
TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC
GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT
CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG
TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC
ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT
CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC
CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG
GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG
GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG
CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG
ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG
GTTT
>C2
GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA
GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC
TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC
GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG
GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG
TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC
GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT
CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG
TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC
ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT
CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC
CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG
GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG
GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG
CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG
ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG
GTTT
>C3
GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA
GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC
TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC
GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG
GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG
TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC
GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT
CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG
TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC
ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT
CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC
CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG
GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG
GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG
CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG
ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG
GTTT
>C4
GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA
GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC
TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC
GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG
GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG
TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC
GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT
CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG
TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC
ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT
CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC
CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG
GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG
GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG
CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG
ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG
GTTT
>C5
GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA
GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC
TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC
GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG
GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG
TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC
GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT
CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG
TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC
ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT
CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC
CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG
GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG
GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG
CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG
ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG
GTTT
>C6
GTGACTTACACCCTGCTCGATCCCGACGAACTCGCTCGGCGGGCCGCCCA
GGTTATTGGTGAGCGCACCGGTATCCTTAAGCACGACGTCGCAGTCGTCC
TCGGATCGGGATGGTCCTCGGCGGTTGCAGCGCTCGGCTCATCGAGAGCC
GTGTTCCCCCAGGCCGAGCTGCCCGGGTTCATAACGCCCAACGCAGCCGG
GCATACCGGCGAGTTGTTGTCGGTGCGTATTGGCGCGCATCGGGTGTTGG
TGCTGGCCGGTCGCATCCATCCCTACGAGGGGCATGACCTTAGGCACGTC
GTCCATCCAGTACGCACGGCGTGCGCGGCCGGTGCACGCATCATCGTTCT
CACTAATGCGGCCGGCGGACTGCGTGCAGACATGGCGGTCGGCCAACTGG
TGCTGATTAGTGACCACCTGAACCTGACGACACGTTCGCCGCTAGTCGGC
ACGCACTTCGTCGACTTAACCAACGCGTACACAACGCGGCTCCGAAAACT
CGCCAGCGACACCGACCCGACACTGACCGAAGGCGTGTACGCGGCCCAGC
CCGGCCCACACTATGAGACTCCCGCGGAAATCCGGATGCTGCGGATGCTG
GGTGCTGACCTAGTGGGCATGTCAACGGTGCACGAGACCATCGCAGCACG
GGCTGCGGGCGCTGAGGTGTTGGGCGTGTCACTGGTGACAAACCTGGCGG
CCGGGATCACCGGCAAGCCACTTAACCATGCTGAGGTGCTTGCCGCGGGG
ACTGCGTCAGCGAACCGGATCGGGTCCCTGCTGGCCGACATCATAGCCCG
GTTT
>C1
VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
TASANRIGSLLADIIARF
>C2
VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
TASANRIGSLLADIIARF
>C3
VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
TASANRIGSLLADIIARF
>C4
VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
TASANRIGSLLADIIARF
>C5
VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
TASANRIGSLLADIIARF
>C6
VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRA
VFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHV
VHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVG
THFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRML
GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAG
TASANRIGSLLADIIARF
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 804 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579774873
Setting output file names to "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 629664896
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9599876829
Seed = 1467342201
Swapseed = 1579774873
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1799.390545 -- -24.965149
Chain 2 -- -1799.390545 -- -24.965149
Chain 3 -- -1799.390442 -- -24.965149
Chain 4 -- -1799.390545 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1799.390545 -- -24.965149
Chain 2 -- -1799.390545 -- -24.965149
Chain 3 -- -1799.390545 -- -24.965149
Chain 4 -- -1799.390545 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1799.391] (-1799.391) (-1799.390) (-1799.391) * [-1799.391] (-1799.391) (-1799.391) (-1799.391)
500 -- [-1100.492] (-1090.199) (-1130.698) (-1091.722) * [-1096.269] (-1104.959) (-1107.543) (-1108.236) -- 0:00:00
1000 -- (-1090.037) [-1093.253] (-1102.388) (-1088.136) * [-1090.649] (-1097.901) (-1098.998) (-1102.779) -- 0:00:00
1500 -- (-1091.570) [-1090.632] (-1096.474) (-1091.816) * (-1085.927) (-1087.721) (-1093.998) [-1099.767] -- 0:00:00
2000 -- [-1089.277] (-1093.144) (-1092.888) (-1092.996) * [-1095.201] (-1098.769) (-1091.145) (-1098.690) -- 0:00:00
2500 -- (-1098.577) (-1094.131) (-1088.821) [-1089.006] * [-1093.080] (-1091.365) (-1094.780) (-1094.936) -- 0:00:00
3000 -- (-1090.319) [-1095.741] (-1091.775) (-1091.820) * [-1088.681] (-1093.829) (-1089.896) (-1089.656) -- 0:00:00
3500 -- (-1095.809) [-1089.737] (-1092.205) (-1089.632) * (-1095.362) [-1093.702] (-1088.224) (-1093.286) -- 0:00:00
4000 -- (-1089.488) (-1094.051) (-1090.653) [-1089.213] * (-1090.791) [-1086.389] (-1091.719) (-1092.347) -- 0:00:00
4500 -- (-1090.774) [-1090.798] (-1086.795) (-1089.713) * (-1092.248) (-1089.238) (-1089.610) [-1090.678] -- 0:00:00
5000 -- [-1094.894] (-1092.111) (-1093.628) (-1086.305) * (-1089.796) [-1093.783] (-1091.553) (-1092.479) -- 0:00:00
Average standard deviation of split frequencies: 0.092852
5500 -- (-1098.703) [-1091.723] (-1086.167) (-1089.015) * [-1096.200] (-1092.995) (-1087.515) (-1091.342) -- 0:00:00
6000 -- (-1094.639) (-1088.743) [-1093.183] (-1097.212) * [-1091.309] (-1088.928) (-1092.354) (-1092.889) -- 0:00:00
6500 -- (-1089.873) [-1091.369] (-1098.427) (-1092.834) * (-1094.906) (-1089.813) [-1094.306] (-1085.984) -- 0:00:00
7000 -- (-1091.638) [-1094.179] (-1092.222) (-1089.800) * (-1091.005) [-1092.004] (-1088.806) (-1094.154) -- 0:00:00
7500 -- [-1090.520] (-1094.891) (-1097.129) (-1091.219) * (-1091.684) [-1089.384] (-1091.904) (-1097.567) -- 0:00:00
8000 -- [-1095.960] (-1091.826) (-1100.953) (-1090.039) * (-1094.780) (-1087.440) [-1089.029] (-1102.791) -- 0:00:00
8500 -- (-1088.444) (-1095.451) (-1090.379) [-1085.103] * (-1093.317) (-1100.422) [-1087.810] (-1102.075) -- 0:00:00
9000 -- (-1100.761) (-1098.259) (-1098.549) [-1084.872] * [-1097.292] (-1088.790) (-1093.649) (-1092.152) -- 0:00:00
9500 -- (-1093.541) [-1091.370] (-1097.183) (-1083.457) * (-1107.133) [-1093.340] (-1093.028) (-1093.104) -- 0:00:00
10000 -- (-1087.215) (-1094.208) (-1094.207) [-1083.736] * [-1089.431] (-1093.126) (-1096.054) (-1093.601) -- 0:00:00
Average standard deviation of split frequencies: 0.072318
10500 -- (-1090.505) (-1090.658) [-1092.881] (-1083.321) * (-1094.182) [-1087.781] (-1093.534) (-1095.330) -- 0:00:00
11000 -- [-1092.335] (-1088.305) (-1088.208) (-1082.103) * (-1091.683) (-1090.055) [-1091.116] (-1092.667) -- 0:00:00
11500 -- [-1093.175] (-1091.461) (-1097.838) (-1083.778) * (-1098.830) (-1095.013) [-1087.813] (-1093.592) -- 0:00:00
12000 -- (-1092.604) (-1090.644) [-1088.898] (-1086.759) * (-1093.691) (-1088.459) (-1097.084) [-1088.272] -- 0:00:00
12500 -- (-1088.685) (-1090.458) (-1090.906) [-1084.494] * [-1092.034] (-1091.915) (-1102.565) (-1094.075) -- 0:00:00
13000 -- (-1099.255) (-1105.266) (-1091.318) [-1086.169] * (-1094.123) [-1091.832] (-1094.844) (-1094.378) -- 0:00:00
13500 -- (-1089.476) (-1103.831) (-1094.189) [-1084.693] * (-1089.700) (-1088.783) [-1088.082] (-1099.014) -- 0:00:00
14000 -- (-1092.815) (-1092.551) (-1095.543) [-1083.124] * (-1095.393) (-1092.279) (-1086.279) [-1097.864] -- 0:00:00
14500 -- [-1089.759] (-1098.099) (-1099.601) (-1082.682) * [-1092.471] (-1091.984) (-1092.805) (-1087.904) -- 0:01:07
15000 -- (-1089.795) [-1092.378] (-1083.330) (-1081.922) * (-1097.699) [-1086.303] (-1092.097) (-1090.416) -- 0:01:05
Average standard deviation of split frequencies: 0.078076
15500 -- (-1088.467) (-1101.126) [-1085.887] (-1082.402) * (-1099.445) (-1095.493) [-1089.643] (-1091.640) -- 0:01:03
16000 -- (-1093.335) (-1096.069) (-1083.831) [-1082.529] * (-1087.716) (-1096.864) (-1097.609) [-1096.728] -- 0:01:01
16500 -- (-1086.495) (-1087.584) [-1083.829] (-1083.063) * (-1092.304) [-1091.270] (-1096.297) (-1102.133) -- 0:00:59
17000 -- (-1092.245) [-1090.155] (-1083.342) (-1081.740) * (-1088.303) (-1106.483) (-1100.450) [-1087.903] -- 0:00:57
17500 -- (-1089.143) (-1092.638) (-1084.332) [-1083.707] * (-1094.231) (-1096.110) (-1088.832) [-1087.674] -- 0:00:56
18000 -- [-1089.839] (-1090.587) (-1088.431) (-1082.913) * (-1098.376) (-1096.157) (-1091.526) [-1087.237] -- 0:00:54
18500 -- (-1102.304) (-1102.232) [-1083.290] (-1082.705) * (-1095.012) (-1095.326) (-1103.430) [-1087.400] -- 0:00:53
19000 -- (-1101.308) (-1093.555) [-1082.815] (-1082.250) * (-1093.015) [-1087.637] (-1094.368) (-1090.578) -- 0:00:51
19500 -- (-1081.506) [-1090.114] (-1083.589) (-1081.805) * (-1098.149) (-1096.663) [-1088.921] (-1096.590) -- 0:00:50
20000 -- (-1085.765) [-1093.053] (-1083.639) (-1085.294) * (-1089.675) (-1092.474) [-1088.220] (-1090.215) -- 0:00:49
Average standard deviation of split frequencies: 0.051322
20500 -- [-1084.925] (-1091.731) (-1084.785) (-1084.784) * (-1096.420) (-1092.765) [-1091.566] (-1086.408) -- 0:00:47
21000 -- (-1085.591) [-1086.923] (-1084.660) (-1087.890) * (-1089.385) (-1099.866) (-1100.379) [-1091.233] -- 0:00:46
21500 -- [-1083.297] (-1093.768) (-1085.879) (-1082.110) * (-1095.259) (-1097.975) (-1093.758) [-1090.029] -- 0:00:45
22000 -- (-1083.171) (-1092.696) (-1082.965) [-1082.100] * (-1098.865) (-1086.071) (-1098.714) [-1095.061] -- 0:00:44
22500 -- (-1085.632) (-1090.152) [-1082.187] (-1086.983) * (-1089.943) (-1087.993) (-1098.566) [-1089.217] -- 0:00:43
23000 -- (-1083.928) (-1094.632) [-1083.358] (-1082.821) * [-1087.637] (-1092.991) (-1090.688) (-1092.219) -- 0:00:42
23500 -- [-1081.546] (-1091.072) (-1084.944) (-1082.016) * [-1096.471] (-1095.208) (-1091.420) (-1093.204) -- 0:00:41
24000 -- [-1081.270] (-1093.380) (-1082.616) (-1082.696) * (-1094.690) (-1094.282) (-1093.354) [-1086.874] -- 0:00:40
24500 -- [-1086.400] (-1106.081) (-1082.270) (-1087.670) * (-1090.496) (-1096.363) (-1088.419) [-1086.142] -- 0:00:39
25000 -- (-1084.147) (-1091.374) (-1083.260) [-1084.703] * (-1087.381) (-1097.848) [-1102.663] (-1088.565) -- 0:00:39
Average standard deviation of split frequencies: 0.042306
25500 -- (-1082.129) (-1086.218) [-1082.194] (-1084.920) * (-1089.774) [-1085.789] (-1087.112) (-1088.648) -- 0:00:38
26000 -- [-1082.380] (-1089.307) (-1082.195) (-1092.720) * [-1089.740] (-1083.849) (-1087.008) (-1090.650) -- 0:00:37
26500 -- [-1085.830] (-1101.808) (-1086.437) (-1087.170) * (-1095.160) (-1082.175) (-1092.186) [-1094.670] -- 0:00:36
27000 -- (-1085.872) [-1096.105] (-1086.197) (-1081.052) * [-1091.991] (-1086.842) (-1094.630) (-1099.513) -- 0:00:36
27500 -- (-1083.248) (-1099.669) (-1087.962) [-1081.730] * [-1090.324] (-1084.462) (-1086.120) (-1088.578) -- 0:00:35
28000 -- [-1084.758] (-1083.189) (-1088.056) (-1084.433) * (-1092.939) (-1082.025) [-1091.052] (-1094.225) -- 0:00:34
28500 -- (-1082.589) (-1087.325) (-1086.235) [-1083.512] * [-1093.507] (-1081.684) (-1093.189) (-1098.451) -- 0:00:34
29000 -- (-1082.483) (-1086.593) [-1084.411] (-1083.139) * [-1089.369] (-1081.315) (-1099.116) (-1090.111) -- 0:00:33
29500 -- [-1082.382] (-1082.445) (-1086.537) (-1084.033) * (-1090.623) (-1082.781) (-1101.494) [-1091.993] -- 0:00:32
30000 -- [-1080.840] (-1085.576) (-1088.448) (-1081.699) * (-1093.242) (-1081.777) (-1090.008) [-1085.129] -- 0:00:32
Average standard deviation of split frequencies: 0.041724
30500 -- (-1081.212) (-1084.388) [-1083.704] (-1085.914) * (-1091.848) [-1081.777] (-1089.665) (-1094.230) -- 0:01:03
31000 -- [-1082.142] (-1083.637) (-1087.732) (-1083.762) * (-1090.582) (-1081.368) (-1098.466) [-1089.592] -- 0:01:02
31500 -- [-1085.043] (-1081.182) (-1082.716) (-1087.895) * (-1086.851) (-1084.298) (-1089.629) [-1093.056] -- 0:01:01
32000 -- (-1083.800) [-1083.180] (-1085.216) (-1081.819) * (-1088.588) (-1081.544) [-1092.317] (-1097.073) -- 0:01:00
32500 -- (-1082.661) [-1081.498] (-1085.011) (-1084.337) * (-1101.215) [-1083.363] (-1088.330) (-1095.975) -- 0:00:59
33000 -- (-1082.284) [-1081.407] (-1083.527) (-1085.500) * [-1085.647] (-1081.384) (-1095.548) (-1093.865) -- 0:00:58
33500 -- [-1087.012] (-1083.208) (-1088.318) (-1082.643) * (-1094.156) [-1082.549] (-1098.232) (-1094.416) -- 0:00:57
34000 -- (-1084.548) (-1084.659) (-1081.621) [-1081.947] * (-1087.768) [-1082.318] (-1091.956) (-1094.881) -- 0:00:56
34500 -- (-1087.739) (-1083.698) [-1082.532] (-1082.935) * [-1097.674] (-1082.952) (-1093.263) (-1103.908) -- 0:00:55
35000 -- (-1084.038) (-1081.411) [-1082.404] (-1083.853) * (-1098.696) (-1082.113) [-1093.884] (-1094.227) -- 0:00:55
Average standard deviation of split frequencies: 0.035542
35500 -- (-1089.034) (-1083.156) [-1083.041] (-1084.085) * (-1092.765) [-1083.237] (-1091.807) (-1096.043) -- 0:00:54
36000 -- (-1085.946) [-1083.184] (-1084.254) (-1083.227) * (-1095.703) [-1084.329] (-1086.321) (-1096.227) -- 0:00:53
36500 -- [-1083.335] (-1087.862) (-1089.577) (-1083.078) * (-1094.480) (-1083.962) (-1096.281) [-1092.026] -- 0:00:52
37000 -- (-1085.506) [-1085.785] (-1083.406) (-1083.121) * (-1099.161) (-1085.876) (-1093.384) [-1088.679] -- 0:00:52
37500 -- (-1084.622) (-1082.104) (-1083.158) [-1081.964] * (-1096.742) [-1084.383] (-1100.944) (-1093.561) -- 0:00:51
38000 -- (-1082.435) (-1081.189) (-1081.795) [-1083.097] * (-1095.228) (-1083.892) (-1091.397) [-1093.289] -- 0:00:50
38500 -- (-1083.079) (-1080.895) (-1083.062) [-1081.489] * (-1092.078) (-1082.108) (-1092.623) [-1092.037] -- 0:00:49
39000 -- (-1086.110) (-1081.315) (-1087.312) [-1081.229] * [-1091.526] (-1083.201) (-1098.215) (-1096.431) -- 0:00:49
39500 -- (-1082.952) [-1082.509] (-1085.920) (-1081.514) * (-1090.531) (-1082.058) (-1088.143) [-1091.401] -- 0:00:48
40000 -- (-1082.848) (-1082.615) [-1085.952] (-1083.895) * [-1089.882] (-1082.278) (-1091.714) (-1091.136) -- 0:00:48
Average standard deviation of split frequencies: 0.031115
40500 -- [-1082.485] (-1081.592) (-1082.063) (-1086.773) * (-1092.028) (-1084.704) (-1086.404) [-1094.210] -- 0:00:47
41000 -- (-1080.969) [-1082.911] (-1082.685) (-1087.163) * (-1095.210) (-1081.347) [-1091.700] (-1088.829) -- 0:00:46
41500 -- (-1082.406) (-1083.999) [-1082.590] (-1085.289) * (-1100.261) [-1083.684] (-1087.742) (-1094.280) -- 0:00:46
42000 -- (-1082.270) (-1082.053) [-1085.693] (-1082.701) * (-1092.937) (-1084.230) (-1090.169) [-1091.442] -- 0:00:45
42500 -- (-1082.231) (-1082.624) [-1085.780] (-1083.269) * (-1086.456) [-1082.561] (-1092.419) (-1090.445) -- 0:00:45
43000 -- (-1086.904) [-1084.892] (-1086.397) (-1083.265) * (-1092.630) (-1082.896) (-1098.942) [-1087.665] -- 0:00:44
43500 -- (-1081.890) (-1084.727) [-1082.858] (-1084.821) * (-1086.567) [-1081.776] (-1096.544) (-1094.074) -- 0:00:43
44000 -- (-1081.487) (-1081.458) (-1082.618) [-1082.914] * (-1103.378) (-1083.764) (-1089.849) [-1089.616] -- 0:00:43
44500 -- (-1082.719) [-1082.578] (-1082.556) (-1083.171) * (-1087.956) (-1087.768) [-1092.719] (-1089.774) -- 0:00:42
45000 -- (-1081.080) (-1084.451) (-1082.086) [-1082.759] * (-1094.782) [-1082.433] (-1094.320) (-1094.215) -- 0:00:42
Average standard deviation of split frequencies: 0.021521
45500 -- (-1083.979) (-1084.685) (-1083.128) [-1081.459] * [-1094.186] (-1081.800) (-1093.628) (-1095.539) -- 0:00:41
46000 -- (-1086.466) (-1084.415) [-1082.994] (-1081.263) * (-1088.693) [-1081.800] (-1092.149) (-1086.489) -- 0:00:41
46500 -- (-1087.937) (-1081.359) (-1082.463) [-1081.196] * (-1090.969) (-1083.257) [-1089.457] (-1087.224) -- 0:00:41
47000 -- [-1087.509] (-1082.305) (-1081.744) (-1084.677) * (-1099.529) (-1086.024) (-1091.295) [-1092.761] -- 0:01:00
47500 -- (-1083.732) (-1083.239) [-1082.016] (-1082.997) * [-1091.152] (-1086.087) (-1094.146) (-1091.766) -- 0:01:00
48000 -- [-1084.095] (-1082.931) (-1081.835) (-1085.651) * (-1092.267) [-1082.603] (-1096.663) (-1089.216) -- 0:00:59
48500 -- (-1082.933) (-1083.326) [-1082.678] (-1084.519) * (-1102.927) [-1083.990] (-1090.661) (-1092.280) -- 0:00:58
49000 -- [-1082.930] (-1082.642) (-1082.034) (-1085.963) * (-1091.891) [-1084.142] (-1096.176) (-1091.671) -- 0:00:58
49500 -- (-1081.308) [-1081.655] (-1082.694) (-1084.472) * [-1090.649] (-1084.489) (-1085.942) (-1092.121) -- 0:00:57
50000 -- (-1082.555) (-1084.477) [-1084.363] (-1083.541) * [-1090.206] (-1082.770) (-1082.417) (-1088.785) -- 0:00:57
Average standard deviation of split frequencies: 0.020567
50500 -- (-1082.630) (-1083.476) [-1083.617] (-1082.113) * (-1093.322) (-1081.910) [-1088.740] (-1087.436) -- 0:00:56
51000 -- (-1084.392) [-1080.980] (-1082.287) (-1082.030) * (-1099.542) (-1082.589) (-1082.947) [-1091.914] -- 0:00:55
51500 -- (-1084.793) (-1083.251) [-1082.226] (-1083.209) * [-1088.480] (-1083.340) (-1084.509) (-1087.490) -- 0:00:55
52000 -- (-1082.888) (-1086.140) (-1084.740) [-1082.957] * (-1091.887) (-1084.410) [-1082.090] (-1083.789) -- 0:00:54
52500 -- (-1083.090) (-1086.117) [-1084.527] (-1084.397) * (-1106.421) (-1084.025) [-1081.762] (-1083.148) -- 0:00:54
53000 -- (-1085.030) (-1085.187) (-1083.356) [-1084.363] * (-1102.936) (-1083.163) (-1082.616) [-1082.085] -- 0:00:53
53500 -- [-1082.235] (-1087.676) (-1084.866) (-1084.397) * (-1106.288) [-1082.702] (-1083.952) (-1081.480) -- 0:00:53
54000 -- [-1083.032] (-1083.063) (-1084.021) (-1081.678) * [-1102.088] (-1081.465) (-1087.457) (-1084.097) -- 0:00:52
54500 -- (-1083.099) [-1082.547] (-1084.386) (-1082.645) * (-1091.293) [-1081.361] (-1087.377) (-1085.965) -- 0:00:52
55000 -- (-1082.327) (-1081.655) [-1083.194] (-1082.619) * (-1091.106) [-1083.174] (-1085.850) (-1091.227) -- 0:00:51
Average standard deviation of split frequencies: 0.021513
55500 -- (-1083.211) (-1081.475) [-1082.915] (-1081.454) * (-1096.649) (-1084.851) [-1089.475] (-1083.485) -- 0:00:51
56000 -- (-1084.599) [-1081.348] (-1083.640) (-1082.027) * (-1090.393) (-1088.478) [-1084.922] (-1083.673) -- 0:00:50
56500 -- (-1085.820) [-1082.309] (-1082.606) (-1081.551) * (-1100.801) (-1084.163) (-1087.123) [-1082.335] -- 0:00:50
57000 -- [-1083.802] (-1082.424) (-1082.501) (-1085.753) * (-1098.032) (-1086.692) (-1084.264) [-1083.275] -- 0:00:49
57500 -- (-1088.795) [-1083.613] (-1083.789) (-1082.082) * (-1094.605) (-1087.443) (-1084.263) [-1087.967] -- 0:00:49
58000 -- (-1082.069) (-1084.942) (-1083.216) [-1081.789] * (-1096.860) [-1087.105] (-1081.946) (-1089.435) -- 0:00:48
58500 -- (-1082.468) (-1083.563) [-1084.698] (-1082.913) * (-1100.080) [-1086.674] (-1081.200) (-1089.737) -- 0:00:48
59000 -- [-1081.017] (-1081.025) (-1081.959) (-1083.198) * (-1103.415) [-1084.272] (-1082.064) (-1082.950) -- 0:00:47
59500 -- (-1081.023) (-1082.526) [-1081.967] (-1083.233) * [-1090.710] (-1082.481) (-1082.302) (-1089.453) -- 0:00:47
60000 -- [-1081.220] (-1080.951) (-1082.349) (-1083.084) * (-1090.742) (-1082.726) (-1081.995) [-1088.925] -- 0:00:47
Average standard deviation of split frequencies: 0.022493
60500 -- (-1087.187) (-1081.468) (-1083.161) [-1081.233] * (-1100.306) (-1082.378) [-1081.840] (-1086.600) -- 0:00:46
61000 -- (-1083.096) (-1085.063) [-1081.976] (-1082.200) * (-1089.125) (-1081.472) [-1081.412] (-1082.336) -- 0:00:46
61500 -- (-1081.071) [-1084.135] (-1081.324) (-1082.022) * (-1097.095) (-1081.975) (-1083.772) [-1083.466] -- 0:00:45
62000 -- [-1084.181] (-1083.355) (-1082.114) (-1083.904) * [-1094.048] (-1081.891) (-1081.688) (-1084.159) -- 0:00:45
62500 -- [-1081.445] (-1084.356) (-1082.949) (-1084.765) * (-1100.775) (-1081.412) (-1082.424) [-1083.335] -- 0:00:45
63000 -- (-1082.151) (-1085.066) [-1082.158] (-1085.192) * (-1086.809) (-1081.412) [-1080.977] (-1081.477) -- 0:00:59
63500 -- (-1080.798) (-1082.373) [-1082.827] (-1083.713) * (-1089.918) (-1082.849) (-1084.248) [-1086.894] -- 0:00:58
64000 -- [-1081.537] (-1082.757) (-1083.410) (-1083.489) * [-1089.899] (-1084.683) (-1088.292) (-1084.274) -- 0:00:58
64500 -- (-1083.971) (-1082.254) [-1084.117] (-1083.348) * (-1085.474) (-1082.878) [-1083.510] (-1083.683) -- 0:00:58
65000 -- [-1081.031] (-1086.814) (-1082.195) (-1082.051) * (-1093.904) (-1081.562) [-1082.960] (-1085.583) -- 0:00:57
Average standard deviation of split frequencies: 0.021427
65500 -- [-1082.691] (-1083.286) (-1085.536) (-1082.716) * (-1093.283) [-1081.541] (-1082.213) (-1088.531) -- 0:00:57
66000 -- (-1085.675) (-1083.534) (-1085.571) [-1082.506] * (-1091.653) [-1080.950] (-1082.485) (-1086.276) -- 0:00:56
66500 -- (-1084.734) (-1082.101) [-1085.201] (-1082.986) * (-1088.087) [-1084.028] (-1083.115) (-1085.333) -- 0:00:56
67000 -- (-1085.770) [-1083.355] (-1082.815) (-1084.294) * (-1093.552) (-1083.092) [-1082.553] (-1085.956) -- 0:00:55
67500 -- (-1083.619) (-1083.087) (-1084.458) [-1083.711] * (-1094.173) (-1082.784) (-1082.259) [-1082.111] -- 0:00:55
68000 -- [-1082.290] (-1082.964) (-1089.236) (-1082.161) * (-1089.500) [-1083.378] (-1082.202) (-1081.956) -- 0:00:54
68500 -- (-1082.412) (-1082.455) (-1083.637) [-1085.422] * [-1090.194] (-1082.435) (-1083.575) (-1082.480) -- 0:00:54
69000 -- [-1083.143] (-1083.159) (-1083.464) (-1085.755) * (-1091.012) (-1082.380) (-1082.847) [-1081.998] -- 0:00:53
69500 -- [-1084.417] (-1081.915) (-1082.094) (-1083.851) * [-1089.833] (-1083.574) (-1082.353) (-1081.825) -- 0:00:53
70000 -- (-1082.500) (-1081.858) (-1082.501) [-1084.285] * (-1097.376) (-1084.288) [-1083.595] (-1086.276) -- 0:00:53
Average standard deviation of split frequencies: 0.020715
70500 -- (-1082.021) (-1081.957) (-1082.771) [-1084.286] * (-1089.502) (-1085.119) (-1081.684) [-1083.459] -- 0:00:52
71000 -- [-1081.423] (-1081.774) (-1081.902) (-1081.368) * [-1089.593] (-1082.708) (-1081.976) (-1085.217) -- 0:00:52
71500 -- (-1081.376) (-1082.213) [-1083.553] (-1081.299) * (-1093.061) (-1081.955) (-1081.894) [-1083.879] -- 0:00:51
72000 -- (-1081.578) (-1085.783) (-1082.210) [-1080.761] * (-1092.906) [-1081.755] (-1083.424) (-1082.236) -- 0:00:51
72500 -- (-1081.332) [-1080.948] (-1083.408) (-1083.705) * (-1097.071) (-1085.677) (-1082.237) [-1082.095] -- 0:00:51
73000 -- (-1081.365) (-1080.959) [-1083.779] (-1082.288) * (-1097.075) (-1082.113) (-1082.664) [-1081.568] -- 0:00:50
73500 -- [-1080.946] (-1083.060) (-1082.092) (-1082.066) * (-1098.907) (-1083.006) (-1081.555) [-1083.360] -- 0:00:50
74000 -- (-1081.111) (-1082.555) (-1082.063) [-1083.801] * [-1089.438] (-1081.145) (-1081.442) (-1083.298) -- 0:00:50
74500 -- [-1082.077] (-1081.703) (-1081.953) (-1083.204) * [-1091.258] (-1083.849) (-1082.253) (-1081.860) -- 0:00:49
75000 -- (-1083.263) (-1085.304) (-1082.228) [-1082.944] * (-1089.647) [-1082.115] (-1082.259) (-1085.181) -- 0:00:49
Average standard deviation of split frequencies: 0.020432
75500 -- (-1083.152) (-1083.296) [-1081.299] (-1081.838) * (-1089.916) (-1081.897) (-1083.895) [-1082.396] -- 0:00:48
76000 -- [-1081.876] (-1081.925) (-1083.085) (-1085.336) * (-1092.964) [-1084.135] (-1081.734) (-1080.885) -- 0:00:48
76500 -- (-1082.503) [-1085.721] (-1081.754) (-1085.635) * (-1093.884) [-1081.595] (-1082.974) (-1081.743) -- 0:00:48
77000 -- (-1084.957) (-1083.783) (-1082.057) [-1083.833] * (-1090.446) [-1081.507] (-1082.937) (-1082.826) -- 0:00:47
77500 -- (-1085.209) (-1082.630) (-1084.135) [-1082.294] * (-1106.072) [-1082.439] (-1083.379) (-1082.592) -- 0:00:47
78000 -- (-1083.838) (-1082.690) (-1090.275) [-1082.330] * (-1095.065) (-1081.482) (-1084.961) [-1081.197] -- 0:00:47
78500 -- (-1088.068) (-1083.005) [-1081.374] (-1084.563) * [-1098.493] (-1081.564) (-1085.570) (-1081.467) -- 0:00:46
79000 -- (-1084.215) (-1083.528) [-1082.583] (-1081.955) * (-1096.830) (-1082.136) [-1080.932] (-1080.910) -- 0:00:46
79500 -- (-1083.801) (-1083.598) [-1084.006] (-1083.340) * (-1097.448) (-1082.861) (-1080.826) [-1080.715] -- 0:00:57
80000 -- [-1081.288] (-1084.068) (-1083.043) (-1082.438) * [-1087.849] (-1083.188) (-1086.946) (-1088.276) -- 0:00:57
Average standard deviation of split frequencies: 0.022726
80500 -- (-1081.422) [-1083.529] (-1083.425) (-1083.730) * (-1095.986) (-1084.856) (-1082.432) [-1082.833] -- 0:00:57
81000 -- (-1084.098) (-1090.251) [-1081.900] (-1082.914) * [-1086.374] (-1081.502) (-1081.688) (-1082.311) -- 0:00:56
81500 -- (-1084.241) [-1082.251] (-1081.848) (-1081.991) * (-1088.122) [-1081.057] (-1081.585) (-1083.777) -- 0:00:56
82000 -- (-1081.925) [-1085.350] (-1083.328) (-1085.082) * (-1094.188) (-1084.051) (-1082.576) [-1082.904] -- 0:00:55
82500 -- (-1084.304) (-1087.188) (-1083.912) [-1084.381] * (-1091.117) (-1083.906) [-1081.176] (-1081.360) -- 0:00:55
83000 -- (-1082.061) [-1083.050] (-1083.035) (-1085.250) * [-1089.538] (-1083.326) (-1084.358) (-1084.432) -- 0:00:55
83500 -- (-1083.027) [-1083.834] (-1081.808) (-1081.196) * (-1091.919) (-1084.131) [-1083.448] (-1082.061) -- 0:00:54
84000 -- (-1084.691) (-1081.938) [-1082.233] (-1082.002) * (-1082.292) [-1085.500] (-1081.256) (-1084.113) -- 0:00:54
84500 -- (-1082.066) [-1084.708] (-1083.513) (-1081.628) * (-1083.572) [-1085.095] (-1081.634) (-1083.787) -- 0:00:54
85000 -- (-1081.746) (-1085.036) [-1085.386] (-1081.999) * (-1082.505) (-1086.588) (-1084.891) [-1082.319] -- 0:00:53
Average standard deviation of split frequencies: 0.019838
85500 -- (-1081.641) (-1083.003) (-1081.906) [-1082.233] * [-1084.249] (-1085.456) (-1082.570) (-1084.044) -- 0:00:53
86000 -- (-1081.837) (-1082.946) (-1081.196) [-1082.078] * (-1082.887) (-1083.135) [-1080.830] (-1084.273) -- 0:00:53
86500 -- (-1081.524) (-1083.056) [-1081.133] (-1083.415) * (-1081.804) (-1082.087) (-1084.128) [-1083.584] -- 0:00:52
87000 -- (-1081.751) (-1082.160) (-1082.687) [-1083.742] * (-1082.952) (-1083.291) (-1081.856) [-1081.819] -- 0:00:52
87500 -- [-1083.089] (-1083.105) (-1084.805) (-1081.509) * (-1085.470) (-1082.475) [-1081.486] (-1082.325) -- 0:00:52
88000 -- (-1081.407) (-1086.278) [-1085.013] (-1080.891) * (-1084.060) [-1082.571] (-1081.702) (-1082.180) -- 0:00:51
88500 -- [-1086.101] (-1085.644) (-1082.918) (-1081.555) * [-1081.181] (-1081.388) (-1083.468) (-1080.990) -- 0:00:51
89000 -- [-1082.796] (-1084.114) (-1083.253) (-1081.552) * [-1084.030] (-1081.140) (-1085.678) (-1081.384) -- 0:00:51
89500 -- (-1082.468) (-1085.437) (-1083.784) [-1082.555] * (-1083.727) (-1083.878) [-1082.451] (-1083.038) -- 0:00:50
90000 -- [-1083.199] (-1082.165) (-1083.815) (-1082.752) * [-1084.671] (-1084.158) (-1084.201) (-1082.047) -- 0:00:50
Average standard deviation of split frequencies: 0.020524
90500 -- (-1084.273) (-1082.374) [-1083.758] (-1083.916) * (-1082.993) [-1086.930] (-1081.882) (-1086.464) -- 0:00:50
91000 -- (-1084.089) [-1085.669] (-1081.322) (-1086.250) * [-1082.251] (-1086.859) (-1084.594) (-1087.304) -- 0:00:49
91500 -- (-1083.633) (-1084.664) [-1083.750] (-1086.549) * (-1082.559) [-1084.786] (-1083.255) (-1086.746) -- 0:00:49
92000 -- [-1082.519] (-1084.442) (-1082.354) (-1082.187) * (-1085.789) (-1082.632) (-1086.335) [-1086.182] -- 0:00:49
92500 -- (-1082.141) [-1081.632] (-1091.075) (-1082.900) * (-1083.602) (-1084.679) [-1083.147] (-1081.649) -- 0:00:49
93000 -- (-1082.881) [-1081.740] (-1089.174) (-1083.758) * [-1081.838] (-1084.272) (-1081.981) (-1081.709) -- 0:00:48
93500 -- [-1083.921] (-1081.729) (-1085.880) (-1085.485) * (-1083.269) [-1084.101] (-1084.181) (-1082.448) -- 0:00:48
94000 -- (-1087.028) [-1082.219] (-1083.926) (-1087.065) * (-1081.299) (-1083.719) (-1084.182) [-1084.203] -- 0:00:48
94500 -- (-1084.159) (-1090.770) (-1083.515) [-1085.819] * (-1082.346) (-1082.336) (-1081.864) [-1081.306] -- 0:00:47
95000 -- (-1082.279) (-1085.217) (-1085.258) [-1081.322] * (-1082.961) (-1082.062) [-1081.549] (-1085.143) -- 0:00:47
Average standard deviation of split frequencies: 0.022097
95500 -- (-1081.590) (-1082.771) [-1086.175] (-1082.862) * (-1083.395) [-1083.034] (-1081.726) (-1085.012) -- 0:00:56
96000 -- (-1083.604) (-1083.372) (-1082.921) [-1083.989] * (-1085.525) [-1088.854] (-1081.385) (-1084.766) -- 0:00:56
96500 -- (-1082.511) [-1084.019] (-1083.706) (-1083.510) * (-1083.234) (-1082.807) [-1083.314] (-1086.664) -- 0:00:56
97000 -- (-1086.021) [-1082.593] (-1082.873) (-1083.254) * (-1081.503) (-1083.096) [-1080.864] (-1083.169) -- 0:00:55
97500 -- (-1083.460) [-1083.737] (-1082.158) (-1084.763) * (-1081.906) (-1081.596) [-1082.503] (-1083.954) -- 0:00:55
98000 -- (-1082.648) [-1084.037] (-1082.328) (-1085.122) * (-1082.921) (-1084.241) [-1084.465] (-1084.564) -- 0:00:55
98500 -- [-1082.022] (-1086.100) (-1083.976) (-1086.188) * (-1082.554) (-1087.238) (-1081.942) [-1082.680] -- 0:00:54
99000 -- (-1082.123) [-1083.543] (-1082.908) (-1086.660) * (-1082.490) (-1081.879) (-1082.003) [-1082.582] -- 0:00:54
99500 -- (-1082.354) [-1084.103] (-1081.608) (-1085.800) * (-1082.934) (-1082.478) [-1082.414] (-1082.458) -- 0:00:54
100000 -- [-1083.151] (-1082.924) (-1081.564) (-1084.454) * (-1088.165) (-1082.503) [-1080.880] (-1083.083) -- 0:00:54
Average standard deviation of split frequencies: 0.019224
100500 -- (-1082.779) (-1083.719) [-1081.543] (-1083.093) * [-1086.691] (-1087.653) (-1082.762) (-1083.702) -- 0:00:53
101000 -- (-1082.532) (-1083.516) (-1082.220) [-1083.128] * [-1084.050] (-1082.427) (-1081.332) (-1083.305) -- 0:00:53
101500 -- (-1083.367) [-1082.053] (-1083.201) (-1083.826) * (-1084.056) (-1085.037) [-1081.248] (-1083.965) -- 0:00:53
102000 -- [-1081.433] (-1083.100) (-1085.309) (-1082.273) * (-1084.292) (-1084.652) [-1081.282] (-1086.471) -- 0:00:52
102500 -- (-1081.423) [-1084.520] (-1085.552) (-1080.833) * [-1084.164] (-1085.275) (-1081.429) (-1083.527) -- 0:00:52
103000 -- (-1084.812) [-1085.344] (-1082.864) (-1081.685) * (-1084.455) (-1086.312) [-1081.990] (-1083.197) -- 0:00:52
103500 -- (-1084.339) [-1084.123] (-1083.896) (-1081.912) * (-1083.117) (-1083.335) [-1085.018] (-1083.362) -- 0:00:51
104000 -- (-1083.420) (-1083.727) [-1086.303] (-1082.060) * (-1083.849) (-1083.431) (-1084.905) [-1082.980] -- 0:00:51
104500 -- (-1083.478) [-1084.465] (-1085.664) (-1083.374) * (-1082.370) (-1085.353) [-1082.840] (-1083.731) -- 0:00:51
105000 -- (-1085.241) (-1084.153) [-1084.180] (-1082.720) * (-1088.081) (-1087.485) (-1083.167) [-1083.202] -- 0:00:51
Average standard deviation of split frequencies: 0.017321
105500 -- (-1082.292) [-1083.198] (-1083.226) (-1081.658) * (-1084.588) (-1084.755) (-1085.256) [-1082.362] -- 0:00:50
106000 -- (-1083.496) [-1083.904] (-1085.733) (-1081.301) * (-1088.867) (-1085.142) [-1082.384] (-1085.495) -- 0:00:50
106500 -- (-1085.997) (-1088.716) (-1083.419) [-1081.322] * (-1085.236) (-1085.100) [-1082.166] (-1087.197) -- 0:00:50
107000 -- (-1083.551) (-1082.029) (-1083.255) [-1081.269] * [-1083.479] (-1085.736) (-1086.098) (-1084.907) -- 0:00:50
107500 -- (-1084.804) (-1081.828) (-1092.846) [-1083.142] * (-1083.622) [-1087.740] (-1082.892) (-1084.320) -- 0:00:49
108000 -- [-1085.505] (-1082.915) (-1082.321) (-1081.823) * (-1086.404) [-1087.744] (-1084.372) (-1084.967) -- 0:00:49
108500 -- (-1081.844) (-1082.461) [-1082.101] (-1083.274) * (-1084.827) (-1086.285) [-1086.782] (-1085.901) -- 0:00:49
109000 -- [-1081.757] (-1084.073) (-1082.032) (-1082.643) * (-1081.397) (-1083.624) (-1087.707) [-1084.754] -- 0:00:49
109500 -- [-1082.091] (-1083.870) (-1087.032) (-1082.792) * (-1081.873) (-1086.020) [-1085.088] (-1084.716) -- 0:00:48
110000 -- (-1081.845) (-1083.142) (-1085.622) [-1081.563] * (-1086.693) [-1083.293] (-1084.912) (-1081.121) -- 0:00:48
Average standard deviation of split frequencies: 0.019056
110500 -- (-1080.840) (-1082.085) (-1084.834) [-1082.938] * (-1083.312) [-1082.760] (-1082.106) (-1082.555) -- 0:00:48
111000 -- [-1083.702] (-1083.022) (-1083.031) (-1082.219) * (-1082.314) [-1082.609] (-1085.898) (-1083.361) -- 0:00:48
111500 -- (-1085.217) [-1082.381] (-1084.396) (-1087.631) * (-1084.996) (-1083.075) (-1085.937) [-1082.264] -- 0:00:55
112000 -- (-1085.221) (-1083.481) (-1084.972) [-1082.874] * (-1088.428) (-1083.421) (-1086.733) [-1083.062] -- 0:00:55
112500 -- (-1082.722) (-1084.816) (-1087.227) [-1083.782] * [-1084.912] (-1082.718) (-1085.228) (-1086.224) -- 0:00:55
113000 -- (-1081.346) (-1084.633) [-1083.330] (-1085.076) * (-1081.724) (-1083.027) (-1084.314) [-1082.089] -- 0:00:54
113500 -- (-1081.038) (-1083.276) (-1085.816) [-1084.807] * (-1083.119) (-1083.836) [-1082.854] (-1081.722) -- 0:00:54
114000 -- (-1080.747) [-1084.725] (-1083.694) (-1084.459) * (-1084.720) (-1084.136) (-1082.956) [-1084.803] -- 0:00:54
114500 -- (-1081.286) (-1084.890) [-1082.935] (-1085.019) * (-1087.677) (-1084.068) (-1083.040) [-1085.996] -- 0:00:54
115000 -- [-1082.288] (-1083.998) (-1084.967) (-1083.216) * (-1087.003) (-1082.584) [-1083.210] (-1088.587) -- 0:00:53
Average standard deviation of split frequencies: 0.022244
115500 -- [-1083.653] (-1085.210) (-1089.408) (-1088.112) * (-1082.831) (-1082.997) [-1081.253] (-1086.166) -- 0:00:53
116000 -- (-1083.447) (-1083.678) (-1090.841) [-1082.497] * (-1082.273) (-1085.293) [-1081.516] (-1082.453) -- 0:00:53
116500 -- (-1086.922) [-1082.622] (-1083.110) (-1085.571) * (-1082.291) (-1082.523) [-1082.420] (-1082.508) -- 0:00:53
117000 -- (-1086.377) (-1085.626) [-1088.427] (-1083.013) * (-1083.502) [-1082.446] (-1082.885) (-1082.302) -- 0:00:52
117500 -- (-1083.045) (-1082.095) (-1083.738) [-1081.592] * (-1084.275) [-1081.186] (-1083.344) (-1083.224) -- 0:00:52
118000 -- [-1085.113] (-1084.754) (-1084.758) (-1083.867) * (-1081.484) (-1082.321) [-1083.541] (-1081.974) -- 0:00:52
118500 -- (-1085.986) (-1085.166) (-1084.083) [-1083.583] * [-1081.350] (-1081.189) (-1084.891) (-1086.448) -- 0:00:52
119000 -- (-1080.616) (-1085.467) [-1083.339] (-1083.458) * [-1081.353] (-1082.100) (-1085.070) (-1084.822) -- 0:00:51
119500 -- (-1082.462) [-1083.985] (-1084.116) (-1086.735) * (-1085.953) [-1084.274] (-1084.778) (-1086.234) -- 0:00:51
120000 -- (-1081.003) (-1082.797) (-1086.712) [-1082.570] * [-1082.281] (-1080.879) (-1083.812) (-1085.106) -- 0:00:51
Average standard deviation of split frequencies: 0.021384
120500 -- [-1082.356] (-1083.156) (-1086.291) (-1085.297) * [-1083.132] (-1081.965) (-1083.382) (-1083.963) -- 0:00:51
121000 -- (-1084.315) [-1082.783] (-1085.573) (-1087.210) * (-1082.430) (-1084.136) [-1084.366] (-1082.431) -- 0:00:50
121500 -- (-1085.524) (-1083.327) [-1083.358] (-1082.790) * [-1082.353] (-1082.802) (-1085.612) (-1083.666) -- 0:00:50
122000 -- [-1082.394] (-1082.098) (-1091.447) (-1083.113) * (-1081.549) (-1090.134) [-1081.889] (-1084.239) -- 0:00:50
122500 -- (-1082.558) (-1081.411) [-1081.046] (-1085.587) * [-1082.290] (-1084.648) (-1082.048) (-1082.494) -- 0:00:50
123000 -- [-1083.653] (-1082.003) (-1083.520) (-1083.811) * (-1084.500) (-1085.261) [-1080.955] (-1082.740) -- 0:00:49
123500 -- [-1083.912] (-1082.725) (-1083.223) (-1086.162) * (-1083.673) [-1082.071] (-1085.831) (-1082.926) -- 0:00:49
124000 -- (-1085.056) [-1081.610] (-1085.511) (-1085.234) * [-1082.986] (-1083.529) (-1088.119) (-1081.566) -- 0:00:49
124500 -- [-1084.049] (-1081.328) (-1083.169) (-1087.301) * (-1084.160) (-1083.674) [-1081.513] (-1088.095) -- 0:00:49
125000 -- (-1082.878) [-1081.697] (-1081.310) (-1086.498) * (-1082.903) (-1084.945) (-1082.454) [-1083.125] -- 0:00:49
Average standard deviation of split frequencies: 0.021513
125500 -- (-1084.755) (-1083.813) (-1083.624) [-1083.178] * [-1085.538] (-1084.329) (-1081.586) (-1089.163) -- 0:00:48
126000 -- [-1080.953] (-1083.437) (-1082.783) (-1081.286) * [-1081.493] (-1084.296) (-1081.931) (-1095.149) -- 0:00:48
126500 -- (-1082.171) (-1083.631) (-1083.046) [-1081.258] * (-1083.081) (-1085.029) [-1084.068] (-1086.721) -- 0:00:48
127000 -- [-1083.520] (-1081.490) (-1082.546) (-1081.366) * [-1081.919] (-1082.507) (-1082.929) (-1085.540) -- 0:00:48
127500 -- (-1084.891) (-1081.283) [-1082.640] (-1082.224) * (-1081.108) (-1083.648) (-1084.043) [-1082.675] -- 0:00:54
128000 -- (-1083.358) (-1081.704) (-1082.136) [-1082.894] * (-1083.376) (-1083.253) (-1083.278) [-1083.198] -- 0:00:54
128500 -- [-1082.484] (-1081.409) (-1084.399) (-1083.029) * [-1084.358] (-1082.399) (-1082.938) (-1089.589) -- 0:00:54
129000 -- (-1082.014) [-1081.162] (-1082.971) (-1088.013) * (-1081.865) (-1084.701) [-1082.098] (-1082.177) -- 0:00:54
129500 -- (-1081.033) (-1083.371) (-1085.463) [-1083.399] * (-1085.903) [-1083.949] (-1084.583) (-1082.339) -- 0:00:53
130000 -- [-1082.559] (-1081.619) (-1082.445) (-1082.001) * (-1081.747) (-1084.056) [-1082.450] (-1082.213) -- 0:00:53
Average standard deviation of split frequencies: 0.019041
130500 -- [-1083.295] (-1083.335) (-1083.826) (-1082.236) * (-1088.767) (-1084.495) [-1082.008] (-1084.004) -- 0:00:53
131000 -- (-1082.096) [-1081.847] (-1084.923) (-1081.830) * [-1084.741] (-1086.612) (-1081.130) (-1084.729) -- 0:00:53
131500 -- (-1082.056) (-1083.141) (-1084.892) [-1082.418] * (-1084.525) (-1083.848) (-1081.498) [-1081.907] -- 0:00:52
132000 -- (-1088.154) [-1082.357] (-1083.025) (-1081.328) * (-1085.409) [-1084.077] (-1086.459) (-1082.075) -- 0:00:52
132500 -- (-1083.219) (-1083.177) [-1082.412] (-1081.665) * [-1081.803] (-1084.489) (-1081.537) (-1084.364) -- 0:00:52
133000 -- (-1081.826) [-1083.370] (-1083.120) (-1081.233) * (-1082.026) (-1084.656) (-1082.325) [-1082.451] -- 0:00:52
133500 -- [-1087.833] (-1084.865) (-1084.123) (-1081.557) * (-1081.081) (-1085.213) (-1083.162) [-1083.420] -- 0:00:51
134000 -- [-1081.319] (-1083.787) (-1082.227) (-1086.357) * [-1082.600] (-1083.194) (-1083.309) (-1084.562) -- 0:00:51
134500 -- (-1081.317) (-1081.370) (-1083.059) [-1083.970] * (-1085.050) (-1082.748) [-1082.394] (-1083.935) -- 0:00:51
135000 -- (-1084.137) (-1081.219) (-1082.570) [-1086.427] * (-1081.292) (-1086.390) [-1082.399] (-1082.399) -- 0:00:51
Average standard deviation of split frequencies: 0.019166
135500 -- [-1085.207] (-1081.008) (-1082.522) (-1082.331) * (-1082.832) [-1081.359] (-1081.966) (-1081.579) -- 0:00:51
136000 -- (-1083.872) [-1081.577] (-1082.875) (-1082.304) * (-1084.219) [-1083.734] (-1083.771) (-1082.811) -- 0:00:50
136500 -- (-1082.218) (-1081.820) [-1081.501] (-1082.625) * (-1083.039) (-1086.886) (-1081.260) [-1081.764] -- 0:00:50
137000 -- (-1084.983) (-1081.631) [-1081.025] (-1081.703) * (-1082.416) (-1088.109) (-1085.623) [-1081.027] -- 0:00:50
137500 -- (-1082.753) (-1084.473) (-1081.528) [-1082.812] * (-1084.113) (-1086.817) [-1087.754] (-1080.855) -- 0:00:50
138000 -- (-1086.659) (-1087.273) [-1081.309] (-1084.844) * (-1084.148) (-1083.851) (-1085.254) [-1081.040] -- 0:00:49
138500 -- [-1081.968] (-1082.236) (-1082.732) (-1083.604) * (-1086.216) (-1085.100) (-1082.801) [-1083.332] -- 0:00:49
139000 -- [-1086.176] (-1082.624) (-1084.356) (-1081.384) * (-1083.239) (-1082.061) [-1084.088] (-1081.992) -- 0:00:49
139500 -- [-1083.411] (-1083.027) (-1086.134) (-1082.439) * [-1083.278] (-1083.399) (-1082.844) (-1083.664) -- 0:00:49
140000 -- (-1083.529) (-1082.829) [-1082.823] (-1085.103) * (-1081.208) [-1083.079] (-1087.304) (-1080.976) -- 0:00:49
Average standard deviation of split frequencies: 0.018333
140500 -- (-1083.084) [-1082.982] (-1081.011) (-1082.296) * [-1082.204] (-1084.783) (-1085.098) (-1080.838) -- 0:00:48
141000 -- (-1083.688) [-1084.525] (-1082.333) (-1083.330) * [-1081.850] (-1081.610) (-1087.911) (-1081.449) -- 0:00:48
141500 -- (-1083.670) (-1085.384) (-1082.260) [-1083.652] * (-1083.982) [-1084.865] (-1083.648) (-1081.252) -- 0:00:48
142000 -- [-1083.890] (-1086.341) (-1084.216) (-1084.813) * (-1088.594) (-1084.703) [-1082.566] (-1081.047) -- 0:00:48
142500 -- (-1083.825) [-1092.785] (-1082.747) (-1083.352) * (-1084.826) [-1081.904] (-1082.341) (-1082.360) -- 0:00:48
143000 -- (-1088.658) (-1083.039) [-1084.444] (-1084.132) * (-1086.020) [-1083.367] (-1082.915) (-1082.057) -- 0:00:47
143500 -- (-1084.142) [-1082.564] (-1081.631) (-1083.012) * (-1083.926) (-1082.703) [-1082.644] (-1083.594) -- 0:00:53
144000 -- [-1088.680] (-1083.411) (-1083.337) (-1091.336) * (-1085.371) [-1085.502] (-1082.662) (-1081.693) -- 0:00:53
144500 -- (-1083.895) (-1081.802) (-1081.867) [-1081.349] * (-1090.750) [-1082.791] (-1082.416) (-1083.196) -- 0:00:53
145000 -- (-1082.387) (-1085.241) (-1081.927) [-1081.349] * [-1085.283] (-1081.983) (-1084.023) (-1083.200) -- 0:00:53
Average standard deviation of split frequencies: 0.017164
145500 -- (-1084.331) (-1083.619) (-1083.161) [-1081.409] * (-1084.173) [-1083.291] (-1081.220) (-1081.919) -- 0:00:52
146000 -- (-1084.307) [-1085.214] (-1084.688) (-1085.133) * [-1085.122] (-1084.107) (-1084.149) (-1081.945) -- 0:00:52
146500 -- (-1085.686) (-1089.278) [-1082.737] (-1085.631) * (-1081.546) (-1083.981) [-1081.855] (-1082.390) -- 0:00:52
147000 -- (-1082.536) (-1085.702) [-1085.948] (-1083.134) * [-1083.474] (-1082.264) (-1081.567) (-1083.669) -- 0:00:52
147500 -- (-1081.348) [-1085.507] (-1084.336) (-1083.512) * (-1082.388) (-1083.774) (-1082.606) [-1081.743] -- 0:00:52
148000 -- (-1082.307) [-1082.789] (-1083.330) (-1084.086) * (-1083.165) (-1085.586) (-1081.923) [-1081.761] -- 0:00:51
148500 -- (-1088.779) (-1084.475) (-1083.104) [-1084.612] * (-1080.927) (-1082.977) [-1081.401] (-1085.099) -- 0:00:51
149000 -- (-1087.624) (-1086.241) [-1082.604] (-1081.438) * (-1083.488) (-1082.209) [-1083.124] (-1086.573) -- 0:00:51
149500 -- (-1084.600) [-1081.319] (-1083.708) (-1083.393) * (-1083.191) (-1088.517) [-1085.213] (-1083.431) -- 0:00:51
150000 -- [-1084.078] (-1082.890) (-1083.285) (-1083.497) * [-1081.640] (-1084.771) (-1084.567) (-1084.013) -- 0:00:51
Average standard deviation of split frequencies: 0.019925
150500 -- (-1084.763) [-1081.582] (-1083.445) (-1082.819) * (-1085.642) (-1082.279) (-1082.091) [-1082.595] -- 0:00:50
151000 -- (-1085.739) (-1084.860) (-1083.055) [-1081.945] * (-1085.441) [-1086.013] (-1081.054) (-1084.153) -- 0:00:50
151500 -- (-1082.849) (-1083.860) [-1086.342] (-1084.240) * [-1083.674] (-1084.850) (-1082.859) (-1085.529) -- 0:00:50
152000 -- (-1082.672) (-1085.164) (-1084.667) [-1082.292] * [-1083.145] (-1084.401) (-1081.604) (-1086.239) -- 0:00:50
152500 -- (-1082.859) [-1084.816] (-1083.823) (-1082.470) * [-1083.186] (-1084.112) (-1081.604) (-1083.484) -- 0:00:50
153000 -- (-1082.153) (-1081.120) [-1082.055] (-1083.298) * (-1081.690) [-1081.739] (-1081.696) (-1083.145) -- 0:00:49
153500 -- [-1083.606] (-1081.459) (-1082.103) (-1086.960) * (-1081.721) [-1081.658] (-1083.344) (-1083.147) -- 0:00:49
154000 -- [-1084.103] (-1081.090) (-1083.722) (-1084.576) * (-1081.647) [-1081.939] (-1080.825) (-1085.776) -- 0:00:49
154500 -- (-1083.371) (-1080.915) [-1083.156] (-1083.343) * (-1084.377) [-1081.283] (-1080.825) (-1083.609) -- 0:00:49
155000 -- (-1084.500) [-1083.646] (-1084.591) (-1082.480) * (-1083.689) (-1086.763) (-1082.589) [-1083.923] -- 0:00:49
Average standard deviation of split frequencies: 0.019197
155500 -- [-1081.984] (-1082.814) (-1086.924) (-1081.500) * (-1081.845) [-1082.538] (-1082.573) (-1083.813) -- 0:00:48
156000 -- (-1086.288) (-1085.383) (-1084.437) [-1081.203] * [-1086.599] (-1086.953) (-1081.745) (-1083.873) -- 0:00:48
156500 -- (-1084.049) (-1083.795) [-1083.241] (-1093.820) * [-1085.067] (-1088.009) (-1083.080) (-1086.080) -- 0:00:48
157000 -- [-1081.589] (-1083.824) (-1087.006) (-1082.703) * (-1083.580) (-1083.355) [-1081.558] (-1084.986) -- 0:00:48
157500 -- (-1082.479) (-1083.408) (-1082.642) [-1082.634] * (-1084.033) [-1082.446] (-1083.013) (-1084.971) -- 0:00:48
158000 -- (-1086.121) (-1083.802) [-1083.738] (-1086.170) * (-1081.450) (-1082.228) [-1081.684] (-1083.719) -- 0:00:47
158500 -- (-1082.134) [-1082.487] (-1085.089) (-1083.139) * (-1082.383) (-1082.065) [-1083.689] (-1081.602) -- 0:00:47
159000 -- [-1082.320] (-1085.991) (-1083.078) (-1083.956) * (-1081.590) (-1083.721) (-1083.227) [-1084.641] -- 0:00:52
159500 -- (-1083.226) (-1081.608) (-1085.116) [-1082.613] * [-1081.589] (-1082.879) (-1081.442) (-1081.722) -- 0:00:52
160000 -- (-1084.955) [-1083.915] (-1082.582) (-1082.057) * (-1081.719) (-1082.377) [-1081.438] (-1087.033) -- 0:00:52
Average standard deviation of split frequencies: 0.018640
160500 -- (-1087.713) (-1083.427) (-1087.461) [-1081.578] * (-1081.664) (-1082.516) (-1081.835) [-1081.384] -- 0:00:52
161000 -- (-1083.881) [-1083.175] (-1083.703) (-1082.248) * (-1083.062) [-1082.276] (-1085.110) (-1081.221) -- 0:00:52
161500 -- [-1084.544] (-1084.994) (-1083.477) (-1081.502) * (-1083.132) (-1085.939) [-1082.582] (-1082.134) -- 0:00:51
162000 -- (-1084.379) (-1086.731) [-1083.006] (-1081.563) * (-1081.013) (-1081.600) [-1084.139] (-1081.393) -- 0:00:51
162500 -- (-1083.532) [-1085.666] (-1082.966) (-1083.496) * [-1081.941] (-1081.865) (-1081.573) (-1082.909) -- 0:00:51
163000 -- [-1083.091] (-1083.484) (-1083.058) (-1088.247) * (-1081.501) (-1081.322) (-1081.819) [-1082.123] -- 0:00:51
163500 -- [-1081.974] (-1083.557) (-1082.460) (-1082.220) * (-1081.064) (-1081.168) (-1085.775) [-1082.493] -- 0:00:51
164000 -- (-1081.254) [-1084.822] (-1082.071) (-1081.800) * (-1083.375) (-1085.273) (-1086.226) [-1082.111] -- 0:00:50
164500 -- (-1081.527) [-1088.052] (-1087.114) (-1084.183) * (-1083.416) [-1084.761] (-1084.042) (-1083.860) -- 0:00:50
165000 -- (-1086.160) (-1084.442) (-1087.009) [-1084.790] * (-1084.441) [-1082.197] (-1083.239) (-1081.558) -- 0:00:50
Average standard deviation of split frequencies: 0.016092
165500 -- [-1082.938] (-1083.980) (-1083.575) (-1082.852) * [-1084.361] (-1085.686) (-1082.666) (-1083.397) -- 0:00:50
166000 -- [-1082.845] (-1083.978) (-1083.636) (-1082.388) * [-1084.055] (-1084.376) (-1085.989) (-1082.660) -- 0:00:50
166500 -- [-1085.522] (-1082.661) (-1081.955) (-1083.248) * (-1083.621) (-1083.099) (-1084.017) [-1081.694] -- 0:00:50
167000 -- (-1085.128) (-1083.223) (-1081.258) [-1082.861] * (-1081.266) (-1085.525) (-1085.687) [-1083.995] -- 0:00:49
167500 -- (-1082.483) (-1082.891) (-1083.299) [-1082.397] * (-1081.893) [-1083.290] (-1086.391) (-1084.386) -- 0:00:49
168000 -- [-1082.684] (-1081.870) (-1083.573) (-1083.279) * (-1082.754) (-1088.237) (-1085.265) [-1083.974] -- 0:00:49
168500 -- [-1082.853] (-1083.731) (-1086.538) (-1081.571) * (-1089.482) (-1083.725) [-1086.734] (-1083.299) -- 0:00:49
169000 -- [-1082.946] (-1081.875) (-1085.140) (-1082.920) * (-1082.361) (-1082.543) [-1082.449] (-1082.654) -- 0:00:49
169500 -- (-1084.502) [-1081.368] (-1085.698) (-1082.102) * [-1082.190] (-1083.462) (-1082.539) (-1082.954) -- 0:00:48
170000 -- (-1082.892) [-1081.628] (-1083.176) (-1085.415) * (-1081.933) (-1081.753) [-1083.852] (-1082.951) -- 0:00:48
Average standard deviation of split frequencies: 0.017800
170500 -- (-1084.274) (-1082.723) [-1083.708] (-1081.994) * (-1081.993) (-1081.284) [-1081.917] (-1082.904) -- 0:00:48
171000 -- (-1081.978) (-1082.707) [-1082.272] (-1083.126) * (-1081.833) (-1082.340) [-1082.021] (-1084.784) -- 0:00:48
171500 -- [-1082.413] (-1083.955) (-1086.670) (-1082.496) * [-1083.489] (-1082.411) (-1084.181) (-1084.964) -- 0:00:48
172000 -- [-1083.944] (-1086.384) (-1083.829) (-1082.584) * (-1087.139) (-1084.912) [-1083.431] (-1082.696) -- 0:00:48
172500 -- (-1084.001) (-1085.525) [-1083.535] (-1085.016) * [-1082.123] (-1083.479) (-1084.353) (-1083.600) -- 0:00:47
173000 -- (-1084.210) (-1084.476) [-1082.562] (-1083.801) * (-1082.343) [-1083.082] (-1082.663) (-1086.767) -- 0:00:47
173500 -- (-1081.656) (-1083.094) (-1084.374) [-1082.324] * (-1083.488) (-1085.919) (-1083.408) [-1083.522] -- 0:00:47
174000 -- (-1085.324) (-1081.226) [-1087.218] (-1087.400) * (-1083.373) (-1085.383) [-1082.639] (-1083.179) -- 0:00:47
174500 -- (-1090.367) (-1085.315) [-1084.298] (-1085.484) * (-1083.792) (-1082.329) (-1083.842) [-1082.223] -- 0:00:47
175000 -- (-1081.604) [-1082.838] (-1086.447) (-1082.754) * (-1082.887) (-1083.524) (-1084.839) [-1082.357] -- 0:00:47
Average standard deviation of split frequencies: 0.018154
175500 -- [-1083.444] (-1082.345) (-1084.330) (-1084.145) * [-1082.887] (-1081.363) (-1082.428) (-1084.910) -- 0:00:51
176000 -- (-1085.127) (-1085.005) [-1083.879] (-1081.503) * (-1081.528) [-1081.940] (-1084.168) (-1083.681) -- 0:00:51
176500 -- [-1081.974] (-1085.654) (-1084.063) (-1081.783) * (-1082.204) (-1081.530) (-1082.110) [-1085.227] -- 0:00:51
177000 -- (-1081.960) (-1085.530) (-1085.978) [-1081.649] * (-1082.183) (-1082.021) [-1082.026] (-1083.270) -- 0:00:51
177500 -- (-1081.280) (-1082.170) (-1081.545) [-1081.759] * [-1082.783] (-1083.120) (-1081.863) (-1082.331) -- 0:00:50
178000 -- (-1080.716) (-1085.610) (-1083.882) [-1082.081] * [-1083.516] (-1082.232) (-1081.907) (-1086.220) -- 0:00:50
178500 -- (-1081.524) (-1086.686) [-1084.401] (-1083.275) * [-1082.059] (-1082.489) (-1081.154) (-1082.214) -- 0:00:50
179000 -- (-1083.560) [-1082.716] (-1082.557) (-1083.838) * (-1082.809) [-1083.231] (-1082.764) (-1082.938) -- 0:00:50
179500 -- (-1082.669) [-1082.366] (-1081.890) (-1083.593) * [-1083.134] (-1082.250) (-1083.174) (-1081.920) -- 0:00:50
180000 -- (-1083.472) [-1082.363] (-1083.361) (-1082.943) * [-1084.467] (-1087.958) (-1082.433) (-1083.392) -- 0:00:50
Average standard deviation of split frequencies: 0.019032
180500 -- (-1084.793) (-1084.213) [-1082.206] (-1086.781) * (-1086.405) (-1081.787) [-1083.955] (-1082.085) -- 0:00:49
181000 -- (-1083.040) (-1085.548) (-1081.177) [-1084.943] * (-1082.020) [-1082.154] (-1085.403) (-1085.173) -- 0:00:49
181500 -- (-1080.909) (-1084.364) [-1081.394] (-1082.082) * (-1082.463) (-1085.577) (-1084.781) [-1082.839] -- 0:00:49
182000 -- (-1083.332) [-1083.897] (-1083.158) (-1082.103) * (-1082.426) (-1085.122) [-1084.351] (-1082.767) -- 0:00:49
182500 -- (-1083.140) (-1086.065) [-1082.357] (-1084.128) * (-1089.074) (-1086.433) (-1081.605) [-1081.277] -- 0:00:49
183000 -- (-1084.479) (-1085.567) (-1081.613) [-1082.110] * [-1083.843] (-1085.861) (-1081.730) (-1082.567) -- 0:00:49
183500 -- [-1082.059] (-1087.578) (-1083.746) (-1081.778) * [-1080.874] (-1082.907) (-1084.728) (-1082.284) -- 0:00:48
184000 -- (-1083.730) [-1082.438] (-1082.451) (-1084.024) * [-1083.624] (-1081.467) (-1084.524) (-1082.922) -- 0:00:48
184500 -- [-1082.279] (-1081.948) (-1084.392) (-1081.970) * [-1082.009] (-1081.900) (-1083.403) (-1083.381) -- 0:00:48
185000 -- [-1082.029] (-1082.317) (-1083.530) (-1081.371) * (-1082.118) [-1083.088] (-1085.728) (-1082.958) -- 0:00:48
Average standard deviation of split frequencies: 0.018188
185500 -- (-1083.167) [-1083.633] (-1082.247) (-1081.464) * [-1082.273] (-1087.810) (-1082.047) (-1081.729) -- 0:00:48
186000 -- (-1081.305) [-1083.325] (-1082.603) (-1083.850) * (-1081.780) (-1082.794) (-1083.179) [-1082.414] -- 0:00:48
186500 -- (-1081.305) (-1081.556) [-1080.768] (-1082.567) * (-1082.645) [-1086.304] (-1082.844) (-1085.728) -- 0:00:47
187000 -- (-1081.513) [-1081.188] (-1080.745) (-1082.731) * [-1084.311] (-1087.290) (-1081.440) (-1084.289) -- 0:00:47
187500 -- [-1082.956] (-1083.117) (-1080.792) (-1086.898) * (-1083.604) (-1081.090) [-1081.647] (-1086.257) -- 0:00:47
188000 -- [-1081.407] (-1081.486) (-1084.050) (-1083.043) * (-1082.427) (-1081.453) [-1081.572] (-1082.931) -- 0:00:47
188500 -- [-1082.816] (-1082.375) (-1080.784) (-1086.097) * [-1082.866] (-1084.495) (-1081.761) (-1083.468) -- 0:00:47
189000 -- (-1082.956) (-1082.180) (-1083.365) [-1088.044] * (-1082.498) [-1081.444] (-1081.531) (-1083.312) -- 0:00:47
189500 -- (-1082.135) (-1085.062) [-1082.162] (-1082.055) * (-1081.493) (-1083.003) [-1081.144] (-1084.026) -- 0:00:47
190000 -- (-1082.477) (-1082.496) [-1084.563] (-1082.544) * (-1081.890) [-1081.178] (-1081.503) (-1081.898) -- 0:00:46
Average standard deviation of split frequencies: 0.019092
190500 -- (-1082.003) [-1081.598] (-1084.656) (-1084.970) * (-1085.684) (-1081.279) [-1081.593] (-1090.258) -- 0:00:46
191000 -- [-1082.840] (-1081.977) (-1085.019) (-1083.178) * (-1086.543) (-1085.500) [-1082.162] (-1084.144) -- 0:00:46
191500 -- [-1080.895] (-1084.016) (-1086.322) (-1086.608) * [-1082.955] (-1083.904) (-1081.848) (-1087.363) -- 0:00:50
192000 -- (-1082.111) [-1082.032] (-1083.988) (-1090.304) * (-1085.906) (-1085.126) [-1083.664] (-1083.066) -- 0:00:50
192500 -- [-1082.135] (-1084.243) (-1083.704) (-1087.530) * (-1085.155) [-1087.484] (-1082.313) (-1082.808) -- 0:00:50
193000 -- (-1084.661) [-1085.524] (-1085.255) (-1084.060) * (-1086.342) (-1083.849) (-1081.604) [-1083.782] -- 0:00:50
193500 -- (-1083.973) [-1086.626] (-1085.651) (-1082.100) * [-1083.209] (-1083.152) (-1081.246) (-1082.080) -- 0:00:50
194000 -- (-1081.492) (-1081.207) [-1083.233] (-1081.609) * (-1082.400) (-1088.416) [-1081.939] (-1082.984) -- 0:00:49
194500 -- (-1080.711) (-1081.150) (-1087.497) [-1081.752] * [-1082.493] (-1081.660) (-1082.694) (-1086.610) -- 0:00:49
195000 -- [-1081.848] (-1081.237) (-1085.520) (-1082.443) * (-1083.430) (-1082.117) [-1083.310] (-1094.242) -- 0:00:49
Average standard deviation of split frequencies: 0.019241
195500 -- (-1080.831) (-1081.822) [-1082.486] (-1083.758) * (-1083.653) [-1082.892] (-1086.051) (-1083.707) -- 0:00:49
196000 -- (-1081.310) (-1081.985) (-1081.462) [-1082.680] * [-1081.978] (-1083.389) (-1087.456) (-1081.775) -- 0:00:49
196500 -- [-1082.843] (-1086.143) (-1081.558) (-1086.667) * (-1083.059) (-1082.663) [-1083.476] (-1083.163) -- 0:00:49
197000 -- (-1083.001) (-1081.639) [-1085.582] (-1081.438) * (-1085.442) (-1082.604) [-1082.605] (-1092.702) -- 0:00:48
197500 -- [-1083.314] (-1082.462) (-1081.679) (-1082.764) * (-1084.121) (-1082.286) (-1082.279) [-1085.696] -- 0:00:48
198000 -- [-1085.482] (-1086.273) (-1084.468) (-1082.209) * (-1083.424) [-1081.851] (-1081.697) (-1083.176) -- 0:00:48
198500 -- (-1085.710) (-1083.495) (-1082.915) [-1082.031] * (-1083.233) [-1082.178] (-1081.864) (-1082.305) -- 0:00:48
199000 -- (-1086.684) [-1081.148] (-1084.033) (-1081.129) * (-1084.793) (-1081.568) (-1083.841) [-1081.974] -- 0:00:48
199500 -- (-1081.668) [-1084.443] (-1082.436) (-1081.868) * (-1085.427) (-1082.118) (-1081.835) [-1085.163] -- 0:00:48
200000 -- (-1081.520) [-1083.102] (-1082.099) (-1084.116) * [-1082.679] (-1081.273) (-1082.078) (-1084.535) -- 0:00:48
Average standard deviation of split frequencies: 0.016444
200500 -- (-1080.774) (-1086.784) [-1084.607] (-1083.810) * [-1084.921] (-1082.548) (-1083.358) (-1083.903) -- 0:00:47
201000 -- (-1088.731) (-1086.074) (-1082.189) [-1083.216] * (-1081.865) (-1082.300) [-1086.040] (-1088.387) -- 0:00:47
201500 -- (-1083.397) [-1083.725] (-1082.505) (-1086.785) * (-1081.972) [-1084.063] (-1081.654) (-1083.289) -- 0:00:47
202000 -- (-1082.228) (-1086.920) (-1084.047) [-1081.146] * (-1081.865) [-1082.358] (-1083.402) (-1082.503) -- 0:00:47
202500 -- (-1086.382) (-1082.830) (-1085.044) [-1081.490] * (-1081.089) [-1082.614] (-1080.942) (-1082.519) -- 0:00:47
203000 -- (-1083.432) (-1081.877) (-1083.098) [-1081.622] * (-1081.407) [-1082.627] (-1081.572) (-1082.011) -- 0:00:47
203500 -- (-1082.671) (-1080.823) (-1083.208) [-1083.535] * (-1081.627) (-1082.509) [-1084.464] (-1084.750) -- 0:00:46
204000 -- (-1082.426) (-1081.347) (-1086.796) [-1082.176] * (-1082.133) (-1082.887) [-1085.042] (-1083.338) -- 0:00:46
204500 -- (-1082.692) (-1086.221) [-1086.791] (-1086.746) * [-1083.434] (-1084.598) (-1084.090) (-1082.720) -- 0:00:46
205000 -- (-1082.677) (-1083.544) (-1082.831) [-1085.768] * (-1083.636) (-1082.068) (-1082.087) [-1086.944] -- 0:00:46
Average standard deviation of split frequencies: 0.015898
205500 -- [-1082.173] (-1083.448) (-1082.287) (-1087.618) * (-1081.044) [-1082.022] (-1083.517) (-1085.239) -- 0:00:46
206000 -- (-1082.399) [-1082.516] (-1082.659) (-1087.481) * (-1081.902) [-1085.634] (-1084.600) (-1084.967) -- 0:00:46
206500 -- (-1081.105) (-1082.922) [-1085.612] (-1087.047) * [-1082.596] (-1084.166) (-1082.191) (-1083.610) -- 0:00:46
207000 -- [-1084.597] (-1086.543) (-1084.096) (-1084.817) * (-1085.365) (-1082.847) [-1084.745] (-1082.369) -- 0:00:45
207500 -- (-1081.448) (-1082.548) [-1085.035] (-1085.735) * (-1087.974) (-1081.839) (-1082.246) [-1082.332] -- 0:00:49
208000 -- (-1081.671) [-1085.032] (-1085.657) (-1085.279) * [-1082.499] (-1081.837) (-1082.523) (-1083.721) -- 0:00:49
208500 -- (-1081.630) [-1082.404] (-1083.948) (-1087.967) * (-1081.494) [-1081.276] (-1083.257) (-1082.613) -- 0:00:49
209000 -- [-1081.266] (-1081.638) (-1081.940) (-1084.589) * [-1082.331] (-1084.871) (-1082.960) (-1086.007) -- 0:00:49
209500 -- (-1081.624) [-1086.357] (-1082.194) (-1083.056) * [-1081.811] (-1084.409) (-1084.887) (-1082.180) -- 0:00:49
210000 -- (-1081.633) (-1084.826) [-1082.999] (-1083.213) * [-1081.693] (-1084.442) (-1085.175) (-1085.842) -- 0:00:48
Average standard deviation of split frequencies: 0.017280
210500 -- (-1083.173) [-1081.785] (-1083.620) (-1083.236) * (-1084.364) (-1086.476) [-1083.304] (-1082.820) -- 0:00:48
211000 -- (-1082.255) (-1082.820) [-1081.750] (-1087.197) * (-1081.616) (-1082.954) [-1082.606] (-1086.657) -- 0:00:48
211500 -- [-1083.907] (-1082.192) (-1087.693) (-1084.348) * (-1081.541) [-1084.132] (-1081.357) (-1082.877) -- 0:00:48
212000 -- [-1087.079] (-1084.928) (-1083.073) (-1083.289) * (-1083.185) (-1083.071) [-1084.384] (-1084.793) -- 0:00:48
212500 -- (-1081.296) (-1088.381) [-1081.952] (-1082.929) * (-1081.376) (-1082.911) [-1083.598] (-1083.611) -- 0:00:48
213000 -- [-1081.315] (-1086.541) (-1085.195) (-1084.662) * [-1081.088] (-1082.429) (-1083.749) (-1087.327) -- 0:00:48
213500 -- (-1082.000) (-1084.566) [-1087.267] (-1082.777) * (-1082.480) (-1085.119) (-1084.296) [-1082.152] -- 0:00:47
214000 -- (-1084.964) (-1084.746) (-1082.350) [-1086.386] * (-1084.348) [-1083.285] (-1083.873) (-1081.940) -- 0:00:47
214500 -- (-1083.576) (-1083.796) [-1082.823] (-1081.517) * (-1083.291) (-1083.660) (-1086.165) [-1082.033] -- 0:00:47
215000 -- (-1083.112) (-1084.505) (-1082.987) [-1082.248] * (-1084.332) (-1086.549) (-1086.636) [-1081.249] -- 0:00:47
Average standard deviation of split frequencies: 0.016611
215500 -- [-1082.068] (-1083.837) (-1081.583) (-1081.136) * [-1081.838] (-1082.885) (-1086.821) (-1081.513) -- 0:00:47
216000 -- (-1083.277) (-1081.290) (-1082.849) [-1081.803] * (-1082.902) [-1083.506] (-1091.861) (-1082.676) -- 0:00:47
216500 -- (-1081.928) [-1081.065] (-1082.566) (-1082.976) * (-1086.458) [-1082.855] (-1084.847) (-1082.147) -- 0:00:47
217000 -- (-1081.798) (-1082.344) [-1082.140] (-1084.382) * (-1088.391) [-1085.851] (-1084.333) (-1083.414) -- 0:00:46
217500 -- (-1084.269) (-1080.847) (-1082.655) [-1082.713] * (-1080.913) (-1083.637) (-1082.726) [-1083.752] -- 0:00:46
218000 -- [-1083.242] (-1081.003) (-1085.084) (-1082.685) * (-1081.419) [-1082.666] (-1080.891) (-1084.358) -- 0:00:46
218500 -- (-1082.105) (-1087.037) (-1082.179) [-1083.041] * (-1084.169) (-1084.292) (-1081.718) [-1083.410] -- 0:00:46
219000 -- [-1084.161] (-1086.040) (-1082.054) (-1083.070) * (-1084.102) (-1083.762) (-1082.446) [-1084.861] -- 0:00:46
219500 -- [-1081.555] (-1083.858) (-1082.442) (-1083.963) * (-1082.066) [-1081.835] (-1081.549) (-1082.693) -- 0:00:46
220000 -- (-1086.798) [-1084.088] (-1080.998) (-1083.239) * [-1083.663] (-1083.340) (-1083.075) (-1081.109) -- 0:00:46
Average standard deviation of split frequencies: 0.015457
220500 -- [-1083.436] (-1084.049) (-1081.055) (-1083.506) * (-1086.884) (-1084.092) (-1081.933) [-1082.408] -- 0:00:45
221000 -- (-1083.666) (-1082.236) [-1082.335] (-1084.770) * (-1084.402) (-1086.473) (-1081.694) [-1083.537] -- 0:00:45
221500 -- (-1081.515) (-1083.402) [-1081.709] (-1083.952) * (-1082.546) (-1084.534) (-1081.872) [-1081.871] -- 0:00:45
222000 -- (-1083.452) (-1084.011) (-1082.321) [-1081.270] * (-1085.293) [-1084.757] (-1084.702) (-1089.121) -- 0:00:45
222500 -- (-1083.235) (-1084.067) (-1082.568) [-1081.126] * [-1086.279] (-1084.545) (-1082.264) (-1086.174) -- 0:00:45
223000 -- (-1081.974) (-1083.895) (-1083.608) [-1082.371] * (-1081.463) (-1083.925) (-1082.778) [-1082.366] -- 0:00:45
223500 -- (-1082.978) (-1085.450) (-1083.519) [-1082.507] * (-1083.348) (-1084.991) (-1090.493) [-1082.118] -- 0:00:45
224000 -- (-1081.772) [-1081.563] (-1084.540) (-1082.741) * (-1085.571) (-1081.001) (-1095.740) [-1081.440] -- 0:00:48
224500 -- (-1082.183) [-1082.612] (-1084.849) (-1082.656) * (-1081.504) (-1081.626) (-1089.513) [-1081.691] -- 0:00:48
225000 -- (-1081.529) (-1081.392) (-1084.235) [-1080.732] * (-1082.135) [-1081.959] (-1084.565) (-1083.380) -- 0:00:48
Average standard deviation of split frequencies: 0.013674
225500 -- [-1080.899] (-1081.731) (-1081.877) (-1080.727) * (-1082.726) [-1080.935] (-1084.885) (-1082.365) -- 0:00:48
226000 -- (-1086.454) [-1082.785] (-1085.889) (-1080.894) * (-1082.276) [-1081.315] (-1085.017) (-1082.577) -- 0:00:47
226500 -- [-1081.541] (-1083.412) (-1085.805) (-1080.880) * [-1082.291] (-1082.227) (-1083.926) (-1084.421) -- 0:00:47
227000 -- [-1081.176] (-1084.704) (-1085.348) (-1080.881) * [-1081.229] (-1081.884) (-1085.676) (-1083.103) -- 0:00:47
227500 -- (-1081.262) [-1084.203] (-1088.909) (-1081.271) * [-1083.002] (-1082.424) (-1086.199) (-1084.946) -- 0:00:47
228000 -- (-1081.129) (-1081.523) (-1083.911) [-1081.319] * (-1082.920) [-1082.640] (-1083.981) (-1082.716) -- 0:00:47
228500 -- [-1083.675] (-1081.827) (-1080.964) (-1083.509) * (-1084.304) (-1082.969) (-1084.544) [-1081.603] -- 0:00:47
229000 -- (-1084.984) (-1084.010) (-1082.528) [-1083.759] * (-1083.026) (-1082.740) [-1082.363] (-1087.579) -- 0:00:47
229500 -- (-1083.602) [-1081.720] (-1083.191) (-1081.793) * (-1081.929) (-1085.817) (-1083.203) [-1083.892] -- 0:00:47
230000 -- (-1082.775) [-1083.236] (-1082.643) (-1082.065) * (-1084.384) (-1081.689) (-1084.090) [-1082.745] -- 0:00:46
Average standard deviation of split frequencies: 0.012035
230500 -- [-1084.207] (-1082.592) (-1082.539) (-1082.042) * [-1083.492] (-1081.616) (-1083.254) (-1086.224) -- 0:00:46
231000 -- (-1083.625) [-1082.510] (-1085.056) (-1081.318) * (-1086.299) (-1082.209) (-1082.229) [-1087.681] -- 0:00:46
231500 -- (-1081.798) [-1085.514] (-1082.505) (-1082.014) * (-1082.715) (-1083.097) [-1082.750] (-1083.224) -- 0:00:46
232000 -- (-1081.592) [-1083.176] (-1081.565) (-1081.728) * (-1081.841) (-1085.541) (-1082.159) [-1082.161] -- 0:00:46
232500 -- (-1082.841) [-1084.185] (-1081.920) (-1084.313) * (-1081.280) (-1082.920) [-1082.231] (-1081.258) -- 0:00:46
233000 -- (-1084.647) [-1085.070] (-1084.294) (-1084.913) * (-1081.593) (-1090.791) [-1082.095] (-1081.388) -- 0:00:46
233500 -- (-1083.752) (-1084.285) [-1083.840] (-1084.702) * (-1086.454) (-1084.678) [-1085.482] (-1083.679) -- 0:00:45
234000 -- (-1083.542) [-1086.349] (-1081.370) (-1089.005) * (-1083.639) (-1083.975) [-1082.500] (-1086.858) -- 0:00:45
234500 -- (-1084.347) (-1087.123) [-1082.586] (-1081.820) * (-1081.873) (-1082.960) [-1082.173] (-1082.143) -- 0:00:45
235000 -- (-1081.925) [-1088.578] (-1082.249) (-1081.996) * (-1081.635) (-1081.959) (-1081.744) [-1083.222] -- 0:00:45
Average standard deviation of split frequencies: 0.012429
235500 -- (-1085.938) (-1085.664) (-1081.761) [-1082.273] * (-1081.429) (-1082.199) (-1083.240) [-1081.677] -- 0:00:45
236000 -- (-1086.325) [-1083.419] (-1087.571) (-1084.775) * (-1087.372) (-1086.759) [-1081.377] (-1082.274) -- 0:00:45
236500 -- [-1081.822] (-1083.612) (-1084.984) (-1083.506) * (-1085.593) [-1086.436] (-1082.244) (-1082.537) -- 0:00:45
237000 -- [-1081.792] (-1084.002) (-1088.202) (-1086.511) * [-1082.538] (-1083.465) (-1082.839) (-1082.959) -- 0:00:45
237500 -- [-1082.153] (-1082.853) (-1084.784) (-1084.136) * [-1081.644] (-1086.669) (-1081.599) (-1082.645) -- 0:00:44
238000 -- [-1082.610] (-1084.357) (-1083.358) (-1082.334) * (-1082.469) [-1083.093] (-1081.621) (-1081.950) -- 0:00:44
238500 -- (-1081.116) [-1085.367] (-1081.575) (-1085.402) * (-1080.831) [-1083.126] (-1081.669) (-1081.990) -- 0:00:44
239000 -- (-1081.356) [-1087.082] (-1081.385) (-1084.869) * (-1081.130) [-1081.387] (-1086.400) (-1081.493) -- 0:00:44
239500 -- [-1082.732] (-1083.507) (-1082.943) (-1084.394) * [-1081.168] (-1083.180) (-1082.933) (-1082.435) -- 0:00:44
240000 -- (-1084.463) (-1080.815) [-1082.795] (-1082.689) * (-1083.007) (-1081.575) [-1084.133] (-1083.504) -- 0:00:47
Average standard deviation of split frequencies: 0.012674
240500 -- (-1084.595) (-1081.746) [-1083.798] (-1082.896) * (-1082.381) (-1081.982) [-1087.065] (-1084.381) -- 0:00:47
241000 -- (-1084.811) (-1083.274) (-1083.804) [-1083.672] * (-1087.164) [-1084.303] (-1087.610) (-1084.999) -- 0:00:47
241500 -- (-1084.357) (-1085.482) [-1082.033] (-1083.251) * (-1081.484) (-1086.911) (-1086.697) [-1086.468] -- 0:00:47
242000 -- (-1083.600) [-1081.197] (-1083.187) (-1083.764) * [-1081.836] (-1083.297) (-1090.249) (-1086.629) -- 0:00:46
242500 -- (-1082.459) (-1082.368) [-1083.182] (-1083.783) * [-1083.653] (-1083.291) (-1084.913) (-1086.011) -- 0:00:46
243000 -- (-1083.945) [-1082.398] (-1081.793) (-1081.439) * (-1082.948) [-1085.035] (-1085.597) (-1084.610) -- 0:00:46
243500 -- (-1081.504) [-1082.252] (-1081.617) (-1083.426) * (-1084.027) (-1083.340) (-1083.144) [-1080.952] -- 0:00:46
244000 -- (-1081.802) (-1082.196) (-1082.132) [-1082.595] * [-1083.840] (-1084.007) (-1083.430) (-1081.722) -- 0:00:46
244500 -- (-1084.428) (-1091.550) (-1082.650) [-1082.232] * (-1083.824) (-1082.102) (-1082.812) [-1082.425] -- 0:00:46
245000 -- (-1082.084) (-1089.693) (-1085.933) [-1082.841] * (-1081.883) [-1082.412] (-1085.448) (-1084.055) -- 0:00:46
Average standard deviation of split frequencies: 0.011723
245500 -- (-1081.549) (-1087.523) (-1084.246) [-1082.515] * (-1081.283) [-1082.410] (-1084.712) (-1082.534) -- 0:00:46
246000 -- (-1080.987) (-1087.993) [-1084.226] (-1083.661) * [-1081.209] (-1084.894) (-1083.510) (-1081.982) -- 0:00:45
246500 -- (-1085.990) (-1083.696) [-1080.666] (-1083.402) * (-1081.136) [-1082.263] (-1082.994) (-1085.903) -- 0:00:45
247000 -- [-1082.441] (-1083.613) (-1081.372) (-1081.143) * (-1080.956) (-1081.910) (-1083.265) [-1085.204] -- 0:00:45
247500 -- (-1085.393) [-1081.747] (-1083.762) (-1081.807) * (-1082.398) (-1083.291) [-1082.690] (-1082.633) -- 0:00:45
248000 -- (-1082.883) (-1081.355) [-1083.481] (-1081.212) * [-1081.982] (-1082.729) (-1082.391) (-1082.542) -- 0:00:45
248500 -- (-1080.882) (-1080.626) [-1083.530] (-1083.200) * (-1086.762) (-1083.112) (-1081.714) [-1082.288] -- 0:00:45
249000 -- (-1080.868) (-1082.875) [-1082.917] (-1081.714) * (-1085.272) (-1082.173) (-1085.330) [-1082.298] -- 0:00:45
249500 -- (-1083.661) [-1082.924] (-1084.278) (-1081.763) * (-1081.401) [-1081.609] (-1082.498) (-1084.182) -- 0:00:45
250000 -- (-1082.479) (-1081.901) [-1081.226] (-1084.264) * (-1086.614) (-1085.372) (-1082.038) [-1086.408] -- 0:00:45
Average standard deviation of split frequencies: 0.012390
250500 -- (-1083.130) (-1084.704) [-1083.326] (-1085.763) * [-1084.954] (-1090.222) (-1081.860) (-1088.723) -- 0:00:44
251000 -- [-1084.771] (-1083.758) (-1082.523) (-1084.744) * [-1085.675] (-1085.903) (-1082.040) (-1085.048) -- 0:00:44
251500 -- (-1081.652) (-1084.333) (-1081.519) [-1086.891] * (-1083.191) (-1086.985) [-1081.505] (-1084.708) -- 0:00:44
252000 -- [-1083.381] (-1090.039) (-1081.976) (-1086.607) * (-1085.507) (-1087.069) [-1083.071] (-1087.465) -- 0:00:44
252500 -- (-1086.324) (-1085.986) [-1082.401] (-1081.952) * [-1081.810] (-1086.338) (-1083.940) (-1088.968) -- 0:00:44
253000 -- (-1086.128) (-1081.501) [-1083.848] (-1083.268) * (-1084.751) [-1081.894] (-1084.292) (-1086.102) -- 0:00:44
253500 -- [-1081.557] (-1082.602) (-1081.716) (-1084.343) * (-1081.977) [-1084.037] (-1083.680) (-1085.907) -- 0:00:44
254000 -- [-1083.373] (-1087.749) (-1082.169) (-1085.161) * [-1081.489] (-1083.203) (-1084.194) (-1088.597) -- 0:00:44
254500 -- (-1084.370) (-1083.442) [-1082.816] (-1081.768) * (-1085.530) (-1083.515) (-1083.073) [-1082.732] -- 0:00:43
255000 -- (-1082.894) [-1081.253] (-1081.341) (-1081.798) * (-1086.109) [-1082.974] (-1081.794) (-1082.752) -- 0:00:43
Average standard deviation of split frequencies: 0.012782
255500 -- (-1083.803) (-1083.299) [-1081.421] (-1083.079) * (-1084.757) (-1082.768) [-1084.121] (-1085.157) -- 0:00:43
256000 -- (-1083.677) (-1083.194) (-1082.754) [-1088.310] * (-1082.481) (-1084.342) [-1085.000] (-1084.491) -- 0:00:43
256500 -- (-1087.582) [-1081.288] (-1084.120) (-1082.896) * (-1085.586) (-1083.170) [-1085.447] (-1082.101) -- 0:00:46
257000 -- [-1083.843] (-1081.587) (-1083.041) (-1083.898) * (-1091.981) (-1085.206) (-1085.027) [-1081.853] -- 0:00:46
257500 -- (-1083.054) (-1082.247) [-1081.496] (-1086.554) * [-1084.956] (-1083.052) (-1083.972) (-1083.438) -- 0:00:46
258000 -- (-1083.271) (-1083.331) [-1082.596] (-1083.614) * [-1082.192] (-1081.748) (-1087.581) (-1083.462) -- 0:00:46
258500 -- [-1082.701] (-1084.151) (-1081.606) (-1083.104) * (-1082.722) (-1083.490) [-1084.651] (-1083.410) -- 0:00:45
259000 -- (-1082.214) (-1083.093) (-1082.806) [-1082.624] * (-1081.958) (-1083.982) (-1086.360) [-1084.904] -- 0:00:45
259500 -- [-1081.755] (-1083.163) (-1081.320) (-1084.789) * [-1082.487] (-1084.647) (-1083.882) (-1081.718) -- 0:00:45
260000 -- [-1083.415] (-1083.203) (-1083.769) (-1083.372) * (-1082.499) (-1083.252) [-1083.785] (-1082.303) -- 0:00:45
Average standard deviation of split frequencies: 0.012234
260500 -- [-1081.260] (-1082.678) (-1083.802) (-1087.551) * (-1082.696) (-1083.797) [-1084.890] (-1085.491) -- 0:00:45
261000 -- (-1081.262) (-1083.273) (-1083.720) [-1083.478] * (-1084.960) (-1083.830) (-1084.731) [-1083.904] -- 0:00:45
261500 -- (-1081.517) (-1087.615) (-1088.242) [-1081.801] * (-1084.175) (-1084.694) (-1083.055) [-1081.436] -- 0:00:45
262000 -- (-1082.141) (-1082.260) (-1081.587) [-1081.390] * (-1083.228) (-1083.268) [-1081.797] (-1081.980) -- 0:00:45
262500 -- [-1081.934] (-1081.572) (-1081.613) (-1081.371) * (-1082.438) [-1087.259] (-1082.773) (-1085.593) -- 0:00:44
263000 -- [-1081.938] (-1081.575) (-1083.473) (-1081.456) * (-1083.966) [-1084.256] (-1084.811) (-1084.261) -- 0:00:44
263500 -- (-1085.754) [-1081.891] (-1082.141) (-1081.429) * [-1081.478] (-1084.502) (-1081.542) (-1084.512) -- 0:00:44
264000 -- (-1083.692) [-1086.898] (-1081.661) (-1084.259) * (-1081.463) (-1083.824) (-1081.835) [-1082.303] -- 0:00:44
264500 -- (-1088.648) [-1082.151] (-1083.707) (-1082.819) * [-1081.111] (-1083.927) (-1082.765) (-1083.641) -- 0:00:44
265000 -- (-1086.674) [-1081.731] (-1085.130) (-1083.475) * (-1081.585) (-1084.160) (-1083.849) [-1082.478] -- 0:00:44
Average standard deviation of split frequencies: 0.012822
265500 -- (-1081.963) [-1086.714] (-1083.162) (-1084.010) * (-1081.918) (-1083.202) (-1085.580) [-1081.702] -- 0:00:44
266000 -- (-1081.374) (-1082.561) [-1081.539] (-1083.923) * (-1084.625) (-1087.472) [-1083.860] (-1081.700) -- 0:00:44
266500 -- (-1081.502) (-1081.220) (-1083.551) [-1082.550] * (-1081.281) [-1089.194] (-1083.859) (-1081.667) -- 0:00:44
267000 -- (-1081.505) (-1083.284) (-1085.791) [-1083.380] * [-1083.504] (-1083.872) (-1081.317) (-1082.147) -- 0:00:43
267500 -- (-1083.206) [-1081.234] (-1082.972) (-1081.628) * [-1084.718] (-1083.780) (-1081.600) (-1082.585) -- 0:00:43
268000 -- (-1082.757) (-1081.752) (-1082.563) [-1082.785] * (-1085.302) (-1083.733) [-1081.238] (-1082.056) -- 0:00:43
268500 -- (-1083.110) (-1081.009) (-1083.630) [-1083.676] * [-1082.030] (-1083.141) (-1083.015) (-1083.267) -- 0:00:43
269000 -- (-1082.524) (-1081.157) [-1083.145] (-1083.065) * (-1082.195) (-1083.141) (-1083.842) [-1083.481] -- 0:00:43
269500 -- [-1082.867] (-1083.293) (-1085.219) (-1085.602) * [-1082.223] (-1082.569) (-1086.433) (-1084.703) -- 0:00:43
270000 -- (-1083.388) (-1083.493) (-1088.856) [-1081.507] * [-1082.080] (-1087.584) (-1084.222) (-1081.509) -- 0:00:43
Average standard deviation of split frequencies: 0.013836
270500 -- (-1082.432) [-1081.618] (-1081.970) (-1083.495) * (-1082.173) [-1086.169] (-1084.704) (-1081.444) -- 0:00:43
271000 -- (-1081.214) (-1082.506) [-1084.412] (-1082.888) * (-1081.423) [-1082.347] (-1082.612) (-1083.058) -- 0:00:43
271500 -- (-1082.706) [-1081.630] (-1086.387) (-1082.069) * (-1084.529) (-1084.074) [-1083.247] (-1082.162) -- 0:00:42
272000 -- [-1082.164] (-1082.558) (-1087.396) (-1082.257) * (-1083.654) (-1082.498) (-1086.893) [-1081.443] -- 0:00:42
272500 -- [-1087.297] (-1082.070) (-1084.904) (-1082.111) * (-1082.746) (-1082.654) [-1081.203] (-1081.503) -- 0:00:45
273000 -- (-1083.697) (-1082.402) (-1083.942) [-1083.553] * (-1081.802) (-1083.672) [-1081.414] (-1081.838) -- 0:00:45
273500 -- (-1083.939) (-1081.321) [-1082.608] (-1084.695) * (-1081.372) [-1086.138] (-1081.428) (-1081.487) -- 0:00:45
274000 -- (-1085.669) (-1082.819) [-1082.608] (-1083.577) * (-1081.550) (-1083.080) (-1081.285) [-1081.817] -- 0:00:45
274500 -- (-1083.973) [-1081.767] (-1086.563) (-1082.611) * (-1082.090) (-1082.855) [-1081.505] (-1083.389) -- 0:00:44
275000 -- (-1083.469) (-1083.205) (-1084.894) [-1082.075] * [-1083.670] (-1086.946) (-1084.853) (-1084.504) -- 0:00:44
Average standard deviation of split frequencies: 0.013563
275500 -- [-1081.079] (-1081.707) (-1088.553) (-1081.146) * (-1089.301) (-1085.038) (-1084.180) [-1084.160] -- 0:00:44
276000 -- (-1082.677) [-1082.635] (-1084.458) (-1083.353) * (-1083.244) [-1083.188] (-1082.215) (-1083.568) -- 0:00:44
276500 -- (-1081.664) [-1083.458] (-1081.672) (-1081.985) * (-1083.614) (-1085.396) (-1083.333) [-1081.602] -- 0:00:44
277000 -- (-1081.376) (-1085.143) [-1081.419] (-1082.878) * (-1084.762) (-1083.153) (-1083.722) [-1085.331] -- 0:00:44
277500 -- (-1081.712) [-1082.729] (-1082.877) (-1084.241) * (-1085.278) (-1085.079) [-1083.647] (-1083.194) -- 0:00:44
278000 -- [-1081.733] (-1086.461) (-1082.533) (-1082.779) * [-1082.691] (-1085.613) (-1083.042) (-1085.854) -- 0:00:44
278500 -- (-1086.796) (-1081.032) (-1083.125) [-1082.242] * [-1083.052] (-1082.030) (-1083.072) (-1083.672) -- 0:00:44
279000 -- [-1085.149] (-1081.111) (-1084.268) (-1081.578) * (-1082.573) (-1083.768) [-1081.861] (-1084.100) -- 0:00:43
279500 -- (-1081.693) (-1084.098) (-1083.312) [-1082.033] * (-1082.394) [-1084.901] (-1082.351) (-1083.297) -- 0:00:43
280000 -- (-1085.083) (-1082.987) (-1086.084) [-1083.230] * (-1083.909) [-1085.801] (-1081.879) (-1082.713) -- 0:00:43
Average standard deviation of split frequencies: 0.012943
280500 -- (-1082.635) (-1083.921) [-1086.077] (-1082.723) * (-1084.353) [-1081.378] (-1083.452) (-1086.228) -- 0:00:43
281000 -- [-1085.142] (-1083.474) (-1086.452) (-1081.298) * (-1086.395) (-1082.848) [-1085.576] (-1086.185) -- 0:00:43
281500 -- [-1084.185] (-1084.304) (-1083.499) (-1082.419) * [-1084.755] (-1081.910) (-1084.811) (-1086.346) -- 0:00:43
282000 -- (-1084.388) (-1083.719) (-1083.871) [-1082.355] * (-1083.655) [-1082.125] (-1083.677) (-1082.758) -- 0:00:43
282500 -- [-1083.295] (-1082.015) (-1083.706) (-1081.792) * (-1084.678) (-1083.918) [-1083.616] (-1086.475) -- 0:00:43
283000 -- (-1083.576) (-1084.403) (-1084.004) [-1083.304] * [-1085.234] (-1082.890) (-1082.817) (-1084.801) -- 0:00:43
283500 -- [-1082.820] (-1083.944) (-1081.737) (-1086.287) * (-1085.051) (-1083.612) (-1083.042) [-1083.121] -- 0:00:42
284000 -- [-1081.340] (-1082.161) (-1081.350) (-1083.709) * [-1082.422] (-1082.899) (-1083.795) (-1083.535) -- 0:00:42
284500 -- [-1081.676] (-1081.972) (-1083.079) (-1083.558) * (-1081.865) (-1083.576) (-1083.033) [-1083.515] -- 0:00:42
285000 -- (-1086.079) [-1085.450] (-1083.857) (-1086.771) * (-1080.980) (-1086.706) (-1085.021) [-1080.764] -- 0:00:42
Average standard deviation of split frequencies: 0.012701
285500 -- (-1083.327) [-1083.096] (-1081.508) (-1085.265) * [-1082.102] (-1084.053) (-1082.955) (-1080.764) -- 0:00:42
286000 -- (-1082.216) [-1083.274] (-1083.056) (-1081.392) * [-1083.431] (-1081.059) (-1086.871) (-1084.514) -- 0:00:42
286500 -- (-1087.225) [-1083.908] (-1082.140) (-1080.621) * (-1083.028) [-1082.319] (-1085.414) (-1083.991) -- 0:00:42
287000 -- [-1082.996] (-1085.964) (-1082.918) (-1080.618) * (-1084.172) (-1081.260) (-1083.350) [-1083.712] -- 0:00:42
287500 -- (-1083.043) (-1087.444) [-1083.251] (-1083.398) * (-1085.106) (-1082.979) [-1084.362] (-1081.551) -- 0:00:42
288000 -- [-1082.662] (-1082.583) (-1083.319) (-1083.994) * [-1083.135] (-1080.825) (-1081.386) (-1084.696) -- 0:00:42
288500 -- (-1082.448) (-1081.585) (-1083.086) [-1083.555] * (-1085.131) [-1081.901] (-1083.270) (-1081.742) -- 0:00:41
289000 -- (-1082.483) (-1083.100) (-1082.336) [-1083.660] * (-1085.406) (-1081.867) (-1086.053) [-1081.990] -- 0:00:44
289500 -- (-1081.144) (-1087.269) (-1082.425) [-1082.977] * [-1082.232] (-1083.621) (-1083.925) (-1081.247) -- 0:00:44
290000 -- (-1084.109) (-1086.445) [-1081.151] (-1082.498) * [-1083.261] (-1083.083) (-1084.000) (-1082.571) -- 0:00:44
Average standard deviation of split frequencies: 0.013833
290500 -- (-1083.635) (-1084.213) (-1081.884) [-1082.534] * (-1083.294) (-1083.342) (-1082.293) [-1081.537] -- 0:00:43
291000 -- (-1081.422) (-1083.420) [-1081.570] (-1082.394) * (-1083.042) [-1082.488] (-1081.466) (-1081.438) -- 0:00:43
291500 -- (-1084.254) (-1084.082) [-1081.020] (-1082.282) * (-1089.327) [-1082.445] (-1081.351) (-1083.240) -- 0:00:43
292000 -- (-1083.284) (-1084.114) (-1081.326) [-1081.477] * (-1084.258) [-1081.744] (-1082.567) (-1083.600) -- 0:00:43
292500 -- (-1083.257) [-1081.453] (-1081.939) (-1083.050) * [-1084.776] (-1085.573) (-1085.883) (-1081.430) -- 0:00:43
293000 -- (-1081.930) (-1081.863) [-1081.425] (-1082.445) * [-1083.441] (-1084.324) (-1081.677) (-1082.413) -- 0:00:43
293500 -- [-1082.433] (-1083.548) (-1083.737) (-1081.295) * (-1084.521) [-1082.582] (-1082.705) (-1082.714) -- 0:00:43
294000 -- (-1082.185) [-1082.851] (-1085.445) (-1081.967) * (-1084.557) [-1083.715] (-1082.652) (-1081.655) -- 0:00:43
294500 -- (-1081.412) (-1081.584) (-1086.205) [-1082.272] * (-1084.679) [-1082.880] (-1081.877) (-1081.738) -- 0:00:43
295000 -- (-1082.930) (-1082.504) (-1087.084) [-1082.310] * [-1083.676] (-1090.889) (-1086.724) (-1081.211) -- 0:00:43
Average standard deviation of split frequencies: 0.013677
295500 -- (-1087.869) (-1088.317) (-1081.529) [-1081.074] * [-1082.587] (-1090.169) (-1087.691) (-1082.067) -- 0:00:42
296000 -- (-1088.076) (-1083.820) [-1085.367] (-1081.112) * (-1083.953) (-1083.503) [-1087.037] (-1083.894) -- 0:00:42
296500 -- [-1085.157] (-1083.612) (-1082.057) (-1082.240) * [-1082.533] (-1083.511) (-1088.473) (-1080.937) -- 0:00:42
297000 -- (-1082.989) (-1085.559) (-1082.955) [-1084.965] * (-1082.284) (-1083.720) (-1084.626) [-1083.516] -- 0:00:42
297500 -- (-1084.239) (-1084.566) (-1083.087) [-1081.672] * (-1081.693) (-1083.926) [-1085.030] (-1082.969) -- 0:00:42
298000 -- [-1084.441] (-1083.006) (-1085.041) (-1084.865) * (-1083.001) (-1081.985) [-1081.854] (-1081.860) -- 0:00:42
298500 -- (-1083.864) (-1085.560) (-1086.550) [-1081.823] * (-1080.687) [-1081.201] (-1082.628) (-1081.858) -- 0:00:42
299000 -- [-1081.137] (-1082.911) (-1087.335) (-1081.997) * (-1081.477) (-1082.169) (-1082.621) [-1083.908] -- 0:00:42
299500 -- (-1083.730) [-1080.950] (-1081.403) (-1083.693) * [-1081.423] (-1087.045) (-1087.116) (-1081.407) -- 0:00:42
300000 -- (-1084.679) (-1082.284) [-1083.326] (-1083.041) * (-1081.635) (-1080.699) [-1085.578] (-1084.442) -- 0:00:42
Average standard deviation of split frequencies: 0.015483
300500 -- [-1083.749] (-1082.595) (-1081.186) (-1086.236) * (-1080.842) (-1081.880) (-1084.051) [-1084.816] -- 0:00:41
301000 -- (-1081.777) [-1083.115] (-1081.743) (-1086.181) * (-1082.641) (-1081.914) [-1081.904] (-1088.413) -- 0:00:41
301500 -- (-1082.798) [-1081.731] (-1081.507) (-1083.216) * [-1083.733] (-1080.872) (-1081.908) (-1086.055) -- 0:00:41
302000 -- (-1083.199) (-1083.205) (-1085.581) [-1083.272] * (-1082.373) (-1081.759) [-1081.515] (-1082.872) -- 0:00:41
302500 -- (-1081.839) (-1081.902) [-1085.630] (-1083.022) * (-1081.122) (-1081.913) (-1081.517) [-1084.066] -- 0:00:41
303000 -- [-1082.672] (-1081.298) (-1081.011) (-1085.380) * (-1083.660) (-1084.872) (-1082.016) [-1084.745] -- 0:00:41
303500 -- (-1082.854) (-1081.326) (-1083.238) [-1082.608] * (-1082.947) (-1080.833) (-1083.918) [-1083.644] -- 0:00:41
304000 -- (-1081.676) (-1082.502) [-1081.625] (-1080.938) * (-1081.402) [-1083.669] (-1082.551) (-1085.351) -- 0:00:41
304500 -- [-1082.023] (-1082.342) (-1081.494) (-1081.588) * [-1084.823] (-1083.847) (-1083.874) (-1084.259) -- 0:00:41
305000 -- (-1083.468) (-1082.277) (-1081.806) [-1081.296] * (-1083.789) (-1084.796) (-1081.941) [-1083.217] -- 0:00:41
Average standard deviation of split frequencies: 0.015043
305500 -- (-1087.194) (-1082.078) [-1081.723] (-1081.092) * [-1083.865] (-1084.697) (-1086.215) (-1082.489) -- 0:00:43
306000 -- (-1086.157) (-1081.139) [-1084.793] (-1081.365) * [-1085.272] (-1084.883) (-1082.234) (-1087.557) -- 0:00:43
306500 -- (-1083.323) (-1085.862) (-1082.089) [-1081.059] * (-1082.649) [-1084.527] (-1081.331) (-1085.027) -- 0:00:42
307000 -- (-1082.665) (-1082.833) [-1081.659] (-1082.216) * (-1084.350) (-1083.606) [-1081.840] (-1082.399) -- 0:00:42
307500 -- (-1086.767) (-1082.525) [-1082.689] (-1082.944) * (-1081.593) [-1086.182] (-1083.511) (-1082.547) -- 0:00:42
308000 -- (-1081.832) (-1082.997) (-1085.182) [-1082.696] * (-1082.907) [-1082.318] (-1085.192) (-1086.179) -- 0:00:42
308500 -- (-1081.386) (-1082.386) (-1083.485) [-1085.449] * [-1082.031] (-1084.964) (-1086.511) (-1081.484) -- 0:00:42
309000 -- (-1081.748) (-1082.403) (-1083.191) [-1084.287] * [-1081.202] (-1084.644) (-1084.600) (-1084.244) -- 0:00:42
309500 -- [-1082.070] (-1083.260) (-1082.341) (-1083.753) * (-1081.078) (-1084.317) (-1082.969) [-1083.840] -- 0:00:42
310000 -- [-1083.591] (-1085.227) (-1085.016) (-1082.719) * (-1083.749) [-1088.704] (-1083.751) (-1083.938) -- 0:00:42
Average standard deviation of split frequencies: 0.015079
310500 -- (-1083.865) [-1081.783] (-1081.891) (-1086.141) * (-1082.405) [-1082.833] (-1081.817) (-1081.933) -- 0:00:42
311000 -- (-1082.936) (-1083.572) [-1084.049] (-1083.027) * [-1082.555] (-1083.556) (-1081.692) (-1081.961) -- 0:00:42
311500 -- [-1085.143] (-1083.847) (-1083.496) (-1083.301) * (-1083.609) [-1081.878] (-1083.266) (-1085.306) -- 0:00:41
312000 -- (-1086.430) (-1084.370) (-1082.036) [-1083.544] * (-1084.336) [-1081.790] (-1081.849) (-1082.906) -- 0:00:41
312500 -- (-1081.035) [-1083.977] (-1081.690) (-1083.226) * (-1086.363) [-1083.218] (-1084.052) (-1081.921) -- 0:00:41
313000 -- (-1080.889) (-1082.813) [-1081.834] (-1081.834) * (-1082.393) (-1082.816) (-1084.636) [-1081.367] -- 0:00:41
313500 -- (-1083.754) (-1085.587) (-1083.686) [-1082.353] * (-1083.888) (-1082.949) (-1084.777) [-1084.914] -- 0:00:41
314000 -- (-1085.405) (-1083.746) [-1090.018] (-1084.901) * (-1083.680) [-1083.892] (-1083.407) (-1082.355) -- 0:00:41
314500 -- (-1082.721) (-1082.439) [-1084.529] (-1086.681) * (-1081.112) (-1083.216) (-1082.857) [-1083.943] -- 0:00:41
315000 -- [-1083.880] (-1083.707) (-1090.286) (-1082.088) * (-1081.530) (-1083.956) (-1081.782) [-1083.231] -- 0:00:41
Average standard deviation of split frequencies: 0.014825
315500 -- [-1082.022] (-1081.972) (-1087.719) (-1081.851) * [-1082.222] (-1082.789) (-1082.474) (-1084.845) -- 0:00:41
316000 -- [-1082.983] (-1081.707) (-1086.860) (-1082.548) * (-1081.391) [-1082.181] (-1082.322) (-1085.679) -- 0:00:41
316500 -- [-1081.963] (-1081.939) (-1081.647) (-1082.609) * [-1085.288] (-1082.846) (-1084.666) (-1084.536) -- 0:00:41
317000 -- [-1083.546] (-1081.183) (-1090.429) (-1082.399) * (-1083.516) (-1084.081) [-1085.148] (-1081.135) -- 0:00:40
317500 -- (-1081.651) (-1082.146) (-1082.789) [-1083.191] * [-1083.119] (-1086.573) (-1085.275) (-1081.482) -- 0:00:40
318000 -- (-1082.653) (-1083.739) [-1081.973] (-1084.037) * [-1083.002] (-1089.861) (-1081.714) (-1083.133) -- 0:00:40
318500 -- (-1087.114) (-1084.391) [-1081.428] (-1082.237) * (-1086.289) (-1082.274) [-1085.028] (-1082.694) -- 0:00:40
319000 -- (-1082.903) [-1087.462] (-1081.441) (-1083.142) * (-1083.191) [-1084.310] (-1083.499) (-1083.642) -- 0:00:40
319500 -- (-1091.163) (-1083.107) [-1083.376] (-1084.022) * (-1081.795) [-1081.447] (-1084.552) (-1081.585) -- 0:00:40
320000 -- (-1082.061) (-1082.304) [-1089.084] (-1084.569) * (-1082.509) (-1085.366) [-1083.250] (-1083.948) -- 0:00:40
Average standard deviation of split frequencies: 0.014517
320500 -- (-1084.777) (-1081.400) [-1082.436] (-1083.126) * (-1081.245) (-1081.346) [-1082.867] (-1083.663) -- 0:00:40
321000 -- (-1083.978) [-1080.863] (-1083.821) (-1082.691) * [-1081.861] (-1081.982) (-1082.405) (-1082.502) -- 0:00:40
321500 -- (-1090.200) (-1082.516) (-1082.022) [-1081.060] * (-1081.722) (-1082.200) [-1082.764] (-1082.329) -- 0:00:40
322000 -- (-1089.254) (-1081.493) [-1082.200] (-1082.470) * (-1081.741) (-1081.668) (-1085.566) [-1082.846] -- 0:00:42
322500 -- [-1082.621] (-1080.984) (-1081.097) (-1082.670) * [-1081.703] (-1081.674) (-1082.610) (-1082.474) -- 0:00:42
323000 -- (-1081.881) [-1082.456] (-1082.356) (-1082.463) * [-1082.663] (-1085.580) (-1084.225) (-1081.852) -- 0:00:41
323500 -- (-1082.375) [-1083.703] (-1084.947) (-1084.438) * [-1083.736] (-1083.210) (-1082.472) (-1085.139) -- 0:00:41
324000 -- (-1081.927) (-1084.615) (-1083.434) [-1084.750] * (-1083.365) (-1082.744) (-1082.289) [-1081.374] -- 0:00:41
324500 -- (-1083.753) (-1083.516) (-1082.883) [-1082.210] * (-1083.164) (-1081.788) (-1081.820) [-1085.058] -- 0:00:41
325000 -- (-1082.194) (-1084.975) (-1083.201) [-1082.189] * (-1086.104) (-1081.938) [-1084.586] (-1082.566) -- 0:00:41
Average standard deviation of split frequencies: 0.014375
325500 -- (-1085.524) (-1086.018) [-1084.582] (-1081.293) * [-1084.938] (-1084.954) (-1081.806) (-1082.114) -- 0:00:41
326000 -- (-1081.376) (-1082.620) [-1081.124] (-1082.533) * (-1085.334) (-1084.743) (-1082.914) [-1081.994] -- 0:00:41
326500 -- (-1088.661) (-1080.938) [-1081.746] (-1085.708) * (-1083.202) (-1086.674) [-1081.966] (-1081.994) -- 0:00:41
327000 -- [-1085.489] (-1081.363) (-1085.303) (-1082.539) * [-1086.564] (-1083.692) (-1080.686) (-1082.954) -- 0:00:41
327500 -- (-1082.199) [-1083.244] (-1088.212) (-1082.730) * (-1083.485) [-1088.458] (-1081.397) (-1081.699) -- 0:00:41
328000 -- (-1082.188) [-1084.046] (-1084.686) (-1084.568) * [-1083.332] (-1082.116) (-1086.804) (-1086.514) -- 0:00:40
328500 -- (-1084.202) (-1084.991) (-1082.749) [-1083.581] * (-1083.172) [-1081.670] (-1082.517) (-1091.133) -- 0:00:40
329000 -- (-1085.282) (-1086.657) [-1083.745] (-1084.107) * [-1083.411] (-1081.684) (-1083.068) (-1090.078) -- 0:00:40
329500 -- (-1085.083) [-1084.770] (-1081.436) (-1083.648) * (-1083.534) (-1088.148) [-1082.941] (-1087.287) -- 0:00:40
330000 -- (-1084.355) [-1085.358] (-1082.877) (-1081.267) * (-1083.206) (-1086.346) [-1082.678] (-1084.930) -- 0:00:40
Average standard deviation of split frequencies: 0.014843
330500 -- (-1082.648) (-1084.784) (-1082.713) [-1081.506] * (-1082.412) [-1087.050] (-1083.542) (-1086.138) -- 0:00:40
331000 -- (-1087.337) (-1082.501) [-1081.506] (-1082.004) * [-1081.582] (-1081.985) (-1084.557) (-1084.017) -- 0:00:40
331500 -- (-1085.730) (-1082.836) [-1081.321] (-1089.012) * [-1082.253] (-1083.569) (-1083.111) (-1083.313) -- 0:00:40
332000 -- (-1083.280) (-1084.947) [-1081.295] (-1082.314) * (-1082.249) [-1081.365] (-1085.753) (-1083.260) -- 0:00:40
332500 -- (-1083.347) (-1084.619) (-1081.703) [-1086.308] * (-1082.218) (-1083.433) [-1082.993] (-1085.621) -- 0:00:40
333000 -- (-1084.891) [-1087.690] (-1082.961) (-1091.016) * (-1083.388) [-1081.165] (-1081.094) (-1082.856) -- 0:00:40
333500 -- (-1084.394) (-1084.860) (-1082.525) [-1084.017] * (-1085.660) (-1084.130) [-1080.992] (-1082.967) -- 0:00:39
334000 -- [-1083.107] (-1081.333) (-1082.857) (-1084.854) * (-1085.434) (-1082.177) (-1081.253) [-1083.677] -- 0:00:39
334500 -- (-1081.405) (-1084.435) (-1082.773) [-1083.873] * (-1084.675) (-1081.995) (-1081.557) [-1083.423] -- 0:00:39
335000 -- [-1081.350] (-1083.196) (-1085.657) (-1081.765) * (-1082.703) [-1081.793] (-1083.570) (-1083.013) -- 0:00:39
Average standard deviation of split frequencies: 0.014907
335500 -- [-1081.290] (-1084.819) (-1085.022) (-1082.312) * (-1085.681) (-1081.915) [-1084.761] (-1082.490) -- 0:00:39
336000 -- (-1083.217) (-1081.133) (-1080.870) [-1089.278] * (-1084.279) (-1082.118) (-1083.806) [-1080.907] -- 0:00:39
336500 -- (-1088.725) (-1083.716) (-1082.016) [-1082.748] * (-1086.642) (-1082.431) [-1082.017] (-1081.050) -- 0:00:39
337000 -- (-1082.471) (-1085.070) [-1081.630] (-1082.570) * (-1085.279) (-1081.061) [-1083.969] (-1081.214) -- 0:00:39
337500 -- (-1082.542) (-1082.456) [-1081.746] (-1081.624) * (-1083.516) (-1086.643) [-1082.042] (-1081.648) -- 0:00:39
338000 -- (-1082.439) (-1088.330) (-1082.479) [-1081.279] * (-1081.894) (-1083.663) (-1084.230) [-1082.265] -- 0:00:41
338500 -- [-1083.350] (-1082.046) (-1080.909) (-1085.527) * (-1083.927) (-1082.962) (-1084.332) [-1082.712] -- 0:00:41
339000 -- (-1085.113) [-1087.214] (-1081.429) (-1083.983) * (-1083.164) (-1082.985) (-1081.740) [-1083.724] -- 0:00:40
339500 -- (-1081.655) [-1082.428] (-1085.890) (-1084.985) * (-1083.525) (-1082.864) (-1081.933) [-1083.538] -- 0:00:40
340000 -- [-1081.642] (-1087.015) (-1084.024) (-1081.884) * (-1081.382) (-1082.720) (-1080.905) [-1081.653] -- 0:00:40
Average standard deviation of split frequencies: 0.014789
340500 -- (-1081.991) [-1081.732] (-1083.942) (-1083.632) * (-1082.964) (-1086.391) [-1084.749] (-1083.560) -- 0:00:40
341000 -- (-1082.855) [-1081.903] (-1083.820) (-1084.723) * (-1082.839) [-1086.050] (-1082.151) (-1084.688) -- 0:00:40
341500 -- [-1082.021] (-1082.320) (-1082.008) (-1084.911) * [-1081.728] (-1083.098) (-1083.988) (-1082.033) -- 0:00:40
342000 -- [-1084.693] (-1081.705) (-1082.873) (-1086.997) * (-1082.441) [-1080.955] (-1082.353) (-1085.714) -- 0:00:40
342500 -- (-1084.661) (-1081.845) [-1082.801] (-1084.509) * (-1081.390) (-1080.804) (-1083.465) [-1085.286] -- 0:00:40
343000 -- (-1084.553) (-1082.299) [-1086.964] (-1085.239) * (-1080.741) (-1082.524) (-1082.009) [-1082.514] -- 0:00:40
343500 -- (-1085.417) (-1083.557) (-1083.770) [-1082.938] * (-1080.741) [-1082.336] (-1083.483) (-1083.291) -- 0:00:40
344000 -- (-1084.365) (-1087.332) (-1082.612) [-1083.623] * [-1081.714] (-1083.687) (-1085.869) (-1083.941) -- 0:00:40
344500 -- [-1083.713] (-1087.229) (-1083.461) (-1082.065) * (-1081.348) (-1087.426) (-1085.830) [-1083.579] -- 0:00:39
345000 -- (-1087.635) (-1083.960) (-1083.394) [-1084.987] * (-1081.992) (-1082.671) (-1088.779) [-1083.780] -- 0:00:39
Average standard deviation of split frequencies: 0.014391
345500 -- [-1083.039] (-1082.660) (-1083.127) (-1089.102) * (-1081.847) [-1083.211] (-1085.105) (-1081.026) -- 0:00:39
346000 -- (-1083.697) (-1085.357) (-1082.409) [-1084.955] * (-1082.533) (-1086.784) (-1086.725) [-1081.588] -- 0:00:39
346500 -- (-1082.647) (-1085.653) [-1083.045] (-1084.220) * (-1086.013) (-1084.126) [-1081.417] (-1083.418) -- 0:00:39
347000 -- (-1083.855) (-1091.077) (-1082.624) [-1083.084] * (-1082.187) (-1082.904) [-1082.085] (-1082.859) -- 0:00:39
347500 -- (-1083.019) (-1085.244) (-1081.534) [-1082.364] * (-1082.274) (-1082.456) [-1082.438] (-1084.190) -- 0:00:39
348000 -- (-1082.534) (-1085.913) [-1081.381] (-1082.914) * (-1084.277) (-1082.487) (-1081.597) [-1083.959] -- 0:00:39
348500 -- (-1085.731) (-1084.788) [-1081.539] (-1081.794) * (-1085.297) (-1081.893) (-1083.571) [-1081.987] -- 0:00:39
349000 -- [-1089.242] (-1084.385) (-1084.907) (-1083.902) * (-1082.644) (-1082.588) (-1082.846) [-1084.034] -- 0:00:39
349500 -- [-1082.866] (-1090.652) (-1087.041) (-1084.315) * [-1081.568] (-1081.633) (-1084.783) (-1083.125) -- 0:00:39
350000 -- (-1083.389) (-1082.734) [-1083.463] (-1083.484) * [-1081.533] (-1082.672) (-1082.718) (-1082.836) -- 0:00:39
Average standard deviation of split frequencies: 0.013611
350500 -- (-1082.455) [-1082.141] (-1082.708) (-1083.705) * (-1081.258) [-1083.405] (-1086.210) (-1083.353) -- 0:00:38
351000 -- (-1081.965) [-1081.678] (-1081.746) (-1085.568) * (-1083.565) (-1084.054) [-1084.952] (-1082.739) -- 0:00:38
351500 -- (-1083.611) (-1081.456) (-1081.889) [-1088.501] * [-1082.751] (-1084.594) (-1081.839) (-1086.678) -- 0:00:38
352000 -- (-1085.865) (-1081.937) (-1081.872) [-1087.595] * (-1080.864) (-1086.978) [-1086.053] (-1086.267) -- 0:00:38
352500 -- (-1084.336) (-1083.697) [-1081.502] (-1088.520) * [-1081.944] (-1088.765) (-1086.615) (-1083.064) -- 0:00:38
353000 -- (-1084.160) [-1083.810] (-1084.470) (-1087.615) * (-1082.654) [-1088.602] (-1083.478) (-1082.901) -- 0:00:38
353500 -- [-1081.942] (-1083.647) (-1082.769) (-1085.921) * (-1082.086) (-1084.011) [-1086.558] (-1082.388) -- 0:00:38
354000 -- (-1082.016) (-1086.329) [-1087.156] (-1082.646) * (-1083.538) (-1082.477) (-1081.430) [-1082.855] -- 0:00:38
354500 -- [-1084.999] (-1084.182) (-1082.874) (-1083.479) * (-1083.019) (-1083.112) [-1081.957] (-1081.963) -- 0:00:40
355000 -- (-1083.199) [-1082.926] (-1083.443) (-1084.925) * (-1083.517) (-1082.882) [-1082.131] (-1081.262) -- 0:00:39
Average standard deviation of split frequencies: 0.014318
355500 -- (-1082.297) (-1082.845) [-1082.151] (-1087.395) * (-1082.028) (-1082.925) (-1083.344) [-1085.363] -- 0:00:39
356000 -- [-1082.778] (-1082.260) (-1082.149) (-1085.941) * (-1084.939) [-1082.428] (-1082.371) (-1086.412) -- 0:00:39
356500 -- (-1084.627) (-1081.632) (-1084.757) [-1083.044] * (-1087.294) [-1084.239] (-1084.075) (-1083.408) -- 0:00:39
357000 -- (-1085.296) (-1084.999) [-1082.439] (-1088.533) * (-1087.385) (-1084.378) (-1083.041) [-1082.770] -- 0:00:39
357500 -- (-1082.108) (-1083.183) (-1082.852) [-1083.942] * (-1085.085) [-1084.595] (-1082.045) (-1082.041) -- 0:00:39
358000 -- (-1083.957) (-1083.586) (-1093.848) [-1083.555] * (-1083.496) [-1084.835] (-1082.757) (-1081.579) -- 0:00:39
358500 -- (-1085.257) [-1081.216] (-1085.639) (-1082.460) * (-1083.409) [-1084.527] (-1081.302) (-1083.165) -- 0:00:39
359000 -- (-1084.508) (-1082.623) [-1085.205] (-1083.910) * (-1081.385) (-1084.395) (-1082.444) [-1083.654] -- 0:00:39
359500 -- (-1083.557) [-1082.418] (-1082.256) (-1084.422) * (-1081.321) (-1083.195) [-1083.215] (-1082.806) -- 0:00:39
360000 -- (-1082.016) [-1081.906] (-1083.432) (-1084.593) * (-1083.558) (-1085.132) [-1088.646] (-1088.086) -- 0:00:39
Average standard deviation of split frequencies: 0.015113
360500 -- (-1082.020) (-1083.067) [-1083.774] (-1084.276) * (-1085.474) (-1086.649) (-1084.301) [-1089.201] -- 0:00:39
361000 -- (-1082.084) (-1084.479) [-1081.834] (-1084.276) * [-1083.845] (-1082.574) (-1082.700) (-1082.352) -- 0:00:38
361500 -- (-1082.171) [-1083.107] (-1082.370) (-1084.385) * [-1084.266] (-1084.415) (-1082.640) (-1082.987) -- 0:00:38
362000 -- (-1084.615) (-1083.668) (-1082.035) [-1086.526] * (-1085.682) [-1082.131] (-1085.346) (-1082.991) -- 0:00:38
362500 -- [-1086.575] (-1081.515) (-1082.143) (-1081.478) * (-1081.186) (-1082.949) (-1081.328) [-1085.680] -- 0:00:38
363000 -- [-1082.556] (-1081.600) (-1083.313) (-1081.213) * [-1083.425] (-1082.700) (-1083.257) (-1087.980) -- 0:00:38
363500 -- [-1084.292] (-1081.731) (-1083.332) (-1081.882) * (-1081.548) (-1081.740) (-1086.244) [-1083.784] -- 0:00:38
364000 -- (-1086.776) (-1081.934) [-1082.371] (-1082.094) * (-1082.787) (-1084.693) (-1084.179) [-1083.406] -- 0:00:38
364500 -- (-1083.230) (-1083.100) (-1080.768) [-1085.128] * (-1082.965) (-1081.455) (-1085.312) [-1080.981] -- 0:00:38
365000 -- (-1083.270) (-1083.946) [-1082.960] (-1081.841) * (-1082.312) (-1086.335) (-1082.560) [-1082.742] -- 0:00:38
Average standard deviation of split frequencies: 0.014698
365500 -- [-1083.169] (-1084.141) (-1081.322) (-1082.637) * [-1081.009] (-1086.082) (-1083.537) (-1083.031) -- 0:00:38
366000 -- (-1083.931) (-1084.612) [-1085.374] (-1082.602) * [-1082.143] (-1085.218) (-1082.017) (-1082.816) -- 0:00:38
366500 -- (-1085.867) (-1084.922) [-1082.710] (-1085.690) * (-1081.375) (-1086.338) [-1081.970] (-1082.415) -- 0:00:38
367000 -- (-1084.837) (-1082.011) (-1083.180) [-1086.910] * (-1081.282) [-1082.215] (-1082.363) (-1088.416) -- 0:00:37
367500 -- [-1084.017] (-1085.971) (-1085.109) (-1081.716) * [-1081.255] (-1081.956) (-1086.558) (-1082.060) -- 0:00:37
368000 -- (-1082.909) (-1083.218) (-1081.521) [-1081.753] * (-1083.898) (-1084.826) [-1083.599] (-1081.880) -- 0:00:37
368500 -- (-1083.073) [-1081.675] (-1083.608) (-1081.551) * (-1082.183) [-1083.897] (-1082.837) (-1082.161) -- 0:00:37
369000 -- (-1082.776) [-1082.298] (-1084.341) (-1081.616) * (-1084.505) (-1081.510) [-1082.036] (-1085.642) -- 0:00:37
369500 -- (-1082.602) (-1083.328) (-1083.802) [-1084.654] * (-1087.921) (-1081.560) (-1083.285) [-1082.790] -- 0:00:39
370000 -- [-1081.932] (-1083.542) (-1083.148) (-1084.922) * (-1087.440) (-1080.935) [-1082.423] (-1082.588) -- 0:00:39
Average standard deviation of split frequencies: 0.013990
370500 -- [-1081.756] (-1084.505) (-1083.186) (-1086.240) * (-1082.415) (-1080.976) [-1083.651] (-1082.569) -- 0:00:39
371000 -- (-1082.838) (-1081.504) (-1088.265) [-1084.100] * (-1082.868) [-1081.647] (-1083.341) (-1083.008) -- 0:00:38
371500 -- (-1082.869) [-1082.997] (-1083.118) (-1082.700) * (-1085.667) [-1081.402] (-1085.126) (-1084.327) -- 0:00:38
372000 -- (-1084.517) (-1084.139) [-1082.039] (-1085.717) * (-1082.405) (-1081.749) (-1086.572) [-1082.149] -- 0:00:38
372500 -- [-1082.588] (-1082.778) (-1080.777) (-1085.332) * (-1083.893) (-1087.605) (-1086.741) [-1082.370] -- 0:00:38
373000 -- [-1083.292] (-1091.483) (-1081.808) (-1084.928) * (-1082.215) [-1085.871] (-1085.483) (-1082.357) -- 0:00:38
373500 -- (-1081.711) (-1082.379) [-1081.633] (-1095.154) * (-1084.258) (-1086.719) (-1083.251) [-1084.782] -- 0:00:38
374000 -- (-1081.498) (-1081.232) (-1081.708) [-1083.405] * (-1085.983) (-1084.863) (-1083.058) [-1084.957] -- 0:00:38
374500 -- (-1081.957) (-1085.120) [-1082.536] (-1081.939) * (-1084.350) (-1087.043) (-1087.625) [-1083.568] -- 0:00:38
375000 -- (-1083.694) [-1085.191] (-1082.660) (-1083.223) * (-1082.402) (-1089.902) (-1082.594) [-1082.898] -- 0:00:38
Average standard deviation of split frequencies: 0.014012
375500 -- (-1081.290) (-1088.280) [-1086.728] (-1086.649) * (-1082.138) (-1082.419) (-1080.894) [-1082.733] -- 0:00:38
376000 -- [-1081.283] (-1081.376) (-1083.806) (-1084.374) * (-1082.305) (-1085.242) [-1081.982] (-1084.168) -- 0:00:38
376500 -- (-1081.743) (-1082.234) [-1082.920] (-1085.376) * [-1083.073] (-1082.011) (-1084.755) (-1084.323) -- 0:00:38
377000 -- (-1084.677) [-1082.666] (-1084.208) (-1084.425) * (-1083.121) (-1084.712) [-1084.400] (-1083.454) -- 0:00:38
377500 -- (-1086.196) (-1086.449) (-1083.835) [-1084.570] * (-1082.064) (-1081.581) [-1083.385] (-1081.586) -- 0:00:37
378000 -- (-1082.804) [-1083.739] (-1084.506) (-1084.861) * (-1085.829) (-1083.401) (-1085.041) [-1085.684] -- 0:00:37
378500 -- (-1080.989) (-1082.224) [-1084.461] (-1084.585) * (-1085.146) (-1084.790) (-1083.415) [-1081.269] -- 0:00:37
379000 -- (-1083.448) (-1084.302) [-1082.445] (-1085.775) * (-1081.750) (-1084.565) [-1081.895] (-1082.211) -- 0:00:37
379500 -- [-1084.035] (-1087.142) (-1082.128) (-1082.067) * [-1080.998] (-1083.333) (-1082.619) (-1081.812) -- 0:00:37
380000 -- (-1082.553) (-1084.249) (-1081.851) [-1081.521] * (-1081.053) (-1083.499) [-1082.500] (-1083.174) -- 0:00:37
Average standard deviation of split frequencies: 0.014059
380500 -- (-1087.362) (-1083.723) [-1082.042] (-1081.743) * (-1082.582) (-1086.030) (-1086.640) [-1084.307] -- 0:00:37
381000 -- (-1082.880) (-1082.901) (-1087.735) [-1084.540] * [-1081.919] (-1086.021) (-1083.385) (-1085.869) -- 0:00:37
381500 -- (-1081.762) (-1083.248) [-1085.222] (-1084.862) * (-1081.919) (-1087.234) [-1081.664] (-1083.630) -- 0:00:37
382000 -- (-1080.996) (-1082.761) (-1082.501) [-1081.377] * (-1085.400) [-1081.354] (-1083.560) (-1088.631) -- 0:00:37
382500 -- (-1081.657) (-1084.128) (-1082.462) [-1081.931] * (-1085.780) [-1083.465] (-1084.749) (-1088.038) -- 0:00:37
383000 -- [-1081.494] (-1085.048) (-1081.980) (-1085.160) * (-1083.370) (-1094.391) (-1085.951) [-1084.200] -- 0:00:37
383500 -- [-1081.759] (-1086.036) (-1082.640) (-1084.277) * [-1081.667] (-1084.280) (-1086.918) (-1084.335) -- 0:00:36
384000 -- (-1083.849) (-1085.756) [-1082.584] (-1084.388) * [-1083.932] (-1085.402) (-1085.553) (-1084.178) -- 0:00:36
384500 -- [-1086.206] (-1087.458) (-1082.662) (-1084.409) * (-1085.725) [-1085.044] (-1084.536) (-1086.059) -- 0:00:36
385000 -- (-1083.063) (-1083.554) (-1081.725) [-1084.025] * (-1086.011) (-1086.699) (-1084.702) [-1085.338] -- 0:00:36
Average standard deviation of split frequencies: 0.013793
385500 -- (-1084.461) (-1084.496) (-1083.324) [-1082.417] * (-1083.651) (-1082.443) [-1083.879] (-1091.581) -- 0:00:38
386000 -- (-1084.481) [-1084.683] (-1082.505) (-1083.281) * (-1081.331) (-1081.177) [-1084.053] (-1084.674) -- 0:00:38
386500 -- [-1084.802] (-1082.356) (-1085.363) (-1083.030) * [-1082.938] (-1085.031) (-1085.181) (-1081.873) -- 0:00:38
387000 -- (-1082.205) (-1085.321) (-1085.086) [-1083.685] * [-1083.060] (-1083.942) (-1085.377) (-1081.974) -- 0:00:38
387500 -- (-1082.074) (-1084.276) (-1084.436) [-1088.990] * (-1081.993) (-1085.776) [-1083.245] (-1085.110) -- 0:00:37
388000 -- (-1084.599) (-1083.812) (-1082.914) [-1081.991] * (-1082.616) (-1082.650) [-1082.127] (-1080.925) -- 0:00:37
388500 -- [-1081.461] (-1082.678) (-1083.800) (-1082.266) * (-1082.893) (-1085.167) [-1081.145] (-1081.399) -- 0:00:37
389000 -- [-1083.667] (-1082.606) (-1083.026) (-1082.266) * (-1089.062) (-1083.288) (-1081.038) [-1081.177] -- 0:00:37
389500 -- [-1083.930] (-1083.254) (-1083.581) (-1083.707) * (-1083.897) (-1088.332) [-1082.902] (-1087.314) -- 0:00:37
390000 -- [-1081.905] (-1083.162) (-1082.613) (-1082.938) * (-1087.657) (-1085.615) [-1084.453] (-1088.946) -- 0:00:37
Average standard deviation of split frequencies: 0.013557
390500 -- (-1086.280) (-1084.447) (-1081.525) [-1083.425] * (-1083.650) (-1088.916) [-1081.580] (-1086.212) -- 0:00:37
391000 -- (-1086.546) [-1082.839] (-1082.377) (-1084.323) * (-1085.293) (-1082.950) [-1082.509] (-1084.995) -- 0:00:37
391500 -- (-1084.202) [-1083.636] (-1081.110) (-1082.477) * (-1083.736) [-1082.915] (-1085.384) (-1082.370) -- 0:00:37
392000 -- (-1085.461) (-1082.403) (-1081.033) [-1082.505] * (-1083.346) (-1082.990) [-1082.296] (-1084.193) -- 0:00:37
392500 -- (-1083.853) (-1087.040) (-1082.465) [-1084.172] * (-1087.136) [-1082.521] (-1082.138) (-1083.017) -- 0:00:37
393000 -- (-1081.674) (-1085.922) [-1086.760] (-1086.675) * (-1086.940) [-1082.589] (-1085.346) (-1082.076) -- 0:00:37
393500 -- [-1083.928] (-1084.055) (-1084.048) (-1084.383) * (-1084.823) [-1083.853] (-1092.081) (-1083.018) -- 0:00:36
394000 -- (-1084.454) (-1082.433) (-1083.682) [-1082.618] * (-1083.055) [-1082.457] (-1085.861) (-1084.694) -- 0:00:36
394500 -- [-1083.083] (-1082.290) (-1082.779) (-1081.398) * [-1083.043] (-1081.574) (-1086.491) (-1086.308) -- 0:00:36
395000 -- (-1082.583) [-1082.734] (-1081.763) (-1081.219) * (-1083.437) [-1082.227] (-1082.782) (-1082.994) -- 0:00:36
Average standard deviation of split frequencies: 0.012814
395500 -- (-1083.454) [-1083.047] (-1082.080) (-1083.507) * [-1081.416] (-1085.429) (-1080.905) (-1085.566) -- 0:00:36
396000 -- (-1084.519) (-1081.409) [-1081.477] (-1084.443) * (-1081.436) [-1083.173] (-1085.296) (-1083.304) -- 0:00:36
396500 -- (-1083.953) (-1082.522) [-1081.511] (-1086.733) * [-1081.044] (-1083.458) (-1084.778) (-1081.452) -- 0:00:36
397000 -- (-1082.611) [-1083.352] (-1087.655) (-1084.497) * (-1082.515) (-1080.837) [-1081.524] (-1083.089) -- 0:00:36
397500 -- (-1082.076) [-1081.702] (-1086.230) (-1083.295) * (-1088.497) [-1082.572] (-1081.658) (-1083.416) -- 0:00:36
398000 -- [-1081.312] (-1081.822) (-1084.516) (-1082.926) * [-1087.922] (-1085.112) (-1081.820) (-1082.283) -- 0:00:36
398500 -- (-1080.993) (-1081.578) [-1083.468] (-1083.007) * (-1083.708) (-1084.882) (-1083.114) [-1081.754] -- 0:00:36
399000 -- (-1083.069) [-1080.720] (-1086.851) (-1083.175) * (-1082.576) (-1086.256) (-1084.652) [-1082.021] -- 0:00:36
399500 -- (-1083.442) [-1082.386] (-1084.150) (-1084.359) * (-1081.824) [-1083.521] (-1084.417) (-1081.818) -- 0:00:36
400000 -- (-1085.812) (-1086.031) [-1084.965] (-1081.438) * (-1081.882) (-1082.419) (-1082.985) [-1081.851] -- 0:00:36
Average standard deviation of split frequencies: 0.013150
400500 -- (-1084.027) (-1086.824) [-1084.648] (-1082.416) * (-1082.091) [-1084.702] (-1084.520) (-1081.441) -- 0:00:35
401000 -- [-1083.600] (-1085.411) (-1086.193) (-1084.531) * (-1081.750) (-1084.689) [-1082.750] (-1082.125) -- 0:00:35
401500 -- (-1082.497) [-1081.517] (-1083.689) (-1084.169) * (-1083.417) [-1084.557] (-1081.363) (-1085.233) -- 0:00:35
402000 -- [-1083.771] (-1081.992) (-1083.296) (-1089.552) * (-1081.940) [-1082.139] (-1081.663) (-1084.959) -- 0:00:37
402500 -- [-1084.503] (-1081.349) (-1084.485) (-1082.627) * (-1081.684) (-1081.598) [-1082.287] (-1084.525) -- 0:00:37
403000 -- (-1084.192) (-1082.934) (-1081.646) [-1080.734] * (-1081.032) (-1082.874) (-1081.225) [-1086.077] -- 0:00:37
403500 -- (-1087.454) [-1080.700] (-1081.613) (-1083.266) * [-1081.032] (-1081.066) (-1082.317) (-1084.227) -- 0:00:36
404000 -- (-1086.076) [-1080.712] (-1081.790) (-1083.568) * [-1082.170] (-1082.434) (-1083.075) (-1084.158) -- 0:00:36
404500 -- (-1085.836) (-1081.022) [-1082.201] (-1087.344) * [-1082.554] (-1092.702) (-1085.236) (-1082.151) -- 0:00:36
405000 -- (-1085.921) [-1081.708] (-1084.917) (-1087.355) * (-1083.339) [-1084.490] (-1086.228) (-1082.878) -- 0:00:36
Average standard deviation of split frequencies: 0.012294
405500 -- (-1084.340) (-1081.703) (-1082.783) [-1084.658] * (-1085.951) (-1083.584) [-1082.587] (-1086.207) -- 0:00:36
406000 -- (-1082.803) (-1081.991) [-1081.745] (-1084.190) * (-1084.066) [-1083.183] (-1084.232) (-1083.838) -- 0:00:36
406500 -- [-1081.800] (-1085.684) (-1085.424) (-1086.350) * (-1081.627) [-1080.920] (-1083.740) (-1082.871) -- 0:00:36
407000 -- (-1082.428) (-1084.346) (-1081.604) [-1083.825] * (-1080.710) [-1084.278] (-1081.633) (-1085.570) -- 0:00:36
407500 -- (-1083.012) [-1081.203] (-1082.408) (-1082.817) * (-1081.502) (-1083.276) [-1084.216] (-1085.832) -- 0:00:36
408000 -- (-1082.165) [-1083.200] (-1082.501) (-1081.137) * (-1082.516) (-1084.408) (-1082.976) [-1084.972] -- 0:00:36
408500 -- (-1083.330) [-1082.214] (-1080.830) (-1082.428) * (-1083.124) [-1084.405] (-1083.293) (-1085.865) -- 0:00:36
409000 -- (-1082.917) [-1082.866] (-1084.500) (-1083.824) * [-1085.745] (-1082.797) (-1083.763) (-1083.617) -- 0:00:36
409500 -- [-1082.920] (-1083.368) (-1085.272) (-1084.704) * (-1083.966) [-1080.877] (-1083.209) (-1083.363) -- 0:00:36
410000 -- (-1083.282) (-1082.629) [-1083.029] (-1082.126) * (-1084.873) (-1084.794) [-1084.381] (-1087.207) -- 0:00:35
Average standard deviation of split frequencies: 0.012019
410500 -- [-1084.050] (-1084.622) (-1083.267) (-1086.770) * (-1082.920) (-1085.453) [-1084.225] (-1083.934) -- 0:00:35
411000 -- [-1083.411] (-1081.634) (-1084.094) (-1081.498) * (-1082.547) (-1083.859) (-1084.861) [-1082.478] -- 0:00:35
411500 -- (-1084.327) [-1081.398] (-1083.930) (-1082.439) * [-1082.085] (-1083.574) (-1082.800) (-1084.002) -- 0:00:35
412000 -- (-1088.051) [-1083.193] (-1081.432) (-1082.455) * (-1084.270) [-1082.764] (-1082.881) (-1083.282) -- 0:00:35
412500 -- (-1085.650) (-1083.760) (-1083.762) [-1081.480] * (-1084.867) [-1082.718] (-1082.121) (-1082.919) -- 0:00:35
413000 -- (-1081.867) (-1081.550) (-1088.384) [-1085.024] * (-1088.409) (-1081.838) [-1083.426] (-1084.575) -- 0:00:35
413500 -- (-1081.990) [-1081.677] (-1084.845) (-1089.341) * (-1081.592) [-1082.401] (-1082.351) (-1082.608) -- 0:00:35
414000 -- (-1082.548) (-1080.768) (-1081.759) [-1083.422] * (-1088.484) (-1082.695) (-1088.479) [-1082.089] -- 0:00:35
414500 -- (-1081.564) (-1084.049) [-1082.796] (-1085.845) * (-1083.879) (-1082.423) (-1083.207) [-1082.825] -- 0:00:35
415000 -- [-1081.083] (-1080.673) (-1084.194) (-1081.728) * (-1082.831) (-1090.024) (-1083.186) [-1083.675] -- 0:00:35
Average standard deviation of split frequencies: 0.013102
415500 -- (-1086.443) (-1080.975) [-1082.427] (-1084.214) * (-1081.030) [-1086.172] (-1081.774) (-1082.390) -- 0:00:35
416000 -- (-1082.151) [-1082.343] (-1082.036) (-1081.366) * (-1081.436) [-1082.948] (-1081.695) (-1081.935) -- 0:00:35
416500 -- (-1086.243) [-1081.787] (-1083.352) (-1080.840) * [-1081.219] (-1081.599) (-1081.719) (-1081.790) -- 0:00:35
417000 -- (-1081.331) [-1085.219] (-1085.487) (-1083.381) * (-1081.790) (-1080.754) (-1084.657) [-1081.870] -- 0:00:34
417500 -- (-1081.934) (-1083.408) [-1084.244] (-1085.780) * [-1082.083] (-1082.960) (-1081.772) (-1082.711) -- 0:00:34
418000 -- (-1082.280) (-1087.489) (-1081.692) [-1081.599] * (-1081.790) (-1085.709) [-1081.076] (-1084.854) -- 0:00:34
418500 -- (-1082.361) (-1083.310) [-1083.211] (-1087.466) * [-1081.757] (-1086.976) (-1082.733) (-1082.815) -- 0:00:34
419000 -- [-1083.189] (-1085.728) (-1086.415) (-1085.261) * (-1081.591) (-1085.700) [-1082.699] (-1081.325) -- 0:00:36
419500 -- (-1081.622) (-1085.650) (-1082.414) [-1081.339] * [-1080.880] (-1081.918) (-1084.426) (-1082.502) -- 0:00:35
420000 -- (-1081.791) [-1084.106] (-1082.342) (-1081.448) * (-1080.683) [-1082.103] (-1087.266) (-1081.973) -- 0:00:35
Average standard deviation of split frequencies: 0.013027
420500 -- [-1082.824] (-1088.328) (-1081.704) (-1081.768) * (-1083.682) (-1081.654) (-1082.811) [-1081.341] -- 0:00:35
421000 -- [-1081.472] (-1082.713) (-1086.022) (-1082.088) * (-1081.479) (-1082.260) [-1082.630] (-1083.633) -- 0:00:35
421500 -- (-1081.184) (-1081.499) (-1082.695) [-1084.271] * (-1082.087) (-1081.447) [-1082.404] (-1083.417) -- 0:00:35
422000 -- [-1081.495] (-1082.169) (-1082.914) (-1081.332) * (-1082.645) (-1084.023) (-1081.450) [-1082.085] -- 0:00:35
422500 -- [-1081.416] (-1083.945) (-1081.943) (-1083.264) * (-1080.786) (-1084.632) (-1086.739) [-1083.157] -- 0:00:35
423000 -- (-1083.511) (-1082.470) [-1081.130] (-1080.862) * (-1084.036) [-1083.581] (-1084.722) (-1084.107) -- 0:00:35
423500 -- (-1082.805) (-1085.392) (-1081.250) [-1082.960] * (-1082.491) (-1082.217) [-1084.232] (-1082.055) -- 0:00:35
424000 -- (-1084.048) (-1082.243) (-1083.191) [-1082.216] * (-1081.383) [-1086.265] (-1083.040) (-1083.895) -- 0:00:35
424500 -- [-1081.123] (-1087.331) (-1086.030) (-1082.645) * (-1084.133) (-1084.596) (-1082.819) [-1082.157] -- 0:00:35
425000 -- (-1081.840) (-1085.676) [-1081.596] (-1086.300) * (-1085.589) (-1084.690) [-1083.531] (-1081.974) -- 0:00:35
Average standard deviation of split frequencies: 0.011652
425500 -- (-1084.669) (-1083.175) (-1083.898) [-1081.502] * [-1083.540] (-1083.583) (-1081.024) (-1083.949) -- 0:00:35
426000 -- (-1087.197) (-1083.313) [-1081.688] (-1081.689) * (-1087.492) [-1080.963] (-1082.067) (-1085.818) -- 0:00:35
426500 -- [-1083.511] (-1083.515) (-1081.463) (-1082.778) * (-1081.049) (-1082.522) [-1084.158] (-1082.909) -- 0:00:34
427000 -- (-1082.573) (-1081.580) (-1082.078) [-1082.611] * (-1081.850) (-1084.931) [-1082.925] (-1082.226) -- 0:00:34
427500 -- [-1082.677] (-1084.165) (-1082.095) (-1082.459) * (-1081.779) (-1082.901) (-1082.221) [-1082.468] -- 0:00:34
428000 -- (-1083.622) (-1083.583) [-1081.382] (-1081.117) * [-1081.664] (-1083.073) (-1081.760) (-1082.594) -- 0:00:34
428500 -- [-1081.344] (-1082.436) (-1087.156) (-1087.452) * (-1081.451) (-1081.399) [-1081.636] (-1084.458) -- 0:00:34
429000 -- (-1081.866) (-1081.910) [-1082.373] (-1084.032) * (-1081.398) (-1081.574) [-1082.096] (-1091.497) -- 0:00:34
429500 -- (-1082.289) (-1082.760) (-1083.303) [-1082.989] * (-1083.947) [-1083.885] (-1081.559) (-1084.691) -- 0:00:34
430000 -- (-1082.753) (-1082.715) [-1081.778] (-1086.531) * (-1082.230) (-1083.887) (-1082.043) [-1086.602] -- 0:00:34
Average standard deviation of split frequencies: 0.011912
430500 -- [-1082.706] (-1083.141) (-1082.882) (-1084.395) * (-1081.967) (-1082.744) (-1082.092) [-1083.615] -- 0:00:34
431000 -- (-1087.133) [-1082.596] (-1084.010) (-1084.140) * [-1082.515] (-1082.751) (-1086.327) (-1084.650) -- 0:00:34
431500 -- (-1086.813) (-1086.697) [-1082.546] (-1084.031) * (-1082.660) [-1083.758] (-1089.873) (-1083.914) -- 0:00:34
432000 -- (-1081.136) (-1088.039) [-1083.981] (-1083.184) * (-1085.472) [-1083.644] (-1081.675) (-1086.102) -- 0:00:34
432500 -- (-1084.107) (-1087.498) [-1085.759] (-1081.795) * (-1082.889) (-1085.691) [-1082.018] (-1081.927) -- 0:00:34
433000 -- (-1085.129) [-1087.417] (-1083.349) (-1081.379) * (-1082.298) (-1085.242) [-1081.931] (-1081.637) -- 0:00:34
433500 -- (-1083.015) [-1081.676] (-1084.605) (-1082.157) * (-1085.745) [-1085.453] (-1083.385) (-1081.593) -- 0:00:33
434000 -- (-1082.509) (-1081.382) [-1083.019] (-1087.215) * [-1083.314] (-1084.123) (-1082.692) (-1084.675) -- 0:00:33
434500 -- [-1082.342] (-1080.875) (-1082.401) (-1083.788) * (-1082.514) (-1081.247) [-1082.414] (-1083.160) -- 0:00:33
435000 -- (-1084.502) (-1081.048) (-1085.373) [-1086.157] * (-1081.518) (-1081.979) [-1081.337] (-1083.474) -- 0:00:33
Average standard deviation of split frequencies: 0.011257
435500 -- (-1085.152) (-1080.808) (-1082.685) [-1081.844] * [-1080.843] (-1083.266) (-1081.681) (-1082.566) -- 0:00:34
436000 -- [-1084.619] (-1081.877) (-1080.761) (-1083.399) * (-1081.466) (-1087.420) [-1081.991] (-1081.945) -- 0:00:34
436500 -- (-1091.874) [-1084.559] (-1082.228) (-1084.304) * (-1081.883) (-1086.024) [-1082.014] (-1081.506) -- 0:00:34
437000 -- (-1090.453) (-1085.040) (-1085.138) [-1084.621] * (-1081.865) (-1082.211) [-1081.769] (-1083.606) -- 0:00:34
437500 -- (-1085.873) (-1082.787) (-1083.128) [-1086.637] * [-1081.064] (-1081.953) (-1084.681) (-1086.746) -- 0:00:34
438000 -- [-1086.745] (-1084.369) (-1084.475) (-1084.837) * [-1081.868] (-1081.745) (-1081.851) (-1085.678) -- 0:00:34
438500 -- (-1090.224) [-1083.993] (-1084.290) (-1085.711) * (-1082.079) [-1084.700] (-1081.146) (-1083.603) -- 0:00:34
439000 -- [-1084.131] (-1083.448) (-1082.623) (-1085.325) * (-1083.188) [-1086.360] (-1082.992) (-1086.541) -- 0:00:34
439500 -- [-1084.756] (-1081.738) (-1083.158) (-1082.956) * [-1083.491] (-1088.315) (-1084.765) (-1090.179) -- 0:00:34
440000 -- (-1089.309) [-1084.144] (-1083.014) (-1083.174) * (-1082.298) (-1082.819) (-1085.529) [-1087.064] -- 0:00:34
Average standard deviation of split frequencies: 0.010635
440500 -- (-1086.578) [-1081.030] (-1083.362) (-1082.330) * (-1084.230) (-1080.694) (-1081.936) [-1084.744] -- 0:00:34
441000 -- (-1082.471) (-1081.775) [-1081.770] (-1084.992) * (-1083.928) [-1080.694] (-1083.724) (-1085.143) -- 0:00:34
441500 -- (-1083.424) (-1083.325) [-1082.495] (-1082.323) * (-1083.720) (-1080.934) (-1085.810) [-1085.707] -- 0:00:34
442000 -- (-1092.000) (-1083.953) (-1084.895) [-1082.160] * (-1082.541) [-1084.087] (-1082.780) (-1086.041) -- 0:00:34
442500 -- (-1083.700) (-1084.979) [-1084.146] (-1085.710) * [-1081.260] (-1081.054) (-1083.267) (-1082.764) -- 0:00:34
443000 -- (-1084.463) (-1085.294) [-1083.175] (-1092.088) * [-1083.170] (-1083.640) (-1086.495) (-1081.746) -- 0:00:33
443500 -- (-1087.243) (-1082.623) [-1085.473] (-1084.348) * (-1082.297) (-1082.227) (-1084.000) [-1082.416] -- 0:00:33
444000 -- (-1082.886) (-1082.469) [-1082.962] (-1082.819) * (-1082.622) [-1084.988] (-1083.053) (-1083.851) -- 0:00:33
444500 -- (-1085.965) (-1081.844) [-1081.126] (-1082.975) * (-1089.676) (-1085.194) (-1082.498) [-1083.875] -- 0:00:33
445000 -- (-1082.184) (-1083.198) [-1081.319] (-1082.315) * (-1083.257) (-1088.182) [-1084.401] (-1084.930) -- 0:00:33
Average standard deviation of split frequencies: 0.010259
445500 -- (-1085.086) (-1085.308) [-1082.235] (-1083.568) * (-1083.087) (-1081.770) (-1082.067) [-1082.287] -- 0:00:33
446000 -- (-1086.537) (-1082.862) (-1081.354) [-1081.138] * (-1083.994) [-1083.678] (-1083.483) (-1081.164) -- 0:00:33
446500 -- (-1081.571) (-1083.072) (-1081.977) [-1084.671] * (-1082.506) [-1082.842] (-1081.671) (-1082.690) -- 0:00:33
447000 -- (-1084.405) (-1084.424) [-1084.162] (-1090.229) * (-1082.507) (-1081.650) (-1088.376) [-1081.507] -- 0:00:33
447500 -- (-1084.596) (-1082.459) [-1083.558] (-1093.617) * (-1086.119) [-1081.484] (-1084.954) (-1081.282) -- 0:00:33
448000 -- (-1085.926) (-1085.193) (-1082.429) [-1091.279] * (-1086.991) (-1087.413) [-1081.926] (-1082.995) -- 0:00:33
448500 -- (-1084.288) [-1082.704] (-1084.626) (-1082.845) * (-1084.311) (-1082.845) [-1082.625] (-1082.404) -- 0:00:33
449000 -- [-1083.056] (-1083.223) (-1084.765) (-1081.591) * (-1085.603) (-1082.159) [-1081.075] (-1084.473) -- 0:00:33
449500 -- [-1082.444] (-1084.966) (-1082.356) (-1082.305) * (-1084.943) (-1083.411) [-1082.751] (-1083.237) -- 0:00:33
450000 -- (-1081.442) (-1084.072) (-1081.555) [-1082.147] * (-1083.856) (-1082.351) (-1081.478) [-1083.756] -- 0:00:33
Average standard deviation of split frequencies: 0.009906
450500 -- (-1081.120) (-1082.240) (-1083.817) [-1081.209] * (-1084.145) (-1080.961) (-1083.333) [-1085.505] -- 0:00:32
451000 -- (-1084.501) (-1082.586) [-1084.244] (-1081.303) * [-1082.064] (-1082.557) (-1085.204) (-1082.491) -- 0:00:32
451500 -- [-1083.929] (-1087.257) (-1084.853) (-1083.834) * (-1082.090) [-1084.284] (-1084.805) (-1081.035) -- 0:00:34
452000 -- (-1082.130) [-1084.280] (-1085.116) (-1082.932) * (-1082.977) [-1082.597] (-1083.819) (-1080.938) -- 0:00:33
452500 -- (-1083.037) [-1082.629] (-1083.927) (-1081.955) * (-1084.021) [-1084.522] (-1082.631) (-1082.743) -- 0:00:33
453000 -- (-1082.110) [-1084.069] (-1084.146) (-1081.389) * [-1085.173] (-1083.289) (-1083.805) (-1082.897) -- 0:00:33
453500 -- (-1084.056) (-1084.111) (-1083.335) [-1083.588] * (-1089.026) (-1083.899) [-1082.053] (-1082.491) -- 0:00:33
454000 -- (-1081.379) [-1082.186] (-1086.943) (-1082.721) * (-1083.809) (-1084.011) (-1083.170) [-1082.075] -- 0:00:33
454500 -- [-1084.496] (-1085.660) (-1084.791) (-1082.230) * (-1082.744) (-1084.352) [-1083.574] (-1082.728) -- 0:00:33
455000 -- (-1087.818) (-1083.879) (-1083.602) [-1081.437] * [-1084.758] (-1086.852) (-1082.031) (-1082.071) -- 0:00:33
Average standard deviation of split frequencies: 0.009950
455500 -- (-1091.886) (-1084.848) [-1086.082] (-1080.967) * (-1084.686) (-1082.235) [-1081.262] (-1083.261) -- 0:00:33
456000 -- (-1086.359) [-1084.402] (-1083.222) (-1081.467) * (-1081.503) (-1081.164) [-1087.383] (-1082.511) -- 0:00:33
456500 -- (-1081.099) [-1085.119] (-1082.174) (-1089.255) * (-1081.470) (-1082.945) [-1085.284] (-1083.253) -- 0:00:33
457000 -- [-1080.802] (-1081.991) (-1081.662) (-1089.026) * (-1081.415) (-1083.971) [-1082.758] (-1082.694) -- 0:00:33
457500 -- [-1080.803] (-1083.933) (-1083.314) (-1084.840) * (-1082.167) (-1083.164) (-1083.699) [-1086.379] -- 0:00:33
458000 -- (-1082.664) [-1081.112] (-1082.869) (-1086.215) * (-1081.418) (-1081.986) [-1083.279] (-1082.770) -- 0:00:33
458500 -- (-1083.893) [-1081.741] (-1086.031) (-1084.676) * [-1083.534] (-1082.693) (-1082.414) (-1083.762) -- 0:00:33
459000 -- (-1084.382) [-1082.565] (-1085.008) (-1084.043) * (-1086.120) (-1082.774) [-1085.009] (-1086.224) -- 0:00:33
459500 -- [-1084.344] (-1082.789) (-1084.614) (-1084.310) * (-1086.865) (-1082.106) [-1081.779] (-1088.032) -- 0:00:32
460000 -- [-1085.796] (-1084.210) (-1086.854) (-1083.590) * (-1084.169) [-1084.711] (-1083.099) (-1086.630) -- 0:00:32
Average standard deviation of split frequencies: 0.010361
460500 -- (-1085.073) (-1084.048) [-1081.253] (-1082.953) * (-1085.882) [-1082.390] (-1085.923) (-1085.726) -- 0:00:32
461000 -- (-1084.380) (-1084.338) [-1085.877] (-1083.116) * (-1083.509) (-1080.849) (-1082.038) [-1081.535] -- 0:00:32
461500 -- [-1081.626] (-1082.236) (-1083.545) (-1083.926) * [-1084.103] (-1081.472) (-1084.569) (-1081.631) -- 0:00:32
462000 -- (-1082.727) [-1081.559] (-1083.273) (-1083.650) * (-1082.895) [-1081.472] (-1087.915) (-1083.715) -- 0:00:32
462500 -- (-1082.698) (-1086.144) [-1083.872] (-1081.504) * (-1086.902) [-1084.208] (-1080.961) (-1082.441) -- 0:00:32
463000 -- (-1082.602) (-1081.879) [-1081.011] (-1083.294) * [-1088.590] (-1082.882) (-1083.142) (-1084.217) -- 0:00:32
463500 -- (-1085.625) (-1082.279) [-1084.491] (-1081.392) * [-1082.847] (-1083.559) (-1082.404) (-1084.685) -- 0:00:32
464000 -- (-1087.387) [-1082.524] (-1083.764) (-1083.757) * (-1081.898) [-1083.903] (-1085.015) (-1083.850) -- 0:00:32
464500 -- [-1082.591] (-1083.359) (-1083.839) (-1081.180) * (-1083.925) [-1086.872] (-1086.776) (-1083.610) -- 0:00:32
465000 -- (-1082.291) [-1083.828] (-1083.324) (-1088.661) * [-1082.516] (-1084.054) (-1083.267) (-1085.029) -- 0:00:32
Average standard deviation of split frequencies: 0.010175
465500 -- (-1082.832) [-1082.499] (-1083.699) (-1087.035) * (-1082.910) (-1084.491) [-1081.380] (-1084.446) -- 0:00:32
466000 -- (-1082.004) [-1081.757] (-1081.732) (-1081.962) * (-1082.320) [-1083.740] (-1081.617) (-1086.311) -- 0:00:32
466500 -- (-1084.336) [-1081.763] (-1084.627) (-1082.964) * (-1081.224) (-1082.730) (-1083.356) [-1081.360] -- 0:00:32
467000 -- (-1087.771) (-1087.126) [-1085.087] (-1081.533) * (-1082.952) [-1081.654] (-1084.216) (-1081.767) -- 0:00:31
467500 -- (-1083.473) (-1089.380) (-1088.134) [-1086.112] * (-1084.963) (-1085.560) (-1083.609) [-1082.928] -- 0:00:33
468000 -- (-1082.421) [-1083.541] (-1084.047) (-1083.359) * (-1083.986) [-1081.971] (-1084.925) (-1083.314) -- 0:00:32
468500 -- (-1085.033) (-1083.232) [-1085.281] (-1084.266) * (-1083.760) (-1082.526) (-1083.192) [-1082.374] -- 0:00:32
469000 -- (-1083.530) [-1082.732] (-1082.244) (-1085.667) * (-1084.688) [-1083.384] (-1081.948) (-1081.598) -- 0:00:32
469500 -- [-1082.055] (-1088.448) (-1081.278) (-1082.629) * [-1084.608] (-1083.640) (-1085.629) (-1080.981) -- 0:00:32
470000 -- [-1081.591] (-1088.450) (-1082.056) (-1083.957) * (-1083.814) (-1082.771) (-1084.421) [-1081.319] -- 0:00:32
Average standard deviation of split frequencies: 0.010016
470500 -- (-1083.293) (-1087.323) (-1081.117) [-1086.494] * (-1082.205) (-1083.373) (-1087.549) [-1080.729] -- 0:00:32
471000 -- (-1082.497) (-1083.063) (-1081.206) [-1086.253] * (-1086.404) (-1083.927) (-1084.854) [-1082.531] -- 0:00:32
471500 -- (-1082.119) [-1081.291] (-1081.949) (-1083.851) * [-1082.874] (-1083.172) (-1083.679) (-1081.605) -- 0:00:32
472000 -- (-1084.430) [-1081.396] (-1083.210) (-1084.973) * [-1082.063] (-1082.003) (-1082.737) (-1082.735) -- 0:00:32
472500 -- (-1086.446) (-1083.504) [-1081.802] (-1082.596) * (-1083.432) [-1082.901] (-1081.986) (-1084.817) -- 0:00:32
473000 -- (-1082.833) (-1084.280) (-1082.099) [-1082.624] * (-1083.372) (-1083.876) [-1081.144] (-1083.518) -- 0:00:32
473500 -- (-1084.838) (-1083.506) (-1081.873) [-1082.056] * (-1081.968) (-1083.460) [-1082.139] (-1083.508) -- 0:00:32
474000 -- [-1084.429] (-1081.577) (-1081.351) (-1082.569) * (-1087.047) (-1081.817) (-1082.500) [-1083.955] -- 0:00:32
474500 -- (-1085.439) [-1083.770] (-1083.302) (-1086.772) * (-1086.268) [-1081.402] (-1082.283) (-1084.710) -- 0:00:32
475000 -- (-1085.446) [-1081.451] (-1083.138) (-1086.224) * (-1084.955) (-1081.763) (-1081.662) [-1084.163] -- 0:00:32
Average standard deviation of split frequencies: 0.010370
475500 -- (-1084.260) (-1083.487) [-1081.442] (-1082.903) * (-1082.794) (-1081.833) [-1082.180] (-1083.535) -- 0:00:31
476000 -- (-1084.544) (-1082.491) [-1082.939] (-1084.782) * [-1083.235] (-1084.535) (-1084.705) (-1090.615) -- 0:00:31
476500 -- (-1082.348) (-1082.116) [-1081.947] (-1082.311) * (-1084.234) [-1086.051] (-1081.846) (-1084.720) -- 0:00:31
477000 -- (-1082.071) (-1085.175) [-1082.591] (-1082.607) * (-1084.484) (-1082.758) [-1082.474] (-1081.224) -- 0:00:31
477500 -- (-1082.373) [-1084.200] (-1081.429) (-1083.275) * (-1081.939) (-1082.063) (-1081.846) [-1082.099] -- 0:00:31
478000 -- [-1082.735] (-1084.347) (-1081.832) (-1082.800) * [-1083.058] (-1084.321) (-1084.807) (-1082.193) -- 0:00:31
478500 -- (-1083.530) (-1082.282) [-1081.229] (-1081.781) * [-1083.690] (-1086.347) (-1083.376) (-1083.152) -- 0:00:31
479000 -- (-1081.608) [-1083.020] (-1081.299) (-1082.143) * (-1081.760) (-1084.177) (-1085.028) [-1082.291] -- 0:00:31
479500 -- (-1082.044) (-1081.917) (-1086.094) [-1082.433] * (-1083.882) [-1084.099] (-1081.369) (-1082.141) -- 0:00:31
480000 -- (-1083.711) (-1083.488) [-1081.450] (-1082.072) * [-1082.162] (-1082.093) (-1084.532) (-1083.172) -- 0:00:31
Average standard deviation of split frequencies: 0.010903
480500 -- (-1084.328) (-1081.219) (-1082.660) [-1081.931] * (-1082.134) [-1083.561] (-1081.955) (-1084.088) -- 0:00:31
481000 -- (-1083.211) [-1081.654] (-1084.230) (-1082.051) * (-1083.311) (-1087.094) (-1081.016) [-1081.928] -- 0:00:31
481500 -- (-1082.872) [-1087.818] (-1081.588) (-1082.511) * [-1087.264] (-1081.987) (-1083.870) (-1081.507) -- 0:00:31
482000 -- (-1083.913) [-1082.838] (-1082.605) (-1083.532) * (-1082.589) [-1081.462] (-1081.277) (-1081.405) -- 0:00:31
482500 -- (-1084.485) [-1083.467] (-1082.310) (-1081.512) * [-1084.876] (-1084.347) (-1081.208) (-1083.329) -- 0:00:31
483000 -- [-1081.008] (-1085.318) (-1082.024) (-1083.087) * (-1081.923) (-1082.832) (-1081.498) [-1081.564] -- 0:00:31
483500 -- (-1087.193) [-1086.070] (-1081.298) (-1083.260) * (-1083.350) (-1081.690) (-1088.313) [-1081.273] -- 0:00:30
484000 -- (-1083.609) [-1082.716] (-1087.212) (-1083.864) * [-1082.820] (-1084.331) (-1083.517) (-1081.663) -- 0:00:31
484500 -- [-1083.152] (-1084.492) (-1083.967) (-1083.618) * (-1082.557) [-1084.532] (-1082.822) (-1082.183) -- 0:00:31
485000 -- (-1083.852) (-1088.657) (-1083.494) [-1083.216] * (-1081.301) (-1081.985) (-1081.450) [-1081.860] -- 0:00:31
Average standard deviation of split frequencies: 0.010784
485500 -- [-1084.929] (-1083.278) (-1083.657) (-1089.846) * (-1081.305) (-1084.670) [-1082.383] (-1081.760) -- 0:00:31
486000 -- [-1085.657] (-1083.914) (-1080.867) (-1081.981) * (-1081.724) (-1084.386) [-1081.905] (-1083.226) -- 0:00:31
486500 -- (-1084.096) (-1082.683) [-1081.419] (-1087.255) * [-1081.736] (-1082.268) (-1085.079) (-1084.120) -- 0:00:31
487000 -- (-1082.444) (-1083.514) [-1082.610] (-1089.580) * [-1081.205] (-1084.526) (-1084.004) (-1084.619) -- 0:00:31
487500 -- [-1082.257] (-1085.006) (-1081.805) (-1084.107) * (-1081.205) (-1083.822) (-1087.401) [-1084.113] -- 0:00:31
488000 -- (-1081.698) (-1085.075) [-1088.486] (-1086.485) * (-1082.931) (-1084.846) [-1084.737] (-1082.091) -- 0:00:31
488500 -- [-1085.270] (-1085.280) (-1084.169) (-1084.463) * [-1082.981] (-1081.710) (-1084.504) (-1082.286) -- 0:00:31
489000 -- (-1080.927) [-1081.651] (-1084.110) (-1083.742) * (-1086.539) [-1086.382] (-1088.815) (-1087.075) -- 0:00:31
489500 -- [-1081.014] (-1081.837) (-1085.008) (-1083.651) * (-1083.689) [-1083.488] (-1082.546) (-1082.643) -- 0:00:31
490000 -- (-1081.746) [-1081.580] (-1083.729) (-1085.518) * (-1082.733) [-1082.785] (-1081.833) (-1081.480) -- 0:00:31
Average standard deviation of split frequencies: 0.010568
490500 -- (-1083.075) (-1084.839) [-1082.609] (-1086.645) * (-1085.367) [-1084.916] (-1083.440) (-1081.553) -- 0:00:31
491000 -- (-1081.064) (-1082.318) (-1081.959) [-1082.498] * [-1083.501] (-1082.242) (-1081.580) (-1084.224) -- 0:00:31
491500 -- [-1081.167] (-1081.895) (-1081.632) (-1081.743) * (-1081.649) [-1082.242] (-1084.029) (-1085.069) -- 0:00:31
492000 -- [-1082.717] (-1082.442) (-1082.504) (-1083.614) * (-1082.661) [-1083.439] (-1086.467) (-1084.556) -- 0:00:30
492500 -- (-1082.282) (-1081.991) (-1082.162) [-1082.286] * (-1082.757) (-1083.457) (-1084.994) [-1083.298] -- 0:00:30
493000 -- (-1082.283) (-1086.011) (-1082.341) [-1082.534] * (-1084.576) (-1081.708) [-1082.273] (-1083.733) -- 0:00:30
493500 -- (-1081.710) (-1084.987) [-1084.157] (-1084.429) * [-1080.740] (-1085.611) (-1081.499) (-1082.916) -- 0:00:30
494000 -- (-1084.263) (-1085.694) [-1081.201] (-1083.240) * (-1081.442) (-1081.653) [-1080.737] (-1082.043) -- 0:00:30
494500 -- (-1083.694) (-1085.793) [-1081.847] (-1081.500) * (-1083.079) (-1084.738) (-1081.294) [-1084.108] -- 0:00:30
495000 -- [-1083.611] (-1084.653) (-1084.938) (-1081.246) * [-1081.559] (-1083.821) (-1080.821) (-1082.618) -- 0:00:30
Average standard deviation of split frequencies: 0.010622
495500 -- [-1084.936] (-1082.140) (-1085.182) (-1084.700) * (-1081.503) [-1083.077] (-1082.883) (-1085.723) -- 0:00:30
496000 -- (-1081.743) (-1092.917) (-1088.867) [-1082.589] * (-1085.946) [-1083.623] (-1081.395) (-1083.106) -- 0:00:30
496500 -- [-1082.589] (-1086.438) (-1081.249) (-1084.023) * [-1084.437] (-1081.340) (-1084.089) (-1084.937) -- 0:00:30
497000 -- [-1082.287] (-1086.458) (-1082.757) (-1082.281) * (-1083.798) (-1081.281) [-1082.949] (-1087.450) -- 0:00:30
497500 -- (-1084.536) [-1085.655] (-1085.575) (-1082.189) * (-1081.959) (-1081.290) (-1081.666) [-1081.674] -- 0:00:30
498000 -- (-1082.641) [-1084.753] (-1082.870) (-1086.127) * (-1082.043) [-1084.449] (-1082.346) (-1081.835) -- 0:00:30
498500 -- [-1082.009] (-1083.698) (-1081.662) (-1082.838) * [-1085.285] (-1085.408) (-1081.256) (-1082.070) -- 0:00:30
499000 -- (-1081.614) (-1085.024) [-1081.461] (-1083.384) * [-1084.607] (-1086.786) (-1084.585) (-1081.592) -- 0:00:30
499500 -- (-1082.357) [-1082.108] (-1087.205) (-1081.976) * [-1083.531] (-1087.319) (-1083.081) (-1081.202) -- 0:00:30
500000 -- (-1082.966) (-1081.888) (-1084.311) [-1084.892] * (-1081.752) (-1087.750) (-1082.688) [-1081.503] -- 0:00:31
Average standard deviation of split frequencies: 0.010911
500500 -- (-1082.643) (-1082.094) (-1085.410) [-1081.965] * (-1081.842) (-1083.702) [-1083.255] (-1083.093) -- 0:00:30
501000 -- (-1086.749) (-1084.285) (-1082.613) [-1082.681] * [-1082.380] (-1086.344) (-1082.282) (-1084.891) -- 0:00:30
501500 -- (-1083.839) (-1085.245) [-1081.511] (-1086.707) * (-1084.697) (-1083.190) [-1081.333] (-1082.724) -- 0:00:30
502000 -- (-1082.262) (-1081.562) [-1081.520] (-1082.901) * (-1082.127) [-1081.519] (-1082.505) (-1089.285) -- 0:00:30
502500 -- (-1082.080) (-1081.195) (-1082.785) [-1081.665] * [-1082.779] (-1085.567) (-1082.549) (-1087.207) -- 0:00:30
503000 -- [-1081.287] (-1081.406) (-1084.566) (-1084.673) * (-1083.248) [-1085.121] (-1083.148) (-1082.495) -- 0:00:30
503500 -- (-1081.538) [-1082.605] (-1083.850) (-1084.663) * [-1083.979] (-1082.631) (-1082.596) (-1082.769) -- 0:00:30
504000 -- (-1083.021) (-1086.794) [-1082.675] (-1081.755) * (-1081.800) [-1081.943] (-1083.574) (-1082.402) -- 0:00:30
504500 -- [-1084.169] (-1083.530) (-1083.105) (-1082.318) * (-1084.346) (-1082.932) [-1083.135] (-1085.039) -- 0:00:30
505000 -- [-1083.704] (-1083.026) (-1082.115) (-1085.440) * [-1082.244] (-1084.481) (-1085.613) (-1086.482) -- 0:00:30
Average standard deviation of split frequencies: 0.010522
505500 -- [-1081.072] (-1082.434) (-1082.930) (-1089.788) * (-1081.179) (-1084.685) [-1083.136] (-1086.070) -- 0:00:30
506000 -- [-1084.358] (-1081.632) (-1082.631) (-1082.680) * (-1081.999) (-1081.479) [-1083.428] (-1084.127) -- 0:00:30
506500 -- (-1086.282) (-1081.322) (-1083.490) [-1084.329] * (-1081.544) (-1082.071) (-1090.683) [-1082.685] -- 0:00:30
507000 -- (-1085.390) (-1083.258) (-1084.800) [-1083.059] * (-1083.477) [-1082.568] (-1087.614) (-1087.615) -- 0:00:30
507500 -- (-1082.597) (-1089.688) (-1082.652) [-1083.438] * [-1081.446] (-1082.537) (-1090.548) (-1084.607) -- 0:00:30
508000 -- [-1084.675] (-1083.384) (-1081.959) (-1081.057) * (-1081.439) (-1082.728) [-1081.820] (-1081.849) -- 0:00:30
508500 -- (-1083.763) [-1082.516] (-1081.735) (-1083.497) * (-1083.809) (-1083.779) [-1081.717] (-1083.059) -- 0:00:29
509000 -- (-1084.854) (-1085.727) (-1081.531) [-1085.450] * (-1083.115) (-1084.683) (-1082.562) [-1083.002] -- 0:00:29
509500 -- [-1087.162] (-1082.240) (-1082.015) (-1085.250) * (-1083.964) (-1083.794) (-1084.736) [-1081.707] -- 0:00:29
510000 -- (-1083.953) (-1082.278) (-1085.064) [-1082.057] * (-1083.460) [-1083.504] (-1083.016) (-1083.958) -- 0:00:29
Average standard deviation of split frequencies: 0.010697
510500 -- (-1082.571) [-1083.316] (-1084.166) (-1081.166) * [-1082.912] (-1081.258) (-1081.757) (-1082.106) -- 0:00:29
511000 -- [-1082.296] (-1081.483) (-1081.684) (-1084.635) * [-1082.568] (-1082.791) (-1082.427) (-1083.559) -- 0:00:29
511500 -- (-1082.013) (-1082.116) (-1084.092) [-1083.660] * (-1081.222) (-1084.083) [-1083.098] (-1082.624) -- 0:00:29
512000 -- (-1082.313) (-1083.203) [-1083.297] (-1084.892) * (-1085.742) [-1081.751] (-1082.782) (-1085.378) -- 0:00:29
512500 -- (-1088.707) [-1082.749] (-1084.192) (-1083.358) * (-1084.162) [-1081.878] (-1082.906) (-1081.842) -- 0:00:29
513000 -- (-1083.066) (-1084.405) (-1085.175) [-1083.446] * (-1083.479) [-1081.119] (-1083.106) (-1081.768) -- 0:00:29
513500 -- (-1081.993) (-1084.600) (-1085.876) [-1081.516] * (-1082.489) (-1081.838) [-1081.037] (-1083.410) -- 0:00:29
514000 -- (-1087.558) (-1081.587) [-1082.103] (-1081.849) * (-1082.829) [-1083.565] (-1084.016) (-1087.936) -- 0:00:29
514500 -- (-1083.027) (-1082.339) [-1082.886] (-1082.804) * (-1084.805) (-1085.707) [-1083.289] (-1084.956) -- 0:00:29
515000 -- [-1082.036] (-1085.669) (-1085.138) (-1083.020) * [-1082.542] (-1084.228) (-1084.291) (-1085.794) -- 0:00:29
Average standard deviation of split frequencies: 0.010264
515500 -- (-1081.349) (-1084.810) (-1082.289) [-1081.763] * (-1086.116) [-1086.530] (-1084.412) (-1086.536) -- 0:00:29
516000 -- (-1082.564) (-1083.293) [-1082.852] (-1081.763) * (-1085.002) (-1081.631) (-1084.579) [-1085.518] -- 0:00:29
516500 -- (-1084.226) (-1083.667) [-1082.886] (-1081.238) * (-1081.887) (-1082.975) [-1081.811] (-1081.693) -- 0:00:29
517000 -- (-1085.189) (-1082.521) (-1081.799) [-1081.729] * (-1082.898) (-1085.384) (-1083.460) [-1083.333] -- 0:00:29
517500 -- (-1084.856) (-1083.976) [-1081.456] (-1083.212) * (-1085.414) (-1086.549) (-1083.846) [-1082.463] -- 0:00:29
518000 -- (-1084.702) (-1084.785) (-1082.126) [-1082.490] * (-1081.667) (-1085.989) [-1083.399] (-1083.275) -- 0:00:29
518500 -- (-1085.633) (-1082.334) (-1085.898) [-1081.216] * (-1082.096) (-1082.015) [-1082.968] (-1083.574) -- 0:00:29
519000 -- (-1084.123) (-1085.073) (-1082.879) [-1084.349] * [-1081.918] (-1081.574) (-1088.046) (-1081.863) -- 0:00:29
519500 -- [-1081.632] (-1082.324) (-1088.643) (-1086.076) * (-1082.874) [-1082.684] (-1085.400) (-1085.837) -- 0:00:29
520000 -- [-1081.538] (-1081.285) (-1082.743) (-1082.257) * (-1082.785) (-1081.810) [-1084.541] (-1085.972) -- 0:00:29
Average standard deviation of split frequencies: 0.010492
520500 -- (-1081.106) (-1082.195) (-1083.073) [-1084.490] * (-1083.628) (-1086.227) (-1084.464) [-1085.491] -- 0:00:29
521000 -- (-1082.160) (-1082.104) (-1080.708) [-1086.909] * [-1083.707] (-1081.445) (-1083.030) (-1085.186) -- 0:00:29
521500 -- (-1081.511) [-1081.979] (-1083.292) (-1084.603) * [-1084.207] (-1080.832) (-1087.047) (-1083.247) -- 0:00:29
522000 -- (-1087.142) (-1086.057) [-1081.789] (-1082.057) * (-1084.384) (-1084.344) [-1081.756] (-1081.852) -- 0:00:29
522500 -- (-1083.056) (-1085.010) (-1083.278) [-1082.136] * (-1082.854) [-1080.779] (-1083.984) (-1083.995) -- 0:00:29
523000 -- (-1082.678) [-1083.707] (-1084.397) (-1088.712) * (-1083.526) [-1083.649] (-1081.069) (-1084.035) -- 0:00:29
523500 -- (-1088.202) [-1081.242] (-1084.150) (-1087.726) * (-1083.269) [-1082.954] (-1082.323) (-1083.232) -- 0:00:29
524000 -- (-1081.721) [-1082.846] (-1083.174) (-1080.985) * [-1083.580] (-1082.205) (-1082.162) (-1082.521) -- 0:00:29
524500 -- (-1087.019) (-1081.037) (-1082.943) [-1085.079] * (-1082.268) [-1081.447] (-1082.532) (-1083.676) -- 0:00:29
525000 -- (-1084.221) (-1082.204) (-1083.413) [-1083.611] * (-1084.454) (-1081.788) [-1082.305] (-1084.656) -- 0:00:28
Average standard deviation of split frequencies: 0.010333
525500 -- (-1084.837) (-1084.472) (-1082.962) [-1088.440] * [-1081.287] (-1083.455) (-1084.919) (-1090.314) -- 0:00:28
526000 -- (-1084.534) (-1084.366) [-1081.411] (-1083.301) * [-1082.807] (-1082.868) (-1082.489) (-1083.950) -- 0:00:28
526500 -- (-1082.686) (-1084.964) (-1084.370) [-1082.359] * [-1082.282] (-1082.964) (-1081.951) (-1084.716) -- 0:00:28
527000 -- (-1082.220) [-1082.147] (-1085.245) (-1081.962) * (-1083.829) (-1088.129) [-1081.596] (-1083.984) -- 0:00:28
527500 -- [-1081.222] (-1082.155) (-1082.450) (-1081.329) * (-1086.702) (-1081.675) [-1081.455] (-1087.629) -- 0:00:28
528000 -- (-1080.835) [-1081.655] (-1085.814) (-1087.599) * (-1089.476) (-1082.714) (-1083.412) [-1082.895] -- 0:00:28
528500 -- [-1082.828] (-1083.253) (-1084.632) (-1082.829) * (-1087.205) [-1083.161] (-1084.081) (-1084.003) -- 0:00:28
529000 -- (-1083.942) (-1085.082) (-1084.501) [-1083.411] * (-1084.313) (-1084.542) (-1081.356) [-1082.303] -- 0:00:28
529500 -- (-1088.304) (-1082.057) (-1088.224) [-1083.719] * [-1082.073] (-1082.321) (-1082.396) (-1083.394) -- 0:00:28
530000 -- (-1085.713) (-1082.676) (-1085.033) [-1086.365] * [-1082.646] (-1082.597) (-1086.824) (-1081.790) -- 0:00:28
Average standard deviation of split frequencies: 0.010399
530500 -- (-1082.856) (-1083.227) (-1086.260) [-1084.088] * (-1081.842) (-1081.583) (-1084.105) [-1084.185] -- 0:00:28
531000 -- [-1082.658] (-1081.071) (-1084.981) (-1083.171) * [-1081.779] (-1082.171) (-1082.541) (-1084.053) -- 0:00:28
531500 -- (-1082.954) [-1081.614] (-1084.568) (-1082.412) * (-1084.668) (-1081.697) (-1081.243) [-1083.832] -- 0:00:28
532000 -- (-1085.883) (-1082.046) (-1084.020) [-1081.798] * (-1083.428) [-1082.988] (-1084.493) (-1081.417) -- 0:00:28
532500 -- [-1083.006] (-1082.491) (-1084.494) (-1081.835) * (-1081.517) (-1082.645) [-1084.788] (-1081.882) -- 0:00:28
533000 -- (-1084.909) [-1081.896] (-1085.196) (-1081.074) * (-1081.493) (-1085.815) (-1082.093) [-1083.249] -- 0:00:28
533500 -- [-1086.040] (-1084.203) (-1084.928) (-1082.912) * (-1082.361) [-1083.505] (-1083.477) (-1084.011) -- 0:00:28
534000 -- (-1083.469) (-1082.965) (-1082.915) [-1083.123] * (-1083.899) (-1084.366) (-1084.551) [-1080.729] -- 0:00:28
534500 -- (-1082.982) (-1084.668) (-1095.894) [-1085.222] * (-1081.683) (-1085.022) [-1083.390] (-1082.156) -- 0:00:28
535000 -- (-1082.297) [-1082.008] (-1084.350) (-1083.273) * (-1082.674) (-1083.848) [-1081.326] (-1082.559) -- 0:00:28
Average standard deviation of split frequencies: 0.010709
535500 -- [-1081.283] (-1083.589) (-1085.745) (-1085.619) * (-1081.512) (-1086.731) (-1082.103) [-1081.797] -- 0:00:28
536000 -- (-1082.871) (-1083.184) (-1086.186) [-1083.174] * [-1082.285] (-1082.321) (-1083.054) (-1088.982) -- 0:00:28
536500 -- [-1084.036] (-1081.775) (-1083.010) (-1081.624) * (-1081.729) (-1084.966) [-1081.388] (-1084.370) -- 0:00:28
537000 -- (-1082.637) [-1083.443] (-1083.126) (-1084.635) * (-1082.165) (-1082.953) (-1082.873) [-1085.097] -- 0:00:28
537500 -- (-1081.384) [-1081.738] (-1082.311) (-1084.980) * (-1085.481) (-1083.451) [-1082.295] (-1085.618) -- 0:00:28
538000 -- (-1083.883) [-1081.283] (-1081.905) (-1082.852) * (-1088.739) (-1083.569) (-1082.694) [-1087.423] -- 0:00:28
538500 -- (-1081.339) (-1082.884) (-1084.596) [-1083.103] * (-1083.556) (-1088.739) (-1082.444) [-1084.260] -- 0:00:28
539000 -- [-1081.499] (-1081.614) (-1083.792) (-1086.271) * (-1083.079) [-1082.075] (-1081.310) (-1084.576) -- 0:00:28
539500 -- (-1080.949) (-1084.176) [-1082.795] (-1084.742) * (-1082.492) (-1083.747) (-1085.409) [-1080.718] -- 0:00:28
540000 -- (-1082.836) (-1085.422) [-1081.382] (-1083.522) * (-1082.004) (-1083.130) (-1083.790) [-1081.249] -- 0:00:28
Average standard deviation of split frequencies: 0.010802
540500 -- (-1084.063) (-1081.229) [-1082.130] (-1082.194) * (-1085.700) (-1084.083) (-1082.330) [-1082.920] -- 0:00:28
541000 -- (-1082.877) (-1081.132) [-1081.857] (-1084.039) * (-1082.485) (-1082.790) [-1080.835] (-1082.302) -- 0:00:27
541500 -- (-1082.335) (-1083.178) [-1082.285] (-1084.825) * (-1081.781) (-1082.603) [-1083.503] (-1081.751) -- 0:00:27
542000 -- (-1083.222) (-1083.610) [-1082.856] (-1081.688) * (-1082.895) [-1080.992] (-1085.342) (-1082.186) -- 0:00:27
542500 -- (-1083.286) (-1082.783) [-1084.527] (-1083.259) * (-1081.530) (-1086.971) [-1081.934] (-1083.583) -- 0:00:27
543000 -- [-1081.216] (-1082.494) (-1087.449) (-1083.340) * (-1082.009) [-1083.705] (-1081.877) (-1084.395) -- 0:00:27
543500 -- (-1083.391) (-1083.103) (-1083.767) [-1084.548] * [-1081.316] (-1081.659) (-1085.025) (-1081.787) -- 0:00:27
544000 -- (-1083.157) [-1081.943] (-1084.709) (-1082.803) * (-1083.866) [-1081.686] (-1086.172) (-1081.957) -- 0:00:27
544500 -- (-1082.950) [-1082.208] (-1083.137) (-1085.233) * (-1084.336) (-1081.740) (-1083.129) [-1081.943] -- 0:00:27
545000 -- [-1082.836] (-1082.023) (-1081.597) (-1084.991) * (-1083.402) (-1082.148) (-1084.503) [-1084.204] -- 0:00:27
Average standard deviation of split frequencies: 0.010614
545500 -- (-1082.684) [-1081.828] (-1084.684) (-1081.524) * (-1083.317) [-1081.863] (-1085.901) (-1084.996) -- 0:00:27
546000 -- (-1082.307) (-1081.586) (-1084.667) [-1081.272] * [-1081.178] (-1082.658) (-1082.296) (-1081.518) -- 0:00:27
546500 -- (-1085.090) (-1081.416) [-1082.389] (-1081.589) * (-1082.698) (-1082.823) [-1084.018] (-1082.034) -- 0:00:27
547000 -- (-1092.428) (-1080.987) (-1085.526) [-1081.137] * (-1081.229) (-1082.634) [-1086.898] (-1083.090) -- 0:00:27
547500 -- [-1086.420] (-1083.385) (-1082.856) (-1081.248) * [-1081.451] (-1083.831) (-1082.727) (-1081.907) -- 0:00:27
548000 -- (-1083.088) (-1081.456) (-1083.857) [-1082.896] * [-1082.104] (-1084.112) (-1084.102) (-1082.740) -- 0:00:27
548500 -- (-1083.912) [-1082.135] (-1085.141) (-1081.814) * (-1084.592) (-1084.326) [-1081.543] (-1090.516) -- 0:00:27
549000 -- [-1082.476] (-1083.241) (-1083.546) (-1081.074) * (-1082.454) (-1085.616) (-1083.862) [-1083.257] -- 0:00:27
549500 -- (-1081.066) (-1081.981) (-1083.546) [-1082.101] * [-1082.850] (-1081.499) (-1081.251) (-1082.320) -- 0:00:27
550000 -- (-1082.790) (-1086.764) [-1082.920] (-1081.288) * (-1082.469) (-1081.758) [-1085.448] (-1082.599) -- 0:00:27
Average standard deviation of split frequencies: 0.010827
550500 -- (-1082.122) (-1081.055) (-1086.023) [-1081.481] * (-1081.792) (-1083.396) (-1086.158) [-1084.641] -- 0:00:27
551000 -- (-1083.708) (-1084.582) [-1085.675] (-1082.680) * (-1083.559) [-1083.715] (-1082.756) (-1083.921) -- 0:00:27
551500 -- (-1081.495) (-1088.820) [-1087.694] (-1086.981) * (-1082.054) [-1083.002] (-1082.821) (-1082.474) -- 0:00:27
552000 -- (-1084.068) [-1084.468] (-1082.240) (-1082.655) * (-1083.520) (-1084.498) (-1082.858) [-1082.176] -- 0:00:27
552500 -- (-1083.370) (-1087.192) (-1084.430) [-1083.081] * [-1087.692] (-1083.053) (-1081.429) (-1081.589) -- 0:00:27
553000 -- (-1083.396) [-1085.305] (-1083.188) (-1084.666) * (-1085.278) [-1081.798] (-1081.746) (-1083.697) -- 0:00:27
553500 -- (-1087.342) (-1082.020) (-1082.660) [-1085.982] * (-1085.283) (-1086.253) [-1082.236] (-1081.826) -- 0:00:27
554000 -- [-1081.731] (-1085.850) (-1083.690) (-1083.733) * (-1084.462) [-1082.940] (-1082.340) (-1083.049) -- 0:00:27
554500 -- (-1084.308) (-1083.558) [-1083.952] (-1083.783) * (-1087.467) (-1083.016) [-1083.937] (-1086.107) -- 0:00:27
555000 -- (-1081.855) [-1084.014] (-1083.260) (-1084.402) * (-1081.805) (-1084.261) (-1084.248) [-1082.593] -- 0:00:27
Average standard deviation of split frequencies: 0.010374
555500 -- [-1083.495] (-1083.274) (-1082.752) (-1083.011) * (-1084.202) (-1082.817) (-1082.626) [-1082.523] -- 0:00:27
556000 -- (-1083.305) (-1084.770) [-1084.829] (-1084.684) * (-1083.551) [-1082.878] (-1082.565) (-1083.503) -- 0:00:27
556500 -- [-1083.599] (-1083.045) (-1084.588) (-1083.986) * (-1081.344) (-1083.672) [-1084.026] (-1081.646) -- 0:00:27
557000 -- (-1082.759) [-1084.143] (-1088.126) (-1083.066) * [-1083.909] (-1088.251) (-1082.306) (-1083.078) -- 0:00:27
557500 -- (-1081.456) (-1084.780) [-1084.379] (-1083.715) * (-1086.667) [-1087.108] (-1083.033) (-1085.865) -- 0:00:26
558000 -- [-1081.915] (-1088.095) (-1086.528) (-1085.679) * (-1082.768) [-1083.020] (-1081.479) (-1083.988) -- 0:00:26
558500 -- (-1083.885) (-1083.882) (-1091.641) [-1081.358] * [-1085.211] (-1081.433) (-1082.361) (-1083.159) -- 0:00:26
559000 -- [-1082.471] (-1082.008) (-1084.831) (-1085.758) * (-1081.969) (-1081.552) [-1083.325] (-1083.330) -- 0:00:26
559500 -- (-1082.711) [-1082.818] (-1084.146) (-1083.170) * (-1083.768) (-1081.392) (-1083.220) [-1081.404] -- 0:00:26
560000 -- [-1083.917] (-1081.430) (-1083.508) (-1081.765) * (-1085.951) [-1082.476] (-1082.690) (-1081.490) -- 0:00:26
Average standard deviation of split frequencies: 0.009743
560500 -- (-1083.847) [-1081.060] (-1084.044) (-1085.090) * (-1083.953) (-1082.996) [-1083.712] (-1083.572) -- 0:00:26
561000 -- (-1081.763) [-1081.235] (-1083.092) (-1085.066) * (-1083.231) [-1082.394] (-1084.997) (-1087.100) -- 0:00:26
561500 -- (-1082.045) (-1081.272) (-1083.265) [-1081.697] * (-1083.488) (-1081.756) (-1083.813) [-1087.072] -- 0:00:26
562000 -- [-1083.862] (-1082.811) (-1082.510) (-1084.489) * (-1082.343) (-1083.981) [-1082.872] (-1082.198) -- 0:00:26
562500 -- (-1084.888) [-1081.946] (-1084.841) (-1084.283) * [-1082.429] (-1081.657) (-1084.424) (-1082.877) -- 0:00:26
563000 -- [-1083.390] (-1083.059) (-1084.344) (-1082.729) * (-1084.503) (-1082.786) [-1082.408] (-1081.609) -- 0:00:26
563500 -- [-1082.354] (-1082.949) (-1082.299) (-1081.291) * [-1082.106] (-1082.517) (-1084.524) (-1089.391) -- 0:00:26
564000 -- (-1083.364) (-1083.588) [-1083.925] (-1081.340) * [-1083.369] (-1085.531) (-1084.504) (-1082.106) -- 0:00:26
564500 -- [-1082.162] (-1084.532) (-1084.710) (-1084.741) * (-1082.134) [-1084.617] (-1084.546) (-1082.439) -- 0:00:26
565000 -- [-1083.215] (-1088.199) (-1082.181) (-1086.569) * (-1082.024) [-1083.290] (-1082.488) (-1085.445) -- 0:00:26
Average standard deviation of split frequencies: 0.009994
565500 -- (-1083.114) (-1086.520) [-1082.243] (-1082.192) * [-1084.222] (-1084.023) (-1082.898) (-1086.251) -- 0:00:26
566000 -- (-1082.351) [-1083.358] (-1083.567) (-1084.732) * (-1085.469) [-1083.979] (-1082.151) (-1081.141) -- 0:00:26
566500 -- (-1082.253) (-1081.934) (-1086.620) [-1084.026] * [-1082.203] (-1081.930) (-1081.541) (-1084.787) -- 0:00:26
567000 -- (-1084.283) (-1083.964) [-1082.025] (-1086.913) * [-1082.491] (-1081.704) (-1082.113) (-1084.435) -- 0:00:26
567500 -- (-1083.232) (-1083.076) (-1081.642) [-1082.139] * (-1081.835) (-1083.386) (-1083.086) [-1083.817] -- 0:00:26
568000 -- [-1083.045] (-1083.356) (-1082.324) (-1082.057) * (-1081.912) (-1082.789) (-1082.877) [-1085.437] -- 0:00:26
568500 -- (-1085.004) (-1081.537) (-1082.352) [-1081.817] * (-1086.633) (-1082.078) [-1081.971] (-1082.030) -- 0:00:26
569000 -- (-1088.147) (-1081.892) [-1083.165] (-1081.298) * (-1083.670) (-1082.092) (-1086.326) [-1082.073] -- 0:00:26
569500 -- (-1081.829) (-1081.974) (-1082.440) [-1081.073] * [-1084.744] (-1083.557) (-1084.321) (-1087.727) -- 0:00:26
570000 -- (-1081.916) [-1082.072] (-1082.668) (-1088.142) * [-1082.870] (-1081.282) (-1082.323) (-1083.419) -- 0:00:26
Average standard deviation of split frequencies: 0.009864
570500 -- (-1084.966) [-1082.377] (-1082.785) (-1081.769) * (-1082.408) [-1082.285] (-1084.956) (-1081.150) -- 0:00:26
571000 -- (-1081.429) [-1082.364] (-1083.743) (-1084.206) * (-1084.433) (-1081.804) (-1086.534) [-1081.920] -- 0:00:26
571500 -- (-1081.425) [-1082.067] (-1081.785) (-1086.556) * [-1085.715] (-1081.416) (-1081.956) (-1082.635) -- 0:00:26
572000 -- [-1081.902] (-1082.652) (-1087.599) (-1082.118) * (-1086.222) [-1085.409] (-1081.999) (-1082.780) -- 0:00:26
572500 -- [-1081.977] (-1083.419) (-1086.929) (-1083.949) * (-1082.568) (-1082.606) [-1083.453] (-1087.289) -- 0:00:26
573000 -- (-1081.165) (-1082.713) [-1082.322] (-1083.945) * [-1081.557] (-1086.374) (-1086.025) (-1084.105) -- 0:00:26
573500 -- (-1082.903) [-1082.027] (-1084.594) (-1084.488) * [-1081.192] (-1083.711) (-1084.062) (-1086.186) -- 0:00:26
574000 -- (-1082.209) (-1083.031) (-1081.315) [-1088.268] * (-1084.946) (-1084.389) (-1083.620) [-1082.235] -- 0:00:25
574500 -- [-1082.807] (-1081.890) (-1083.300) (-1086.713) * (-1086.389) [-1081.675] (-1083.224) (-1081.637) -- 0:00:25
575000 -- (-1082.464) (-1081.896) (-1083.957) [-1082.002] * (-1085.314) (-1085.721) [-1084.259] (-1082.114) -- 0:00:25
Average standard deviation of split frequencies: 0.009628
575500 -- (-1080.814) (-1081.557) [-1081.699] (-1084.809) * (-1082.194) (-1090.522) (-1086.550) [-1081.581] -- 0:00:25
576000 -- (-1083.042) [-1082.373] (-1082.493) (-1084.001) * [-1082.681] (-1082.716) (-1083.486) (-1084.213) -- 0:00:25
576500 -- [-1088.031] (-1085.245) (-1082.505) (-1087.792) * [-1082.595] (-1084.158) (-1082.728) (-1084.173) -- 0:00:25
577000 -- (-1084.487) (-1085.176) (-1085.811) [-1083.005] * (-1081.652) [-1083.368] (-1086.677) (-1085.758) -- 0:00:25
577500 -- (-1083.715) (-1085.049) (-1081.361) [-1081.281] * (-1081.741) (-1081.255) [-1082.891] (-1083.050) -- 0:00:25
578000 -- (-1085.844) (-1080.974) (-1082.516) [-1081.749] * (-1082.824) (-1082.025) [-1080.916] (-1083.292) -- 0:00:25
578500 -- (-1085.811) [-1081.284] (-1084.074) (-1083.519) * [-1082.162] (-1084.564) (-1081.516) (-1082.996) -- 0:00:25
579000 -- (-1084.308) (-1083.037) (-1082.422) [-1083.471] * (-1085.076) (-1085.406) [-1085.055] (-1083.508) -- 0:00:25
579500 -- (-1083.744) (-1085.388) [-1084.902] (-1082.225) * (-1082.944) (-1082.976) [-1085.054] (-1085.202) -- 0:00:25
580000 -- [-1085.876] (-1082.605) (-1086.240) (-1083.259) * [-1082.701] (-1081.907) (-1082.661) (-1084.910) -- 0:00:25
Average standard deviation of split frequencies: 0.009169
580500 -- (-1085.406) (-1082.021) (-1091.619) [-1084.947] * (-1083.212) [-1085.628] (-1085.301) (-1084.471) -- 0:00:25
581000 -- (-1086.864) (-1084.637) [-1082.899] (-1082.884) * (-1085.033) [-1084.344] (-1085.735) (-1082.343) -- 0:00:25
581500 -- [-1086.694] (-1083.010) (-1083.262) (-1083.785) * [-1081.091] (-1086.055) (-1085.446) (-1084.358) -- 0:00:25
582000 -- (-1084.118) (-1084.138) [-1085.209] (-1084.662) * (-1084.412) (-1082.521) [-1086.368] (-1083.713) -- 0:00:25
582500 -- [-1085.106] (-1081.958) (-1083.388) (-1082.115) * (-1084.950) [-1084.898] (-1082.867) (-1085.588) -- 0:00:25
583000 -- [-1082.126] (-1081.071) (-1081.835) (-1083.471) * [-1086.775] (-1083.215) (-1081.867) (-1087.977) -- 0:00:25
583500 -- [-1084.521] (-1080.772) (-1081.670) (-1080.597) * (-1090.234) (-1083.039) [-1084.644] (-1086.061) -- 0:00:25
584000 -- [-1083.917] (-1081.515) (-1086.096) (-1083.766) * (-1083.796) (-1082.056) [-1083.206] (-1081.411) -- 0:00:25
584500 -- [-1082.335] (-1082.741) (-1086.815) (-1085.020) * (-1083.024) [-1082.800] (-1086.728) (-1082.436) -- 0:00:25
585000 -- (-1082.018) (-1082.393) (-1082.385) [-1083.430] * (-1082.836) (-1084.418) (-1082.917) [-1082.479] -- 0:00:25
Average standard deviation of split frequencies: 0.009206
585500 -- (-1082.458) (-1084.390) (-1083.609) [-1081.582] * [-1082.879] (-1084.126) (-1082.257) (-1081.236) -- 0:00:25
586000 -- (-1081.823) (-1082.772) (-1080.835) [-1084.388] * (-1083.851) [-1086.046] (-1083.134) (-1081.245) -- 0:00:25
586500 -- (-1084.205) (-1081.684) [-1080.978] (-1082.210) * (-1082.817) (-1085.058) [-1085.960] (-1085.914) -- 0:00:25
587000 -- (-1082.063) [-1081.058] (-1083.672) (-1082.422) * [-1081.025] (-1086.013) (-1086.270) (-1081.624) -- 0:00:25
587500 -- (-1082.522) [-1081.507] (-1082.091) (-1082.245) * (-1082.385) [-1084.456] (-1083.514) (-1087.777) -- 0:00:25
588000 -- (-1082.991) (-1084.381) [-1084.281] (-1081.238) * [-1085.761] (-1080.821) (-1081.411) (-1084.183) -- 0:00:25
588500 -- (-1087.118) (-1084.760) [-1086.065] (-1083.772) * (-1084.406) (-1081.736) (-1082.673) [-1082.024] -- 0:00:25
589000 -- (-1086.383) (-1081.782) (-1083.231) [-1081.821] * [-1081.660] (-1082.061) (-1084.784) (-1083.608) -- 0:00:25
589500 -- (-1085.720) (-1081.624) [-1080.873] (-1085.887) * (-1083.302) [-1081.451] (-1081.086) (-1085.582) -- 0:00:25
590000 -- (-1081.928) (-1086.944) [-1081.466] (-1082.825) * (-1083.420) (-1083.816) (-1083.915) [-1081.418] -- 0:00:25
Average standard deviation of split frequencies: 0.009444
590500 -- (-1083.654) (-1085.984) (-1083.895) [-1082.935] * (-1082.063) [-1085.503] (-1082.726) (-1087.197) -- 0:00:24
591000 -- (-1083.838) (-1086.898) [-1082.202] (-1082.375) * [-1081.798] (-1087.946) (-1083.609) (-1089.076) -- 0:00:24
591500 -- (-1081.968) (-1089.279) (-1082.050) [-1082.184] * [-1082.315] (-1089.376) (-1087.641) (-1084.658) -- 0:00:24
592000 -- (-1083.202) (-1084.453) (-1081.030) [-1082.153] * (-1081.803) [-1082.017] (-1087.777) (-1082.139) -- 0:00:24
592500 -- (-1082.837) (-1081.598) (-1080.891) [-1082.798] * (-1082.351) (-1084.943) [-1084.665] (-1082.518) -- 0:00:24
593000 -- (-1081.672) (-1084.225) (-1082.321) [-1083.590] * (-1081.864) [-1081.882] (-1086.752) (-1082.482) -- 0:00:24
593500 -- (-1082.458) [-1083.328] (-1083.460) (-1087.168) * (-1081.011) [-1081.711] (-1081.131) (-1082.817) -- 0:00:24
594000 -- [-1082.908] (-1086.473) (-1081.088) (-1083.313) * (-1088.898) (-1084.473) [-1082.161] (-1083.148) -- 0:00:24
594500 -- [-1084.062] (-1093.153) (-1082.441) (-1083.199) * [-1087.950] (-1081.900) (-1081.869) (-1081.773) -- 0:00:24
595000 -- [-1082.628] (-1082.170) (-1081.339) (-1082.766) * (-1087.473) (-1081.713) (-1082.923) [-1081.750] -- 0:00:24
Average standard deviation of split frequencies: 0.009843
595500 -- (-1083.816) (-1083.102) (-1085.805) [-1081.839] * [-1084.543] (-1082.942) (-1084.414) (-1086.691) -- 0:00:24
596000 -- (-1083.185) (-1082.135) [-1082.059] (-1085.839) * [-1081.470] (-1088.173) (-1085.945) (-1085.462) -- 0:00:24
596500 -- (-1081.041) (-1085.104) (-1085.069) [-1084.376] * [-1082.504] (-1085.442) (-1081.308) (-1083.057) -- 0:00:24
597000 -- (-1081.788) [-1083.241] (-1083.312) (-1086.476) * (-1082.043) (-1081.764) [-1081.215] (-1082.512) -- 0:00:24
597500 -- [-1084.068] (-1081.529) (-1083.050) (-1080.963) * (-1085.788) (-1083.772) (-1080.925) [-1083.062] -- 0:00:24
598000 -- (-1081.431) (-1083.603) [-1081.786] (-1081.590) * [-1084.076] (-1083.922) (-1082.216) (-1082.162) -- 0:00:24
598500 -- (-1082.291) [-1081.197] (-1082.627) (-1080.883) * (-1083.311) (-1083.566) (-1082.655) [-1084.969] -- 0:00:24
599000 -- [-1083.685] (-1082.073) (-1083.599) (-1084.291) * (-1084.000) [-1083.260] (-1082.784) (-1083.714) -- 0:00:24
599500 -- (-1082.290) (-1082.079) [-1082.041] (-1083.327) * [-1084.464] (-1082.982) (-1082.340) (-1085.864) -- 0:00:24
600000 -- (-1084.000) [-1081.874] (-1085.908) (-1083.833) * (-1091.221) [-1082.013] (-1085.321) (-1086.668) -- 0:00:24
Average standard deviation of split frequencies: 0.010333
600500 -- (-1082.182) (-1082.839) [-1083.652] (-1083.960) * (-1085.440) (-1082.297) [-1082.309] (-1083.020) -- 0:00:24
601000 -- (-1083.755) (-1082.364) [-1083.751] (-1084.505) * (-1081.284) (-1082.023) [-1081.910] (-1084.186) -- 0:00:24
601500 -- [-1082.598] (-1083.024) (-1083.336) (-1083.274) * (-1084.779) (-1083.278) (-1083.023) [-1082.720] -- 0:00:24
602000 -- (-1087.182) [-1083.034] (-1082.783) (-1084.791) * (-1083.278) [-1082.627] (-1083.555) (-1082.965) -- 0:00:24
602500 -- (-1085.895) [-1085.518] (-1089.180) (-1083.140) * (-1083.156) [-1082.611] (-1084.327) (-1083.655) -- 0:00:24
603000 -- (-1085.614) [-1082.137] (-1085.755) (-1085.483) * (-1084.605) (-1082.736) (-1085.291) [-1085.503] -- 0:00:24
603500 -- (-1082.818) (-1083.818) (-1082.922) [-1082.883] * (-1082.785) (-1082.905) [-1086.178] (-1083.847) -- 0:00:24
604000 -- (-1083.656) [-1082.234] (-1081.243) (-1082.733) * (-1089.166) [-1083.145] (-1084.964) (-1082.706) -- 0:00:24
604500 -- (-1082.018) (-1086.593) [-1083.538] (-1082.494) * (-1084.046) [-1081.980] (-1082.242) (-1083.155) -- 0:00:24
605000 -- [-1085.239] (-1085.843) (-1084.181) (-1082.195) * (-1082.220) (-1083.293) [-1087.558] (-1082.118) -- 0:00:24
Average standard deviation of split frequencies: 0.009594
605500 -- [-1082.865] (-1085.746) (-1081.617) (-1083.789) * (-1083.898) (-1083.591) [-1081.989] (-1081.586) -- 0:00:24
606000 -- (-1083.434) (-1083.475) [-1082.949] (-1086.443) * (-1082.568) (-1083.340) (-1083.096) [-1082.403] -- 0:00:24
606500 -- (-1088.747) (-1083.653) [-1081.951] (-1087.438) * (-1083.123) (-1084.753) (-1088.762) [-1081.504] -- 0:00:24
607000 -- [-1083.651] (-1083.628) (-1081.612) (-1084.856) * (-1086.152) [-1083.336] (-1082.652) (-1082.696) -- 0:00:23
607500 -- (-1083.604) (-1082.902) (-1080.705) [-1082.038] * (-1085.993) (-1082.340) (-1080.784) [-1081.684] -- 0:00:23
608000 -- [-1083.702] (-1082.678) (-1084.780) (-1083.487) * [-1082.390] (-1080.844) (-1082.585) (-1082.607) -- 0:00:23
608500 -- (-1083.514) (-1086.239) [-1082.404] (-1083.602) * (-1083.278) (-1081.994) (-1085.382) [-1083.731] -- 0:00:23
609000 -- (-1082.222) (-1081.269) [-1081.525] (-1083.901) * (-1081.663) (-1081.793) [-1083.985] (-1083.396) -- 0:00:23
609500 -- (-1082.060) [-1085.356] (-1081.187) (-1082.930) * (-1081.670) (-1083.757) (-1083.539) [-1082.261] -- 0:00:23
610000 -- (-1083.501) [-1083.436] (-1082.713) (-1086.489) * (-1082.767) (-1086.435) (-1086.195) [-1082.954] -- 0:00:23
Average standard deviation of split frequencies: 0.009821
610500 -- (-1083.480) [-1082.332] (-1086.973) (-1083.892) * [-1081.746] (-1082.997) (-1081.784) (-1083.755) -- 0:00:23
611000 -- [-1081.809] (-1082.935) (-1085.253) (-1083.270) * [-1083.649] (-1082.135) (-1084.215) (-1087.543) -- 0:00:23
611500 -- (-1082.087) (-1082.840) (-1083.434) [-1083.309] * (-1084.015) (-1086.291) (-1083.981) [-1083.552] -- 0:00:23
612000 -- (-1085.505) (-1081.478) (-1084.891) [-1081.460] * [-1084.431] (-1084.938) (-1085.311) (-1085.512) -- 0:00:23
612500 -- (-1082.758) (-1082.205) [-1085.483] (-1082.258) * (-1082.667) (-1082.819) (-1084.601) [-1082.207] -- 0:00:23
613000 -- [-1081.127] (-1080.761) (-1086.491) (-1081.454) * (-1082.677) (-1086.357) [-1081.859] (-1088.349) -- 0:00:23
613500 -- (-1084.519) [-1082.791] (-1086.273) (-1085.090) * (-1089.112) (-1085.123) (-1080.839) [-1087.766] -- 0:00:23
614000 -- (-1083.130) (-1082.286) (-1085.278) [-1084.088] * (-1082.857) (-1083.580) (-1084.286) [-1084.548] -- 0:00:23
614500 -- [-1085.918] (-1082.688) (-1085.076) (-1084.171) * (-1082.420) (-1083.685) (-1082.435) [-1082.744] -- 0:00:23
615000 -- (-1082.651) (-1083.459) [-1085.196] (-1084.625) * [-1081.256] (-1083.852) (-1081.998) (-1082.638) -- 0:00:23
Average standard deviation of split frequencies: 0.009821
615500 -- [-1082.341] (-1082.976) (-1082.385) (-1081.385) * [-1081.089] (-1083.280) (-1087.782) (-1081.991) -- 0:00:23
616000 -- (-1084.052) (-1083.571) [-1082.053] (-1084.628) * (-1081.981) (-1083.346) [-1085.016] (-1082.156) -- 0:00:23
616500 -- [-1083.078] (-1088.804) (-1086.862) (-1082.125) * (-1081.210) [-1082.825] (-1082.620) (-1083.067) -- 0:00:23
617000 -- (-1084.369) [-1083.340] (-1087.277) (-1082.152) * (-1087.911) (-1082.383) (-1082.391) [-1081.794] -- 0:00:23
617500 -- (-1084.408) (-1081.664) [-1081.715] (-1081.464) * [-1080.732] (-1083.950) (-1081.513) (-1083.986) -- 0:00:23
618000 -- (-1081.756) [-1081.497] (-1083.431) (-1081.556) * (-1082.246) (-1083.945) (-1081.350) [-1083.987] -- 0:00:23
618500 -- [-1086.360] (-1083.996) (-1082.450) (-1081.507) * (-1081.456) [-1081.358] (-1083.324) (-1083.231) -- 0:00:23
619000 -- [-1083.667] (-1083.107) (-1082.651) (-1081.326) * (-1080.706) (-1081.321) (-1086.818) [-1081.900] -- 0:00:23
619500 -- [-1082.523] (-1086.412) (-1082.171) (-1085.182) * (-1080.858) (-1083.078) [-1084.010] (-1081.513) -- 0:00:23
620000 -- [-1081.864] (-1082.536) (-1083.636) (-1082.285) * (-1085.537) (-1084.389) [-1083.225] (-1081.812) -- 0:00:23
Average standard deviation of split frequencies: 0.009831
620500 -- (-1084.798) (-1083.038) (-1085.434) [-1082.412] * [-1082.965] (-1081.951) (-1083.696) (-1084.765) -- 0:00:23
621000 -- (-1081.193) (-1081.992) [-1083.708] (-1084.581) * (-1083.109) [-1080.842] (-1082.378) (-1082.376) -- 0:00:23
621500 -- (-1082.509) (-1083.526) (-1084.181) [-1083.025] * [-1084.237] (-1082.242) (-1085.708) (-1083.696) -- 0:00:23
622000 -- [-1083.398] (-1083.859) (-1083.324) (-1081.262) * (-1082.392) (-1081.666) [-1085.316] (-1081.388) -- 0:00:23
622500 -- (-1082.023) (-1083.749) [-1081.713] (-1084.565) * (-1083.266) (-1082.347) [-1082.260] (-1082.000) -- 0:00:23
623000 -- (-1081.875) (-1081.599) [-1085.192] (-1084.630) * (-1082.087) (-1084.528) (-1083.791) [-1083.149] -- 0:00:22
623500 -- [-1083.119] (-1083.615) (-1082.394) (-1082.988) * (-1082.127) (-1086.224) [-1083.754] (-1083.395) -- 0:00:22
624000 -- (-1081.004) [-1087.202] (-1082.256) (-1081.613) * (-1081.440) [-1082.287] (-1083.351) (-1084.728) -- 0:00:22
624500 -- (-1081.867) (-1086.041) [-1081.842] (-1083.216) * (-1084.713) (-1081.101) (-1084.167) [-1090.041] -- 0:00:22
625000 -- (-1082.041) [-1081.801] (-1082.314) (-1081.753) * (-1081.755) [-1085.401] (-1083.472) (-1085.467) -- 0:00:22
Average standard deviation of split frequencies: 0.009831
625500 -- (-1082.546) [-1082.880] (-1084.111) (-1082.238) * (-1083.145) [-1083.895] (-1086.008) (-1081.320) -- 0:00:22
626000 -- (-1081.919) [-1082.082] (-1084.654) (-1087.574) * (-1085.763) (-1082.465) (-1083.218) [-1081.513] -- 0:00:22
626500 -- (-1081.656) (-1081.231) (-1086.123) [-1082.342] * (-1088.217) (-1082.326) (-1086.578) [-1082.801] -- 0:00:22
627000 -- [-1082.937] (-1080.976) (-1081.530) (-1083.800) * (-1082.644) (-1085.151) [-1082.551] (-1081.236) -- 0:00:22
627500 -- (-1085.150) [-1082.540] (-1085.392) (-1089.234) * (-1083.920) (-1082.764) (-1084.835) [-1081.333] -- 0:00:22
628000 -- (-1084.051) (-1085.502) (-1083.388) [-1081.325] * (-1083.707) [-1083.209] (-1081.772) (-1082.016) -- 0:00:22
628500 -- (-1084.804) (-1088.009) (-1084.912) [-1081.104] * [-1086.361] (-1081.101) (-1085.028) (-1083.708) -- 0:00:22
629000 -- (-1086.866) (-1082.565) [-1082.232] (-1081.654) * [-1085.317] (-1081.392) (-1086.651) (-1083.876) -- 0:00:22
629500 -- (-1091.129) (-1083.008) [-1081.701] (-1082.714) * (-1084.096) (-1081.821) (-1085.069) [-1082.564] -- 0:00:22
630000 -- (-1085.398) (-1082.277) [-1081.438] (-1084.480) * [-1083.451] (-1083.083) (-1084.595) (-1082.687) -- 0:00:22
Average standard deviation of split frequencies: 0.010755
630500 -- [-1081.798] (-1081.596) (-1082.339) (-1081.738) * [-1085.078] (-1083.805) (-1084.202) (-1082.403) -- 0:00:22
631000 -- [-1082.458] (-1081.520) (-1086.108) (-1082.864) * (-1086.133) (-1081.894) [-1081.646] (-1090.473) -- 0:00:22
631500 -- (-1082.448) [-1082.873] (-1087.725) (-1082.446) * (-1084.387) (-1084.421) (-1085.340) [-1087.997] -- 0:00:22
632000 -- (-1083.600) (-1083.087) [-1085.070] (-1082.743) * (-1081.494) (-1083.870) (-1081.928) [-1085.967] -- 0:00:22
632500 -- [-1084.924] (-1082.302) (-1082.095) (-1086.547) * (-1083.326) (-1082.215) [-1084.458] (-1094.503) -- 0:00:22
633000 -- (-1082.192) (-1082.434) (-1086.359) [-1082.310] * (-1084.227) (-1082.677) (-1083.826) [-1081.520] -- 0:00:22
633500 -- (-1085.144) [-1085.312] (-1084.032) (-1083.057) * (-1081.498) [-1083.265] (-1084.378) (-1083.587) -- 0:00:22
634000 -- [-1087.895] (-1082.379) (-1082.723) (-1081.823) * (-1082.344) [-1082.359] (-1084.291) (-1083.622) -- 0:00:22
634500 -- [-1081.147] (-1082.778) (-1083.653) (-1085.207) * (-1084.850) [-1081.942] (-1081.717) (-1085.434) -- 0:00:22
635000 -- [-1081.149] (-1082.315) (-1085.382) (-1083.855) * (-1087.814) (-1085.810) (-1081.768) [-1083.618] -- 0:00:22
Average standard deviation of split frequencies: 0.010542
635500 -- (-1083.250) (-1082.505) (-1081.126) [-1084.801] * (-1084.728) (-1081.634) [-1083.193] (-1082.274) -- 0:00:22
636000 -- (-1081.845) (-1082.884) (-1082.752) [-1083.290] * (-1082.609) (-1084.254) [-1083.025] (-1085.827) -- 0:00:22
636500 -- (-1081.106) [-1083.447] (-1082.693) (-1083.052) * (-1084.631) [-1082.617] (-1083.021) (-1086.903) -- 0:00:22
637000 -- (-1082.941) (-1088.479) (-1083.169) [-1082.022] * (-1082.376) [-1083.457] (-1084.549) (-1083.247) -- 0:00:22
637500 -- [-1081.111] (-1084.135) (-1082.763) (-1083.020) * (-1083.025) (-1082.193) [-1081.691] (-1083.466) -- 0:00:22
638000 -- (-1083.047) [-1089.826] (-1082.302) (-1086.472) * (-1084.784) [-1083.905] (-1082.020) (-1085.557) -- 0:00:22
638500 -- [-1084.270] (-1087.295) (-1081.371) (-1083.815) * (-1083.466) [-1082.189] (-1086.141) (-1082.056) -- 0:00:22
639000 -- [-1090.196] (-1081.253) (-1081.076) (-1082.805) * (-1083.671) [-1083.846] (-1082.162) (-1081.947) -- 0:00:22
639500 -- [-1083.094] (-1081.315) (-1082.601) (-1081.521) * (-1083.108) (-1082.996) [-1084.406] (-1082.638) -- 0:00:21
640000 -- (-1081.738) (-1089.590) [-1081.349] (-1081.670) * [-1082.494] (-1080.828) (-1084.401) (-1083.238) -- 0:00:21
Average standard deviation of split frequencies: 0.010587
640500 -- [-1082.519] (-1088.967) (-1084.289) (-1080.698) * (-1082.262) [-1080.891] (-1085.467) (-1083.269) -- 0:00:21
641000 -- (-1082.247) (-1082.636) [-1083.368] (-1083.349) * [-1082.166] (-1085.938) (-1083.247) (-1081.368) -- 0:00:21
641500 -- (-1081.677) (-1084.885) (-1086.142) [-1081.579] * (-1085.588) (-1086.775) (-1082.816) [-1081.618] -- 0:00:21
642000 -- (-1083.889) (-1083.963) (-1081.567) [-1081.566] * (-1083.602) [-1082.659] (-1081.478) (-1082.411) -- 0:00:21
642500 -- (-1085.420) [-1084.149] (-1084.497) (-1081.747) * (-1083.065) (-1084.023) (-1082.669) [-1082.425] -- 0:00:21
643000 -- [-1084.231] (-1083.098) (-1080.842) (-1083.976) * (-1082.821) (-1082.805) [-1081.460] (-1083.002) -- 0:00:21
643500 -- (-1082.679) [-1083.025] (-1081.127) (-1082.818) * (-1082.616) (-1081.547) [-1083.211] (-1083.072) -- 0:00:21
644000 -- (-1082.304) [-1084.843] (-1081.500) (-1085.645) * (-1083.299) (-1084.959) (-1083.296) [-1084.805] -- 0:00:21
644500 -- [-1081.428] (-1083.061) (-1082.149) (-1081.310) * (-1087.737) [-1084.069] (-1092.029) (-1086.503) -- 0:00:21
645000 -- [-1082.542] (-1082.595) (-1086.027) (-1091.403) * (-1085.255) [-1083.579] (-1084.155) (-1083.234) -- 0:00:21
Average standard deviation of split frequencies: 0.010865
645500 -- [-1082.990] (-1092.580) (-1083.577) (-1084.774) * [-1082.798] (-1082.753) (-1081.536) (-1083.720) -- 0:00:21
646000 -- [-1084.096] (-1083.276) (-1081.678) (-1085.120) * [-1081.973] (-1082.958) (-1082.777) (-1084.107) -- 0:00:21
646500 -- [-1085.886] (-1084.129) (-1083.319) (-1084.881) * (-1081.240) [-1082.539] (-1084.908) (-1082.433) -- 0:00:21
647000 -- [-1082.455] (-1085.214) (-1086.887) (-1083.623) * (-1081.239) (-1083.107) (-1085.437) [-1082.797] -- 0:00:21
647500 -- [-1085.076] (-1084.781) (-1088.571) (-1083.637) * (-1081.113) (-1083.753) (-1082.776) [-1084.865] -- 0:00:21
648000 -- [-1083.271] (-1084.473) (-1081.806) (-1084.268) * (-1081.758) (-1086.307) [-1081.764] (-1083.392) -- 0:00:21
648500 -- (-1081.934) (-1083.390) [-1081.205] (-1086.335) * (-1085.711) (-1084.044) [-1085.771] (-1087.510) -- 0:00:21
649000 -- (-1085.159) (-1083.698) [-1082.363] (-1088.038) * (-1084.037) [-1083.680] (-1083.164) (-1084.854) -- 0:00:21
649500 -- (-1083.648) (-1086.183) [-1081.626] (-1087.385) * (-1083.422) (-1084.898) (-1082.349) [-1086.803] -- 0:00:21
650000 -- (-1082.742) (-1083.069) [-1084.806] (-1084.024) * (-1081.645) (-1088.998) (-1082.785) [-1083.659] -- 0:00:21
Average standard deviation of split frequencies: 0.010827
650500 -- [-1083.116] (-1084.031) (-1085.332) (-1082.363) * (-1080.796) (-1083.230) [-1083.429] (-1084.174) -- 0:00:21
651000 -- [-1083.116] (-1085.263) (-1087.767) (-1084.234) * (-1081.236) (-1084.770) [-1082.512] (-1082.380) -- 0:00:21
651500 -- [-1084.290] (-1086.858) (-1082.075) (-1082.653) * (-1082.168) [-1081.567] (-1082.092) (-1082.267) -- 0:00:21
652000 -- (-1081.881) (-1088.401) (-1083.488) [-1083.311] * (-1083.278) [-1085.324] (-1083.501) (-1086.933) -- 0:00:21
652500 -- (-1081.880) (-1084.226) [-1081.953] (-1082.511) * (-1082.189) [-1085.111] (-1083.394) (-1081.634) -- 0:00:21
653000 -- (-1080.910) (-1083.102) (-1082.425) [-1081.537] * (-1082.217) (-1085.634) (-1083.783) [-1081.546] -- 0:00:21
653500 -- (-1083.979) (-1083.352) (-1081.709) [-1084.386] * (-1082.963) (-1086.243) [-1085.772] (-1084.610) -- 0:00:21
654000 -- [-1084.081] (-1083.397) (-1083.129) (-1083.122) * [-1083.757] (-1085.140) (-1082.172) (-1082.499) -- 0:00:21
654500 -- [-1083.029] (-1081.620) (-1082.262) (-1081.951) * (-1086.252) (-1081.727) (-1084.041) [-1082.130] -- 0:00:21
655000 -- [-1082.768] (-1083.010) (-1081.935) (-1081.863) * [-1082.909] (-1081.801) (-1082.014) (-1082.131) -- 0:00:21
Average standard deviation of split frequencies: 0.010939
655500 -- (-1084.562) (-1082.363) (-1084.128) [-1083.171] * (-1081.340) (-1082.692) [-1081.476] (-1082.151) -- 0:00:21
656000 -- (-1086.573) (-1081.787) [-1081.968] (-1084.596) * [-1081.309] (-1084.534) (-1085.211) (-1083.811) -- 0:00:20
656500 -- (-1083.101) (-1085.342) (-1081.246) [-1084.540] * (-1081.291) [-1083.153] (-1083.014) (-1083.083) -- 0:00:20
657000 -- (-1087.492) [-1082.632] (-1083.681) (-1083.796) * (-1085.454) [-1084.367] (-1089.201) (-1086.704) -- 0:00:20
657500 -- (-1085.468) (-1086.178) [-1081.207] (-1082.919) * (-1083.081) [-1084.237] (-1083.046) (-1083.289) -- 0:00:20
658000 -- (-1086.500) (-1082.185) [-1082.952] (-1087.120) * (-1081.175) (-1082.884) [-1081.619] (-1081.585) -- 0:00:20
658500 -- (-1082.045) [-1087.210] (-1083.588) (-1084.741) * [-1084.443] (-1081.599) (-1082.319) (-1083.400) -- 0:00:20
659000 -- [-1081.120] (-1082.151) (-1085.285) (-1081.225) * (-1083.010) (-1082.353) [-1081.618] (-1085.456) -- 0:00:20
659500 -- (-1082.027) (-1086.070) [-1082.086] (-1082.511) * (-1081.113) [-1081.333] (-1082.721) (-1081.043) -- 0:00:20
660000 -- (-1082.799) (-1083.206) (-1084.358) [-1081.809] * [-1082.010] (-1081.807) (-1083.111) (-1081.811) -- 0:00:20
Average standard deviation of split frequencies: 0.010661
660500 -- (-1083.163) (-1084.085) (-1084.587) [-1081.953] * (-1081.304) (-1081.216) [-1082.868] (-1091.916) -- 0:00:20
661000 -- (-1085.463) (-1081.881) [-1084.429] (-1084.146) * (-1081.186) (-1084.429) (-1083.777) [-1082.141] -- 0:00:20
661500 -- [-1083.489] (-1086.396) (-1082.866) (-1080.956) * [-1081.251] (-1087.260) (-1083.107) (-1083.728) -- 0:00:20
662000 -- [-1081.778] (-1083.586) (-1081.475) (-1081.087) * [-1081.347] (-1083.617) (-1082.610) (-1082.273) -- 0:00:20
662500 -- (-1083.276) (-1084.142) (-1084.259) [-1081.439] * (-1083.995) (-1083.169) (-1083.891) [-1081.274] -- 0:00:20
663000 -- [-1083.314] (-1086.339) (-1085.560) (-1088.500) * (-1084.238) (-1082.551) (-1082.251) [-1083.630] -- 0:00:20
663500 -- (-1083.331) (-1082.848) (-1082.056) [-1083.237] * (-1083.713) [-1082.499] (-1084.714) (-1081.394) -- 0:00:20
664000 -- (-1083.698) (-1083.138) [-1081.970] (-1082.016) * (-1084.556) (-1083.697) [-1081.064] (-1082.520) -- 0:00:20
664500 -- (-1082.632) [-1084.173] (-1082.079) (-1085.091) * (-1082.038) (-1084.798) (-1086.696) [-1085.780] -- 0:00:20
665000 -- (-1085.555) [-1082.174] (-1083.408) (-1086.362) * (-1082.605) [-1082.982] (-1085.815) (-1083.435) -- 0:00:20
Average standard deviation of split frequencies: 0.010539
665500 -- (-1082.463) [-1085.164] (-1082.735) (-1083.428) * (-1081.422) [-1082.083] (-1082.909) (-1088.566) -- 0:00:20
666000 -- (-1083.335) (-1083.222) [-1082.495] (-1082.355) * (-1084.027) (-1084.155) [-1081.738] (-1085.405) -- 0:00:20
666500 -- (-1083.595) (-1082.651) [-1082.604] (-1085.302) * (-1083.239) (-1082.322) [-1083.137] (-1086.527) -- 0:00:20
667000 -- (-1083.569) [-1082.461] (-1082.641) (-1083.689) * (-1085.374) [-1083.309] (-1082.080) (-1087.660) -- 0:00:20
667500 -- (-1083.048) (-1082.235) [-1081.359] (-1083.480) * [-1081.852] (-1084.727) (-1083.935) (-1083.566) -- 0:00:20
668000 -- (-1086.337) (-1082.189) (-1081.537) [-1081.828] * (-1082.107) (-1085.093) (-1085.085) [-1086.461] -- 0:00:20
668500 -- (-1081.795) [-1081.904] (-1083.284) (-1081.903) * (-1081.865) [-1083.123] (-1086.522) (-1084.625) -- 0:00:20
669000 -- (-1082.744) [-1081.757] (-1083.165) (-1081.838) * (-1085.467) (-1081.655) (-1081.824) [-1081.571] -- 0:00:20
669500 -- (-1083.140) [-1083.161] (-1081.293) (-1081.874) * (-1082.992) [-1081.497] (-1084.234) (-1081.571) -- 0:00:20
670000 -- (-1084.518) [-1081.634] (-1083.991) (-1084.221) * (-1081.885) [-1083.035] (-1085.217) (-1081.563) -- 0:00:20
Average standard deviation of split frequencies: 0.010387
670500 -- [-1083.624] (-1081.895) (-1086.041) (-1082.567) * (-1083.009) (-1083.076) [-1082.243] (-1081.743) -- 0:00:20
671000 -- (-1082.485) (-1081.737) [-1083.383] (-1083.972) * (-1081.761) [-1083.628] (-1089.263) (-1085.417) -- 0:00:20
671500 -- (-1083.393) (-1081.718) (-1085.947) [-1083.552] * (-1083.397) [-1083.019] (-1089.483) (-1084.464) -- 0:00:20
672000 -- (-1083.300) [-1083.082] (-1082.742) (-1083.763) * (-1083.109) (-1083.409) [-1082.331] (-1083.951) -- 0:00:20
672500 -- (-1083.582) (-1087.195) (-1082.451) [-1085.757] * [-1080.973] (-1083.217) (-1086.061) (-1088.201) -- 0:00:19
673000 -- (-1082.505) (-1085.416) (-1083.052) [-1082.577] * (-1080.842) (-1083.433) (-1082.360) [-1085.209] -- 0:00:19
673500 -- [-1082.137] (-1083.031) (-1081.904) (-1083.594) * (-1081.436) (-1083.221) [-1083.224] (-1084.243) -- 0:00:19
674000 -- (-1082.246) (-1082.310) (-1083.628) [-1081.207] * [-1085.967] (-1086.619) (-1085.821) (-1087.077) -- 0:00:19
674500 -- (-1085.978) (-1083.531) (-1087.459) [-1083.176] * (-1084.597) (-1082.998) [-1085.086] (-1084.126) -- 0:00:19
675000 -- (-1084.418) (-1089.056) [-1085.859] (-1082.714) * (-1082.664) (-1084.858) [-1085.341] (-1082.702) -- 0:00:19
Average standard deviation of split frequencies: 0.010499
675500 -- (-1082.713) (-1086.135) (-1082.468) [-1082.136] * (-1084.269) (-1083.593) (-1082.954) [-1083.516] -- 0:00:19
676000 -- (-1081.489) (-1083.447) [-1082.595] (-1081.611) * (-1085.201) [-1081.605] (-1082.833) (-1083.249) -- 0:00:19
676500 -- [-1081.782] (-1081.904) (-1083.294) (-1085.046) * (-1084.226) (-1083.414) [-1084.278] (-1086.334) -- 0:00:19
677000 -- (-1081.685) (-1081.748) [-1083.746] (-1083.851) * (-1086.175) (-1081.696) [-1082.149] (-1082.696) -- 0:00:19
677500 -- [-1082.075] (-1081.934) (-1081.381) (-1083.625) * (-1083.336) (-1082.538) [-1081.513] (-1082.288) -- 0:00:19
678000 -- (-1084.011) (-1083.219) [-1083.538] (-1084.850) * (-1084.994) (-1082.258) [-1084.415] (-1083.656) -- 0:00:19
678500 -- (-1083.342) (-1081.579) [-1081.921] (-1084.920) * (-1084.332) (-1081.958) [-1083.453] (-1084.923) -- 0:00:19
679000 -- (-1081.628) (-1082.018) [-1085.382] (-1087.626) * (-1082.265) [-1082.468] (-1085.781) (-1082.365) -- 0:00:19
679500 -- [-1083.710] (-1082.388) (-1082.960) (-1086.760) * [-1085.967] (-1084.353) (-1089.529) (-1083.638) -- 0:00:19
680000 -- (-1084.509) [-1082.683] (-1081.366) (-1090.956) * (-1081.851) (-1082.710) (-1085.245) [-1082.054] -- 0:00:19
Average standard deviation of split frequencies: 0.010812
680500 -- (-1083.474) [-1082.004] (-1084.766) (-1081.041) * (-1081.703) (-1082.870) [-1082.474] (-1083.743) -- 0:00:19
681000 -- (-1083.645) (-1084.461) [-1083.760] (-1086.758) * [-1082.074] (-1084.250) (-1083.492) (-1084.027) -- 0:00:19
681500 -- (-1086.281) (-1083.465) (-1084.259) [-1083.827] * (-1083.272) (-1083.610) [-1082.497] (-1083.512) -- 0:00:19
682000 -- (-1080.652) [-1081.768] (-1086.904) (-1084.804) * (-1081.996) (-1085.807) [-1084.152] (-1081.921) -- 0:00:19
682500 -- (-1080.712) [-1082.049] (-1084.318) (-1095.870) * (-1081.595) (-1081.622) (-1082.359) [-1082.446] -- 0:00:19
683000 -- (-1081.085) (-1085.201) (-1084.112) [-1083.235] * (-1081.479) (-1083.168) [-1082.542] (-1084.395) -- 0:00:19
683500 -- [-1084.151] (-1083.012) (-1081.654) (-1082.492) * (-1082.923) [-1083.086] (-1085.244) (-1084.497) -- 0:00:19
684000 -- (-1083.709) [-1082.167] (-1085.592) (-1082.039) * [-1084.721] (-1082.260) (-1081.633) (-1083.485) -- 0:00:19
684500 -- (-1085.662) (-1084.281) [-1082.461] (-1081.331) * (-1082.454) (-1082.659) [-1081.194] (-1083.250) -- 0:00:19
685000 -- [-1086.010] (-1083.365) (-1083.114) (-1081.074) * (-1081.972) (-1082.561) [-1082.411] (-1082.149) -- 0:00:19
Average standard deviation of split frequencies: 0.010575
685500 -- [-1084.892] (-1085.495) (-1081.562) (-1082.733) * (-1084.200) (-1083.274) (-1085.573) [-1082.028] -- 0:00:19
686000 -- (-1085.273) [-1087.973] (-1083.624) (-1083.082) * (-1084.718) (-1082.545) [-1081.097] (-1083.605) -- 0:00:19
686500 -- (-1084.163) [-1086.062] (-1082.739) (-1082.638) * [-1082.192] (-1082.715) (-1082.470) (-1083.108) -- 0:00:19
687000 -- (-1081.424) (-1085.899) (-1085.172) [-1082.943] * (-1082.361) (-1086.213) [-1082.778] (-1085.960) -- 0:00:19
687500 -- [-1082.314] (-1086.399) (-1086.142) (-1082.644) * (-1081.757) (-1081.496) (-1083.062) [-1082.789] -- 0:00:19
688000 -- [-1081.370] (-1081.306) (-1082.411) (-1085.391) * (-1081.795) (-1081.757) (-1081.782) [-1083.123] -- 0:00:19
688500 -- [-1082.942] (-1081.691) (-1083.436) (-1084.520) * (-1085.810) (-1082.651) [-1081.185] (-1083.051) -- 0:00:19
689000 -- (-1086.450) (-1082.175) (-1086.229) [-1083.217] * (-1084.391) (-1081.777) [-1082.526] (-1084.423) -- 0:00:18
689500 -- [-1082.702] (-1083.650) (-1082.438) (-1080.770) * (-1088.510) [-1082.384] (-1084.095) (-1081.254) -- 0:00:18
690000 -- (-1082.118) (-1085.503) [-1083.616] (-1081.563) * (-1090.284) [-1082.426] (-1084.585) (-1083.190) -- 0:00:18
Average standard deviation of split frequencies: 0.010479
690500 -- (-1083.949) [-1085.685] (-1083.818) (-1082.486) * (-1086.331) (-1083.270) (-1082.371) [-1081.792] -- 0:00:18
691000 -- (-1083.212) (-1082.906) [-1084.859] (-1081.815) * (-1083.594) (-1080.907) [-1082.912] (-1080.985) -- 0:00:18
691500 -- [-1085.417] (-1081.395) (-1083.088) (-1082.321) * (-1084.949) (-1081.173) (-1084.316) [-1082.488] -- 0:00:18
692000 -- [-1084.300] (-1083.534) (-1083.963) (-1082.751) * (-1082.984) [-1080.902] (-1081.024) (-1083.516) -- 0:00:18
692500 -- (-1083.475) (-1081.941) (-1082.161) [-1084.150] * [-1082.432] (-1084.744) (-1082.879) (-1083.916) -- 0:00:18
693000 -- (-1082.657) [-1082.028] (-1085.798) (-1083.848) * (-1084.524) (-1087.667) [-1082.871] (-1082.123) -- 0:00:18
693500 -- (-1081.363) [-1083.073] (-1084.215) (-1090.987) * (-1083.444) (-1083.516) [-1082.939] (-1082.674) -- 0:00:18
694000 -- (-1082.243) [-1083.616] (-1083.129) (-1083.823) * [-1082.064] (-1083.497) (-1083.205) (-1081.245) -- 0:00:18
694500 -- (-1084.283) [-1082.811] (-1087.226) (-1084.609) * (-1085.024) [-1082.621] (-1083.608) (-1082.902) -- 0:00:18
695000 -- (-1082.206) (-1082.853) (-1081.318) [-1081.384] * [-1084.176] (-1082.103) (-1084.262) (-1083.233) -- 0:00:18
Average standard deviation of split frequencies: 0.010244
695500 -- [-1082.393] (-1082.798) (-1082.270) (-1082.111) * (-1084.578) (-1082.796) [-1083.425] (-1081.927) -- 0:00:18
696000 -- (-1083.265) [-1081.672] (-1084.371) (-1081.895) * (-1081.456) (-1083.414) (-1083.800) [-1083.971] -- 0:00:18
696500 -- (-1084.188) (-1084.772) (-1082.488) [-1084.023] * (-1085.626) (-1086.239) [-1082.476] (-1085.928) -- 0:00:18
697000 -- (-1085.893) (-1082.281) (-1086.798) [-1081.894] * (-1084.670) [-1083.297] (-1084.563) (-1081.594) -- 0:00:18
697500 -- (-1087.537) [-1083.738] (-1081.851) (-1081.691) * (-1087.900) (-1081.193) (-1083.344) [-1081.990] -- 0:00:18
698000 -- (-1083.868) (-1083.105) [-1082.527] (-1083.699) * (-1084.216) (-1081.758) [-1083.518] (-1081.513) -- 0:00:18
698500 -- [-1085.928] (-1085.172) (-1082.670) (-1082.909) * (-1085.608) [-1084.380] (-1087.058) (-1085.084) -- 0:00:18
699000 -- (-1088.273) (-1084.904) [-1083.283] (-1082.234) * (-1083.530) (-1083.156) [-1084.347] (-1083.164) -- 0:00:18
699500 -- [-1082.642] (-1086.773) (-1083.264) (-1085.840) * (-1084.183) [-1082.156] (-1081.916) (-1083.888) -- 0:00:18
700000 -- [-1081.609] (-1081.707) (-1083.681) (-1090.444) * (-1084.011) (-1081.813) [-1082.063] (-1083.805) -- 0:00:18
Average standard deviation of split frequencies: 0.010344
700500 -- [-1083.961] (-1082.813) (-1083.375) (-1082.875) * (-1082.094) [-1081.675] (-1082.351) (-1083.039) -- 0:00:18
701000 -- [-1083.628] (-1082.407) (-1082.176) (-1089.775) * (-1084.232) (-1081.440) [-1082.097] (-1090.654) -- 0:00:18
701500 -- (-1082.877) (-1082.407) [-1083.090] (-1083.917) * (-1083.346) (-1081.422) (-1082.304) [-1081.459] -- 0:00:18
702000 -- (-1082.708) (-1086.600) [-1083.960] (-1081.484) * [-1082.127] (-1083.289) (-1082.414) (-1082.347) -- 0:00:18
702500 -- (-1083.407) (-1083.012) (-1085.123) [-1086.720] * (-1084.873) (-1084.197) (-1085.201) [-1082.347] -- 0:00:18
703000 -- [-1081.613] (-1083.414) (-1081.563) (-1084.698) * (-1083.477) (-1082.091) (-1082.571) [-1083.090] -- 0:00:18
703500 -- (-1083.607) (-1081.462) (-1081.563) [-1081.937] * (-1087.219) (-1082.171) [-1080.730] (-1082.553) -- 0:00:18
704000 -- (-1082.607) [-1081.434] (-1081.457) (-1081.565) * [-1081.925] (-1087.260) (-1082.002) (-1082.320) -- 0:00:18
704500 -- (-1084.096) (-1084.111) (-1083.058) [-1083.364] * [-1083.199] (-1083.939) (-1084.959) (-1081.868) -- 0:00:18
705000 -- [-1082.838] (-1083.062) (-1081.288) (-1083.306) * [-1082.471] (-1083.482) (-1084.669) (-1081.804) -- 0:00:17
Average standard deviation of split frequencies: 0.010832
705500 -- (-1085.932) (-1082.944) (-1082.018) [-1082.429] * (-1086.507) (-1082.297) [-1082.713] (-1082.496) -- 0:00:17
706000 -- [-1081.449] (-1084.809) (-1086.137) (-1081.702) * (-1081.712) (-1081.965) [-1082.542] (-1081.858) -- 0:00:17
706500 -- (-1083.846) (-1083.431) [-1081.976] (-1081.077) * [-1082.032] (-1089.924) (-1082.379) (-1084.632) -- 0:00:17
707000 -- [-1083.522] (-1083.632) (-1085.184) (-1083.641) * (-1082.461) (-1084.604) (-1082.551) [-1081.903] -- 0:00:17
707500 -- [-1083.630] (-1081.393) (-1083.994) (-1083.641) * [-1083.017] (-1083.350) (-1082.430) (-1081.737) -- 0:00:17
708000 -- (-1082.604) (-1082.032) (-1084.035) [-1081.624] * (-1083.523) (-1083.454) (-1085.652) [-1083.046] -- 0:00:17
708500 -- [-1081.189] (-1081.326) (-1084.316) (-1082.484) * (-1082.790) (-1082.482) [-1082.673] (-1084.893) -- 0:00:17
709000 -- (-1084.065) [-1084.348] (-1081.772) (-1081.738) * (-1083.786) [-1082.449] (-1082.630) (-1083.193) -- 0:00:17
709500 -- (-1083.210) (-1081.478) (-1083.641) [-1085.782] * [-1080.847] (-1082.586) (-1086.770) (-1084.331) -- 0:00:17
710000 -- (-1082.770) [-1081.139] (-1082.323) (-1084.537) * (-1081.059) (-1082.704) [-1083.273] (-1086.815) -- 0:00:17
Average standard deviation of split frequencies: 0.010650
710500 -- (-1081.668) (-1082.273) [-1086.755] (-1083.534) * (-1083.977) (-1083.551) (-1082.431) [-1081.490] -- 0:00:17
711000 -- (-1081.807) [-1083.225] (-1085.219) (-1086.928) * [-1081.476] (-1083.075) (-1083.657) (-1082.642) -- 0:00:17
711500 -- (-1084.884) (-1081.622) [-1085.156] (-1085.550) * (-1081.835) (-1082.088) (-1083.248) [-1082.519] -- 0:00:17
712000 -- (-1083.685) [-1084.132] (-1084.430) (-1087.202) * (-1082.629) (-1082.569) [-1082.677] (-1082.969) -- 0:00:17
712500 -- (-1081.671) (-1082.255) (-1081.080) [-1081.476] * (-1084.737) (-1082.584) [-1082.386] (-1082.908) -- 0:00:17
713000 -- (-1082.797) [-1083.060] (-1081.634) (-1083.370) * (-1083.990) (-1081.658) (-1084.289) [-1082.029] -- 0:00:17
713500 -- [-1084.362] (-1081.926) (-1081.425) (-1085.145) * (-1083.370) [-1082.554] (-1082.066) (-1082.455) -- 0:00:17
714000 -- (-1083.141) (-1082.770) [-1082.793] (-1083.268) * [-1081.738] (-1084.697) (-1084.867) (-1083.265) -- 0:00:17
714500 -- (-1083.884) [-1084.220] (-1081.678) (-1086.541) * (-1084.164) [-1083.874] (-1081.825) (-1082.443) -- 0:00:17
715000 -- (-1083.872) (-1082.033) [-1081.694] (-1084.512) * (-1086.409) [-1083.127] (-1083.614) (-1082.162) -- 0:00:17
Average standard deviation of split frequencies: 0.011449
715500 -- [-1081.746] (-1081.685) (-1086.593) (-1087.290) * (-1083.471) (-1082.300) [-1084.566] (-1084.807) -- 0:00:17
716000 -- (-1083.520) (-1082.572) (-1084.054) [-1082.724] * (-1081.748) (-1081.416) (-1083.549) [-1081.555] -- 0:00:17
716500 -- (-1085.011) [-1084.534] (-1082.198) (-1083.809) * (-1081.798) [-1083.356] (-1084.439) (-1083.427) -- 0:00:17
717000 -- (-1083.217) (-1084.844) [-1086.045] (-1081.645) * (-1082.131) (-1084.680) (-1082.032) [-1084.456] -- 0:00:17
717500 -- (-1081.933) [-1084.592] (-1087.140) (-1083.835) * (-1082.631) (-1083.593) [-1084.694] (-1084.483) -- 0:00:17
718000 -- (-1082.306) (-1085.356) [-1086.710] (-1082.784) * (-1084.390) [-1085.132] (-1082.069) (-1081.134) -- 0:00:17
718500 -- (-1082.731) (-1084.240) [-1085.427] (-1082.890) * (-1081.834) [-1084.636] (-1083.025) (-1081.643) -- 0:00:17
719000 -- (-1083.390) (-1083.458) (-1088.919) [-1083.291] * (-1084.562) [-1083.011] (-1085.744) (-1084.865) -- 0:00:17
719500 -- (-1082.837) [-1085.402] (-1091.239) (-1082.961) * (-1086.594) [-1083.516] (-1083.295) (-1087.660) -- 0:00:17
720000 -- (-1082.611) (-1085.917) (-1084.405) [-1085.976] * (-1082.907) (-1085.155) (-1083.332) [-1082.888] -- 0:00:17
Average standard deviation of split frequencies: 0.011338
720500 -- (-1081.630) (-1084.973) (-1083.836) [-1082.988] * [-1081.320] (-1084.210) (-1081.884) (-1086.067) -- 0:00:17
721000 -- (-1081.595) (-1083.996) (-1081.220) [-1081.973] * (-1084.177) (-1082.392) (-1082.842) [-1083.963] -- 0:00:17
721500 -- (-1081.652) [-1083.627] (-1083.951) (-1081.850) * (-1083.629) (-1082.146) (-1081.709) [-1082.379] -- 0:00:16
722000 -- (-1081.900) (-1082.044) (-1090.384) [-1084.387] * (-1086.184) (-1081.427) (-1082.955) [-1081.329] -- 0:00:16
722500 -- [-1081.237] (-1082.396) (-1084.277) (-1084.288) * [-1084.774] (-1084.704) (-1082.635) (-1083.432) -- 0:00:16
723000 -- (-1082.353) (-1083.870) [-1082.962] (-1081.936) * (-1083.315) [-1081.672] (-1084.145) (-1084.683) -- 0:00:16
723500 -- [-1083.712] (-1084.629) (-1083.273) (-1085.440) * (-1086.776) (-1085.748) [-1083.698] (-1081.794) -- 0:00:16
724000 -- (-1081.802) [-1082.162] (-1081.595) (-1084.233) * (-1086.128) (-1084.106) (-1087.214) [-1086.830] -- 0:00:16
724500 -- [-1083.268] (-1080.941) (-1084.536) (-1081.576) * [-1084.366] (-1083.900) (-1084.059) (-1082.439) -- 0:00:16
725000 -- (-1081.805) [-1081.067] (-1083.302) (-1082.204) * (-1087.006) [-1083.267] (-1083.197) (-1082.322) -- 0:00:16
Average standard deviation of split frequencies: 0.011399
725500 -- (-1083.802) (-1083.297) [-1083.685] (-1084.030) * (-1087.111) [-1083.152] (-1084.507) (-1081.902) -- 0:00:16
726000 -- [-1081.227] (-1083.504) (-1084.517) (-1084.074) * (-1082.454) (-1081.158) [-1083.446] (-1081.627) -- 0:00:16
726500 -- [-1081.532] (-1084.378) (-1083.466) (-1083.524) * (-1083.964) (-1082.861) (-1083.325) [-1081.786] -- 0:00:16
727000 -- (-1085.950) (-1085.104) [-1083.925] (-1081.508) * (-1083.963) [-1083.239] (-1082.025) (-1083.050) -- 0:00:16
727500 -- [-1082.359] (-1083.377) (-1083.788) (-1081.483) * (-1083.943) (-1086.744) [-1081.587] (-1081.362) -- 0:00:16
728000 -- (-1083.524) (-1084.047) (-1083.722) [-1081.625] * (-1081.978) (-1083.884) [-1083.825] (-1082.592) -- 0:00:16
728500 -- [-1082.991] (-1084.532) (-1081.829) (-1085.777) * (-1081.480) (-1085.399) [-1083.375] (-1082.035) -- 0:00:16
729000 -- (-1082.376) (-1085.670) (-1081.843) [-1087.954] * (-1082.695) [-1081.682] (-1082.315) (-1082.137) -- 0:00:16
729500 -- (-1085.810) (-1085.597) [-1083.147] (-1086.321) * (-1082.551) (-1081.290) (-1082.791) [-1081.232] -- 0:00:16
730000 -- (-1084.881) [-1083.283] (-1082.683) (-1084.536) * (-1081.437) (-1084.010) [-1083.930] (-1083.292) -- 0:00:16
Average standard deviation of split frequencies: 0.011309
730500 -- [-1088.442] (-1081.381) (-1083.713) (-1085.271) * (-1082.113) (-1084.197) (-1085.898) [-1083.621] -- 0:00:16
731000 -- (-1088.579) (-1082.699) [-1082.456] (-1084.553) * (-1083.027) [-1083.259] (-1084.887) (-1083.631) -- 0:00:16
731500 -- (-1081.297) [-1080.792] (-1084.322) (-1083.819) * (-1082.332) [-1082.220] (-1083.326) (-1082.257) -- 0:00:16
732000 -- (-1081.516) (-1084.154) (-1082.502) [-1083.646] * (-1081.699) (-1081.225) (-1083.034) [-1082.327] -- 0:00:16
732500 -- [-1083.272] (-1085.174) (-1084.425) (-1086.032) * (-1082.813) (-1081.371) (-1083.734) [-1082.752] -- 0:00:16
733000 -- (-1081.867) (-1083.777) [-1089.511] (-1081.979) * (-1083.546) [-1081.137] (-1084.643) (-1081.776) -- 0:00:16
733500 -- (-1084.357) (-1085.676) (-1082.596) [-1083.192] * [-1083.234] (-1082.250) (-1083.670) (-1082.287) -- 0:00:16
734000 -- [-1081.887] (-1082.594) (-1081.993) (-1082.049) * (-1083.394) [-1085.773] (-1082.594) (-1084.128) -- 0:00:16
734500 -- (-1081.789) (-1082.049) (-1081.367) [-1084.383] * [-1085.360] (-1083.221) (-1083.655) (-1081.931) -- 0:00:16
735000 -- (-1084.301) [-1084.847] (-1089.467) (-1081.055) * (-1084.302) (-1081.985) [-1085.119] (-1082.963) -- 0:00:16
Average standard deviation of split frequencies: 0.011868
735500 -- (-1084.465) (-1083.177) (-1083.335) [-1082.864] * (-1084.816) [-1081.812] (-1082.512) (-1082.794) -- 0:00:16
736000 -- (-1085.139) [-1083.964] (-1082.897) (-1089.565) * (-1086.543) (-1081.218) [-1081.178] (-1082.975) -- 0:00:16
736500 -- (-1082.065) [-1081.972] (-1081.969) (-1086.907) * (-1084.388) (-1082.884) [-1083.267] (-1084.651) -- 0:00:16
737000 -- [-1082.270] (-1084.375) (-1084.477) (-1081.627) * (-1081.074) (-1082.782) [-1082.723] (-1081.410) -- 0:00:16
737500 -- (-1082.647) (-1085.084) [-1082.112] (-1083.935) * (-1086.993) (-1082.345) [-1083.488] (-1081.837) -- 0:00:16
738000 -- (-1085.482) [-1083.563] (-1084.116) (-1082.205) * (-1086.314) [-1082.876] (-1082.347) (-1084.708) -- 0:00:15
738500 -- (-1087.245) (-1081.833) [-1081.782] (-1081.754) * (-1082.810) (-1085.389) (-1081.589) [-1086.943] -- 0:00:15
739000 -- (-1086.876) (-1081.368) (-1081.004) [-1082.420] * (-1082.840) (-1081.811) (-1081.902) [-1083.080] -- 0:00:15
739500 -- (-1084.933) [-1083.055] (-1082.159) (-1082.080) * (-1084.605) (-1081.854) (-1084.299) [-1082.611] -- 0:00:15
740000 -- (-1082.811) [-1081.793] (-1085.122) (-1081.364) * (-1086.007) [-1083.264] (-1083.221) (-1085.224) -- 0:00:15
Average standard deviation of split frequencies: 0.011257
740500 -- (-1082.314) (-1083.691) (-1082.324) [-1082.861] * [-1084.452] (-1083.862) (-1082.925) (-1082.763) -- 0:00:15
741000 -- (-1082.710) [-1081.059] (-1081.911) (-1086.292) * (-1083.780) (-1083.363) (-1083.387) [-1087.595] -- 0:00:15
741500 -- [-1086.308] (-1085.036) (-1083.688) (-1083.749) * (-1082.177) (-1081.766) [-1083.005] (-1082.322) -- 0:00:15
742000 -- [-1083.621] (-1083.253) (-1082.547) (-1082.672) * [-1081.897] (-1085.344) (-1084.610) (-1082.959) -- 0:00:15
742500 -- (-1085.262) [-1091.132] (-1083.492) (-1083.134) * (-1083.115) [-1084.218] (-1081.364) (-1083.459) -- 0:00:15
743000 -- (-1084.907) [-1081.823] (-1081.929) (-1082.028) * (-1083.135) (-1082.054) (-1081.687) [-1087.267] -- 0:00:15
743500 -- (-1086.158) (-1082.788) [-1083.425] (-1085.115) * (-1082.339) (-1082.876) (-1082.801) [-1083.526] -- 0:00:15
744000 -- (-1083.945) [-1082.450] (-1083.048) (-1086.990) * (-1083.440) (-1084.686) [-1083.839] (-1083.068) -- 0:00:15
744500 -- (-1082.643) (-1083.173) (-1083.295) [-1083.337] * (-1083.509) (-1083.070) [-1080.767] (-1084.039) -- 0:00:15
745000 -- (-1081.534) (-1081.411) (-1081.177) [-1083.854] * (-1082.192) (-1084.419) [-1081.795] (-1081.644) -- 0:00:15
Average standard deviation of split frequencies: 0.010624
745500 -- (-1088.255) (-1083.191) (-1082.171) [-1081.925] * (-1082.427) (-1081.810) [-1081.795] (-1083.271) -- 0:00:15
746000 -- (-1083.741) (-1083.743) (-1083.810) [-1083.892] * (-1083.222) (-1083.124) (-1081.273) [-1082.070] -- 0:00:15
746500 -- [-1082.259] (-1082.341) (-1080.872) (-1084.619) * (-1084.153) [-1084.990] (-1081.518) (-1082.257) -- 0:00:15
747000 -- (-1082.223) (-1087.294) (-1081.042) [-1081.702] * (-1083.741) (-1085.164) (-1082.345) [-1082.890] -- 0:00:15
747500 -- (-1083.160) (-1080.855) (-1084.819) [-1082.983] * (-1084.589) (-1084.949) (-1081.888) [-1087.815] -- 0:00:15
748000 -- (-1083.613) (-1085.188) (-1089.072) [-1084.639] * (-1082.526) [-1083.301] (-1082.668) (-1082.968) -- 0:00:15
748500 -- [-1084.456] (-1083.450) (-1085.210) (-1085.140) * (-1082.806) [-1081.134] (-1084.223) (-1082.697) -- 0:00:15
749000 -- (-1082.405) (-1086.282) [-1082.800] (-1083.512) * (-1085.092) (-1081.277) [-1084.091] (-1084.254) -- 0:00:15
749500 -- (-1082.740) [-1081.306] (-1081.280) (-1082.890) * (-1084.799) (-1081.107) (-1085.036) [-1082.088] -- 0:00:15
750000 -- (-1081.594) [-1083.806] (-1082.949) (-1085.238) * (-1084.207) (-1084.306) [-1086.803] (-1081.787) -- 0:00:15
Average standard deviation of split frequencies: 0.010715
750500 -- (-1081.952) [-1082.571] (-1086.644) (-1085.487) * [-1083.021] (-1081.626) (-1082.170) (-1087.144) -- 0:00:15
751000 -- [-1083.338] (-1084.920) (-1083.694) (-1088.360) * (-1084.721) (-1082.928) (-1082.981) [-1084.616] -- 0:00:15
751500 -- (-1082.870) (-1083.455) [-1084.689] (-1083.013) * (-1081.712) (-1082.200) [-1081.287] (-1083.349) -- 0:00:15
752000 -- (-1081.782) (-1080.982) (-1082.636) [-1082.609] * (-1087.452) (-1086.796) [-1081.966] (-1081.762) -- 0:00:15
752500 -- (-1082.355) (-1081.990) (-1081.619) [-1082.961] * [-1084.381] (-1083.328) (-1081.474) (-1081.639) -- 0:00:15
753000 -- (-1081.473) [-1081.847] (-1081.871) (-1083.046) * (-1082.095) [-1083.124] (-1081.282) (-1081.781) -- 0:00:15
753500 -- (-1086.649) (-1083.570) (-1083.158) [-1081.785] * (-1082.369) (-1084.072) (-1083.966) [-1087.424] -- 0:00:15
754000 -- [-1086.100] (-1081.404) (-1082.346) (-1086.933) * (-1084.519) (-1085.221) (-1086.839) [-1083.197] -- 0:00:15
754500 -- (-1081.601) (-1083.152) [-1082.355] (-1087.668) * (-1084.714) [-1083.424] (-1085.926) (-1082.893) -- 0:00:14
755000 -- (-1082.544) (-1083.166) [-1082.263] (-1086.555) * (-1082.909) (-1083.706) [-1084.680] (-1082.487) -- 0:00:14
Average standard deviation of split frequencies: 0.010951
755500 -- (-1082.949) (-1088.165) [-1081.416] (-1084.990) * (-1085.278) (-1084.077) (-1085.307) [-1082.287] -- 0:00:14
756000 -- [-1082.144] (-1081.214) (-1083.775) (-1084.665) * (-1089.782) [-1083.799] (-1082.747) (-1082.901) -- 0:00:14
756500 -- (-1083.596) [-1083.157] (-1081.771) (-1083.138) * [-1086.245] (-1082.845) (-1082.495) (-1083.150) -- 0:00:14
757000 -- (-1082.341) (-1083.809) [-1087.140] (-1081.451) * (-1084.814) [-1082.349] (-1083.482) (-1086.140) -- 0:00:14
757500 -- (-1083.886) (-1083.944) (-1085.397) [-1085.175] * (-1083.974) [-1084.141] (-1086.953) (-1082.446) -- 0:00:14
758000 -- (-1084.020) [-1081.911] (-1083.321) (-1081.943) * [-1082.313] (-1083.422) (-1084.159) (-1081.524) -- 0:00:14
758500 -- (-1082.854) [-1081.834] (-1085.162) (-1085.517) * (-1082.780) (-1081.536) (-1083.711) [-1083.049] -- 0:00:14
759000 -- [-1084.064] (-1083.498) (-1082.852) (-1081.822) * (-1081.443) (-1083.789) [-1083.900] (-1082.240) -- 0:00:14
759500 -- (-1086.016) (-1082.187) (-1081.786) [-1081.376] * (-1083.122) (-1082.275) [-1081.754] (-1084.226) -- 0:00:14
760000 -- (-1083.187) [-1081.921] (-1086.022) (-1081.273) * [-1084.091] (-1082.402) (-1082.885) (-1084.772) -- 0:00:14
Average standard deviation of split frequencies: 0.010690
760500 -- (-1082.840) [-1081.606] (-1085.088) (-1081.273) * (-1084.602) (-1083.621) (-1083.879) [-1086.814] -- 0:00:14
761000 -- (-1085.639) (-1084.213) [-1083.220] (-1082.680) * [-1081.869] (-1083.384) (-1083.735) (-1081.970) -- 0:00:14
761500 -- [-1083.970] (-1086.043) (-1082.497) (-1082.097) * (-1081.337) (-1082.188) (-1083.424) [-1084.620] -- 0:00:14
762000 -- (-1082.791) (-1082.142) [-1081.319] (-1081.544) * [-1083.446] (-1083.103) (-1084.311) (-1086.103) -- 0:00:14
762500 -- [-1085.432] (-1085.741) (-1081.454) (-1084.460) * (-1081.624) (-1084.763) (-1082.435) [-1084.305] -- 0:00:14
763000 -- [-1084.823] (-1083.582) (-1082.757) (-1084.661) * (-1082.855) [-1081.208] (-1087.265) (-1084.139) -- 0:00:14
763500 -- (-1086.382) (-1082.669) (-1081.332) [-1083.542] * [-1082.790] (-1089.078) (-1081.516) (-1082.627) -- 0:00:14
764000 -- [-1084.522] (-1083.412) (-1084.221) (-1081.986) * (-1081.710) (-1083.473) (-1082.456) [-1082.443] -- 0:00:14
764500 -- (-1081.634) [-1081.845] (-1087.427) (-1082.656) * [-1082.277] (-1085.039) (-1085.949) (-1082.025) -- 0:00:14
765000 -- (-1081.439) (-1084.242) (-1084.918) [-1081.275] * (-1084.156) (-1084.640) [-1085.265] (-1083.197) -- 0:00:14
Average standard deviation of split frequencies: 0.010571
765500 -- [-1081.827] (-1083.065) (-1083.868) (-1082.859) * (-1083.909) (-1082.638) [-1082.745] (-1081.687) -- 0:00:14
766000 -- (-1085.446) (-1085.910) [-1085.128] (-1082.043) * (-1085.550) (-1084.913) [-1084.632] (-1083.283) -- 0:00:14
766500 -- [-1082.371] (-1083.353) (-1088.941) (-1082.063) * (-1084.042) (-1087.448) [-1083.886] (-1082.544) -- 0:00:14
767000 -- (-1080.673) (-1080.860) (-1086.412) [-1082.450] * [-1082.278] (-1083.325) (-1083.844) (-1083.457) -- 0:00:14
767500 -- (-1081.554) (-1081.121) (-1084.963) [-1083.186] * (-1083.322) [-1084.040] (-1085.178) (-1081.635) -- 0:00:14
768000 -- (-1082.299) (-1082.052) [-1082.961] (-1082.938) * (-1084.807) (-1084.105) [-1087.091] (-1082.306) -- 0:00:14
768500 -- (-1085.907) (-1084.229) (-1082.569) [-1082.335] * (-1083.390) (-1083.871) [-1083.609] (-1083.031) -- 0:00:14
769000 -- (-1084.701) (-1080.793) (-1085.670) [-1082.405] * (-1084.772) (-1084.847) (-1084.418) [-1083.112] -- 0:00:14
769500 -- (-1082.859) (-1082.024) (-1083.175) [-1083.043] * (-1081.657) (-1084.114) (-1084.454) [-1083.255] -- 0:00:14
770000 -- [-1083.761] (-1081.215) (-1083.141) (-1083.978) * (-1084.865) (-1084.903) [-1083.435] (-1084.388) -- 0:00:14
Average standard deviation of split frequencies: 0.010003
770500 -- (-1082.743) (-1083.784) [-1081.110] (-1083.162) * (-1083.246) (-1082.861) (-1084.092) [-1081.813] -- 0:00:13
771000 -- (-1084.508) [-1083.467] (-1084.699) (-1085.288) * (-1087.675) [-1085.969] (-1083.788) (-1083.258) -- 0:00:13
771500 -- (-1084.031) [-1080.751] (-1082.187) (-1084.116) * [-1082.042] (-1088.152) (-1083.020) (-1082.185) -- 0:00:13
772000 -- (-1080.858) (-1081.828) [-1083.192] (-1081.086) * (-1082.231) (-1094.957) (-1081.841) [-1083.588] -- 0:00:13
772500 -- (-1087.571) (-1082.383) [-1082.220] (-1083.922) * (-1082.073) [-1084.340] (-1081.210) (-1082.068) -- 0:00:13
773000 -- [-1081.391] (-1082.061) (-1082.815) (-1085.013) * (-1082.213) (-1083.820) (-1082.157) [-1083.642] -- 0:00:13
773500 -- [-1081.645] (-1084.105) (-1081.422) (-1082.486) * (-1083.333) (-1082.783) (-1084.809) [-1083.657] -- 0:00:13
774000 -- (-1082.162) [-1080.852] (-1087.656) (-1084.037) * (-1081.413) [-1083.291] (-1085.636) (-1084.933) -- 0:00:13
774500 -- (-1084.598) (-1081.674) (-1083.714) [-1081.638] * [-1084.407] (-1085.911) (-1083.941) (-1085.789) -- 0:00:13
775000 -- (-1084.311) (-1083.024) [-1081.250] (-1083.822) * (-1082.799) (-1083.312) (-1083.834) [-1083.634] -- 0:00:13
Average standard deviation of split frequencies: 0.010327
775500 -- (-1081.243) (-1083.541) (-1083.923) [-1081.793] * (-1081.350) [-1082.641] (-1082.756) (-1082.293) -- 0:00:13
776000 -- (-1083.033) (-1081.415) [-1085.725] (-1082.306) * (-1081.031) (-1081.849) [-1080.945] (-1081.588) -- 0:00:13
776500 -- (-1082.399) [-1081.471] (-1083.639) (-1084.344) * (-1083.302) [-1082.804] (-1081.726) (-1087.711) -- 0:00:13
777000 -- [-1081.470] (-1084.261) (-1084.215) (-1082.978) * (-1083.607) [-1085.545] (-1082.036) (-1080.874) -- 0:00:13
777500 -- (-1085.539) [-1085.515] (-1082.284) (-1083.423) * [-1080.769] (-1083.815) (-1082.685) (-1082.222) -- 0:00:13
778000 -- (-1085.482) (-1087.405) [-1086.170] (-1083.324) * (-1084.601) (-1083.251) (-1081.730) [-1081.255] -- 0:00:13
778500 -- (-1081.733) (-1082.488) (-1085.043) [-1080.969] * (-1085.316) [-1081.647] (-1081.246) (-1082.560) -- 0:00:13
779000 -- (-1081.999) (-1084.052) [-1083.799] (-1082.037) * (-1084.568) (-1083.574) [-1086.421] (-1090.427) -- 0:00:13
779500 -- (-1081.709) (-1085.421) (-1084.784) [-1083.249] * (-1084.775) (-1083.019) [-1082.078] (-1086.063) -- 0:00:13
780000 -- [-1081.940] (-1083.242) (-1083.709) (-1083.082) * (-1082.291) (-1083.893) [-1081.613] (-1082.223) -- 0:00:13
Average standard deviation of split frequencies: 0.010550
780500 -- (-1082.348) [-1083.384] (-1084.794) (-1082.439) * (-1082.182) (-1083.428) [-1081.538] (-1084.301) -- 0:00:13
781000 -- (-1083.255) (-1082.850) (-1082.340) [-1081.553] * (-1081.848) (-1081.577) (-1083.014) [-1081.460] -- 0:00:13
781500 -- [-1081.874] (-1082.752) (-1082.498) (-1087.760) * [-1082.563] (-1083.423) (-1087.704) (-1083.282) -- 0:00:13
782000 -- (-1082.877) (-1083.466) [-1082.169] (-1082.351) * (-1082.981) (-1084.192) (-1084.580) [-1083.476] -- 0:00:13
782500 -- (-1082.085) (-1083.611) [-1081.449] (-1084.086) * (-1085.518) [-1082.724] (-1084.027) (-1081.597) -- 0:00:13
783000 -- [-1085.672] (-1086.026) (-1081.227) (-1084.388) * [-1082.548] (-1083.417) (-1087.005) (-1081.188) -- 0:00:13
783500 -- (-1087.724) (-1085.227) (-1081.863) [-1083.063] * (-1082.317) (-1089.107) (-1082.004) [-1081.756] -- 0:00:13
784000 -- (-1086.135) (-1082.083) (-1084.538) [-1081.765] * (-1084.275) [-1082.541] (-1090.264) (-1086.076) -- 0:00:13
784500 -- [-1081.428] (-1080.915) (-1082.271) (-1083.167) * (-1082.847) [-1081.722] (-1085.453) (-1081.306) -- 0:00:13
785000 -- (-1082.331) (-1081.951) [-1082.141] (-1081.976) * (-1083.535) (-1081.711) [-1082.686] (-1089.394) -- 0:00:13
Average standard deviation of split frequencies: 0.010372
785500 -- [-1081.290] (-1084.559) (-1085.241) (-1083.612) * (-1082.075) (-1083.814) [-1083.531] (-1087.052) -- 0:00:13
786000 -- (-1081.432) (-1082.060) [-1083.905] (-1082.587) * (-1082.308) (-1086.800) [-1083.339] (-1086.825) -- 0:00:13
786500 -- (-1082.927) [-1082.218] (-1084.191) (-1085.203) * (-1082.059) (-1088.762) [-1082.330] (-1084.607) -- 0:00:13
787000 -- (-1086.439) (-1086.520) (-1082.886) [-1087.006] * (-1084.481) [-1082.319] (-1083.494) (-1083.714) -- 0:00:12
787500 -- (-1087.736) (-1083.033) (-1085.259) [-1086.740] * (-1082.182) [-1084.048] (-1081.766) (-1085.518) -- 0:00:12
788000 -- (-1083.549) (-1084.899) [-1083.699] (-1082.554) * (-1082.293) [-1082.856] (-1083.258) (-1080.761) -- 0:00:12
788500 -- [-1082.680] (-1081.241) (-1082.186) (-1083.377) * (-1084.204) (-1083.065) (-1081.716) [-1084.713] -- 0:00:12
789000 -- (-1081.983) [-1081.368] (-1082.862) (-1081.350) * [-1084.918] (-1083.097) (-1086.173) (-1083.307) -- 0:00:12
789500 -- (-1084.056) (-1084.373) [-1082.586] (-1081.495) * (-1084.473) [-1086.277] (-1082.171) (-1083.719) -- 0:00:12
790000 -- [-1082.621] (-1082.691) (-1083.719) (-1091.571) * (-1089.953) (-1085.668) [-1081.494] (-1091.378) -- 0:00:12
Average standard deviation of split frequencies: 0.010136
790500 -- [-1083.503] (-1080.977) (-1084.964) (-1084.424) * (-1089.178) [-1082.206] (-1082.212) (-1081.385) -- 0:00:12
791000 -- (-1082.327) (-1083.227) [-1085.910] (-1082.539) * (-1083.775) (-1082.524) [-1081.058] (-1085.199) -- 0:00:12
791500 -- (-1084.138) [-1082.051] (-1083.321) (-1081.125) * (-1080.866) (-1081.424) [-1081.396] (-1089.100) -- 0:00:12
792000 -- (-1082.303) (-1084.099) (-1082.827) [-1081.532] * [-1085.423] (-1082.152) (-1081.903) (-1090.706) -- 0:00:12
792500 -- (-1082.519) (-1087.312) (-1081.689) [-1081.811] * (-1082.878) [-1081.896] (-1086.576) (-1083.537) -- 0:00:12
793000 -- (-1081.471) (-1086.153) (-1088.147) [-1081.318] * (-1082.526) (-1083.007) [-1083.142] (-1083.669) -- 0:00:12
793500 -- (-1084.693) (-1084.867) [-1084.528] (-1082.706) * (-1082.685) (-1082.444) [-1080.896] (-1083.454) -- 0:00:12
794000 -- [-1083.856] (-1086.063) (-1083.420) (-1082.784) * (-1081.987) (-1083.415) [-1082.172] (-1084.213) -- 0:00:12
794500 -- (-1087.537) [-1085.973] (-1085.050) (-1085.600) * (-1082.777) (-1082.642) [-1081.866] (-1081.929) -- 0:00:12
795000 -- (-1084.411) (-1082.793) [-1083.690] (-1083.530) * (-1081.104) (-1082.669) [-1082.532] (-1082.476) -- 0:00:12
Average standard deviation of split frequencies: 0.010364
795500 -- [-1086.484] (-1085.386) (-1083.714) (-1082.795) * (-1081.105) (-1085.002) [-1083.694] (-1084.331) -- 0:00:12
796000 -- (-1083.959) (-1084.160) [-1084.114] (-1082.361) * (-1081.093) (-1087.287) (-1083.248) [-1082.582] -- 0:00:12
796500 -- (-1081.589) (-1082.754) (-1083.885) [-1081.751] * (-1084.946) (-1084.224) [-1082.787] (-1081.745) -- 0:00:12
797000 -- (-1081.423) (-1084.795) (-1084.583) [-1085.991] * (-1084.608) (-1083.904) (-1081.326) [-1085.431] -- 0:00:12
797500 -- (-1084.840) (-1090.904) [-1082.651] (-1083.376) * [-1082.676] (-1086.336) (-1084.316) (-1084.845) -- 0:00:12
798000 -- (-1083.237) [-1085.125] (-1083.302) (-1081.641) * (-1083.290) (-1084.401) (-1084.362) [-1082.489] -- 0:00:12
798500 -- (-1081.605) (-1083.846) [-1081.648] (-1081.279) * (-1083.195) [-1081.546] (-1086.159) (-1081.389) -- 0:00:12
799000 -- (-1082.288) (-1083.174) (-1081.310) [-1081.721] * (-1083.419) (-1084.082) [-1085.487] (-1081.664) -- 0:00:12
799500 -- (-1087.482) [-1081.505] (-1081.168) (-1084.295) * (-1083.522) (-1088.566) (-1083.689) [-1081.959] -- 0:00:12
800000 -- (-1086.633) (-1082.682) [-1082.653] (-1087.020) * (-1082.100) (-1082.131) (-1086.170) [-1082.369] -- 0:00:12
Average standard deviation of split frequencies: 0.010561
800500 -- (-1087.921) (-1081.613) [-1083.728] (-1084.170) * [-1084.119] (-1082.751) (-1084.831) (-1084.560) -- 0:00:12
801000 -- (-1087.286) (-1084.122) (-1081.517) [-1083.010] * (-1089.300) (-1088.243) [-1082.160] (-1084.310) -- 0:00:12
801500 -- (-1084.002) (-1084.456) (-1082.231) [-1085.616] * (-1081.960) (-1084.065) [-1083.000] (-1081.373) -- 0:00:12
802000 -- (-1082.412) (-1082.734) [-1082.555] (-1081.404) * (-1081.404) [-1082.734] (-1085.238) (-1087.944) -- 0:00:12
802500 -- [-1084.208] (-1084.249) (-1081.679) (-1082.264) * [-1081.551] (-1081.937) (-1086.303) (-1085.756) -- 0:00:12
803000 -- (-1081.107) [-1087.603] (-1085.074) (-1083.760) * [-1081.825] (-1086.629) (-1082.996) (-1082.587) -- 0:00:12
803500 -- (-1084.148) [-1083.918] (-1081.842) (-1081.258) * (-1084.011) (-1081.785) (-1086.972) [-1081.659] -- 0:00:11
804000 -- (-1084.675) (-1087.215) [-1082.140] (-1082.402) * (-1084.631) [-1083.014] (-1082.868) (-1084.939) -- 0:00:11
804500 -- (-1083.497) (-1082.892) (-1084.114) [-1083.812] * (-1082.570) (-1082.046) (-1085.749) [-1081.664] -- 0:00:11
805000 -- (-1083.316) (-1082.755) [-1083.465] (-1082.250) * (-1085.803) [-1084.115] (-1080.954) (-1081.562) -- 0:00:11
Average standard deviation of split frequencies: 0.010637
805500 -- (-1083.006) (-1087.277) [-1083.620] (-1082.793) * (-1085.885) (-1083.052) [-1080.925] (-1081.611) -- 0:00:11
806000 -- (-1081.551) [-1085.333] (-1083.606) (-1083.061) * (-1083.968) (-1082.291) (-1081.219) [-1080.961] -- 0:00:11
806500 -- (-1082.307) (-1082.687) (-1081.674) [-1082.412] * (-1082.283) [-1082.079] (-1083.674) (-1082.315) -- 0:00:11
807000 -- (-1081.448) [-1085.489] (-1081.932) (-1085.124) * [-1084.284] (-1081.115) (-1088.062) (-1082.155) -- 0:00:11
807500 -- (-1083.517) (-1082.745) [-1081.586] (-1082.284) * (-1084.417) [-1081.151] (-1083.720) (-1083.484) -- 0:00:11
808000 -- (-1082.005) [-1081.892] (-1082.831) (-1082.185) * (-1085.350) [-1081.141] (-1081.638) (-1084.843) -- 0:00:11
808500 -- (-1082.649) (-1081.580) [-1082.469] (-1082.154) * (-1085.733) [-1081.232] (-1086.731) (-1081.277) -- 0:00:11
809000 -- (-1083.579) (-1085.671) [-1082.786] (-1083.527) * (-1082.237) (-1081.210) (-1084.596) [-1081.826] -- 0:00:11
809500 -- [-1082.507] (-1080.833) (-1081.883) (-1081.185) * (-1084.392) [-1082.764] (-1086.366) (-1083.575) -- 0:00:11
810000 -- [-1082.147] (-1081.288) (-1083.187) (-1080.941) * (-1082.912) [-1085.319] (-1087.136) (-1083.768) -- 0:00:11
Average standard deviation of split frequencies: 0.010721
810500 -- (-1081.646) [-1082.333] (-1082.508) (-1082.922) * (-1082.821) [-1083.483] (-1081.792) (-1084.506) -- 0:00:11
811000 -- [-1081.590] (-1082.887) (-1083.319) (-1081.740) * [-1087.048] (-1083.900) (-1085.396) (-1083.833) -- 0:00:11
811500 -- (-1080.961) (-1082.737) (-1085.814) [-1083.186] * (-1083.584) [-1082.217] (-1084.167) (-1084.157) -- 0:00:11
812000 -- (-1083.949) (-1085.607) (-1084.467) [-1082.267] * (-1083.971) (-1081.209) (-1083.641) [-1085.213] -- 0:00:11
812500 -- [-1085.522] (-1083.003) (-1084.461) (-1082.931) * [-1083.758] (-1083.652) (-1081.446) (-1082.891) -- 0:00:11
813000 -- (-1085.768) (-1084.671) (-1084.726) [-1080.742] * [-1081.540] (-1084.162) (-1081.696) (-1084.756) -- 0:00:11
813500 -- (-1082.280) (-1087.924) (-1082.146) [-1081.626] * [-1081.527] (-1081.072) (-1081.602) (-1083.619) -- 0:00:11
814000 -- (-1085.183) (-1089.199) (-1082.421) [-1081.730] * (-1082.831) (-1081.396) (-1083.342) [-1083.157] -- 0:00:11
814500 -- (-1083.227) [-1088.354] (-1085.199) (-1081.946) * [-1082.317] (-1081.512) (-1083.254) (-1086.741) -- 0:00:11
815000 -- (-1082.230) (-1083.764) [-1083.417] (-1082.559) * [-1082.165] (-1085.666) (-1084.695) (-1084.130) -- 0:00:11
Average standard deviation of split frequencies: 0.010724
815500 -- (-1083.406) [-1084.381] (-1084.844) (-1082.418) * (-1083.137) (-1085.543) (-1083.807) [-1082.237] -- 0:00:11
816000 -- (-1085.984) (-1081.791) [-1083.293] (-1083.668) * (-1082.480) (-1085.930) [-1082.741] (-1084.880) -- 0:00:11
816500 -- [-1083.692] (-1084.045) (-1083.377) (-1082.566) * (-1087.932) (-1082.743) [-1082.115] (-1083.024) -- 0:00:11
817000 -- (-1082.773) [-1083.286] (-1084.326) (-1082.034) * (-1084.084) (-1084.865) [-1082.810] (-1083.156) -- 0:00:11
817500 -- (-1082.352) (-1081.999) (-1084.124) [-1081.202] * [-1086.174] (-1083.048) (-1086.853) (-1081.737) -- 0:00:11
818000 -- (-1083.242) (-1084.876) (-1086.151) [-1083.139] * [-1081.873] (-1083.692) (-1083.251) (-1082.252) -- 0:00:11
818500 -- (-1083.123) [-1081.763] (-1080.988) (-1083.061) * (-1084.867) [-1082.013] (-1083.856) (-1083.385) -- 0:00:11
819000 -- (-1084.104) [-1081.903] (-1087.141) (-1080.992) * (-1085.694) [-1081.316] (-1082.484) (-1083.356) -- 0:00:11
819500 -- (-1084.672) (-1081.566) (-1085.710) [-1081.854] * (-1094.137) (-1081.982) (-1082.481) [-1082.760] -- 0:00:11
820000 -- [-1084.377] (-1081.748) (-1082.943) (-1086.203) * (-1083.319) (-1082.188) [-1082.803] (-1082.560) -- 0:00:10
Average standard deviation of split frequencies: 0.010447
820500 -- [-1085.357] (-1084.755) (-1083.073) (-1083.397) * (-1084.966) [-1083.644] (-1083.086) (-1082.552) -- 0:00:10
821000 -- [-1084.585] (-1085.906) (-1083.402) (-1081.246) * [-1081.791] (-1083.099) (-1084.177) (-1083.368) -- 0:00:10
821500 -- (-1081.645) (-1085.076) (-1083.367) [-1082.086] * (-1088.968) (-1085.293) [-1082.604] (-1083.650) -- 0:00:10
822000 -- (-1084.914) (-1081.578) (-1082.644) [-1081.944] * (-1083.152) (-1085.014) (-1083.013) [-1083.371] -- 0:00:10
822500 -- (-1081.844) [-1082.440] (-1083.349) (-1081.420) * (-1082.926) (-1088.604) [-1082.691] (-1082.875) -- 0:00:10
823000 -- (-1085.777) (-1082.299) [-1081.477] (-1081.905) * [-1084.101] (-1082.720) (-1086.250) (-1082.094) -- 0:00:10
823500 -- (-1085.165) (-1081.063) [-1082.286] (-1084.199) * [-1083.318] (-1081.685) (-1082.667) (-1082.852) -- 0:00:10
824000 -- [-1085.511] (-1081.435) (-1085.322) (-1082.436) * (-1082.438) [-1082.731] (-1087.592) (-1082.132) -- 0:00:10
824500 -- (-1083.652) [-1083.775] (-1084.032) (-1082.186) * (-1082.650) (-1082.294) [-1082.514] (-1081.701) -- 0:00:10
825000 -- [-1084.808] (-1083.443) (-1080.742) (-1082.809) * (-1082.133) [-1081.915] (-1084.047) (-1083.042) -- 0:00:10
Average standard deviation of split frequencies: 0.010130
825500 -- [-1085.076] (-1083.769) (-1082.846) (-1083.451) * (-1084.385) (-1081.614) (-1081.227) [-1085.215] -- 0:00:10
826000 -- (-1082.467) (-1082.345) (-1081.462) [-1082.491] * [-1081.920] (-1083.578) (-1081.839) (-1082.290) -- 0:00:10
826500 -- (-1082.652) (-1082.172) (-1087.119) [-1082.651] * (-1092.428) (-1082.336) [-1083.957] (-1085.392) -- 0:00:10
827000 -- (-1082.162) [-1081.957] (-1085.156) (-1086.162) * (-1086.317) (-1083.891) [-1084.935] (-1082.185) -- 0:00:10
827500 -- (-1080.897) [-1083.071] (-1084.717) (-1085.117) * [-1084.204] (-1081.881) (-1088.476) (-1085.376) -- 0:00:10
828000 -- (-1082.946) (-1082.514) [-1081.209] (-1086.031) * [-1085.655] (-1086.040) (-1082.513) (-1088.292) -- 0:00:10
828500 -- (-1082.123) (-1083.902) [-1082.161] (-1085.097) * (-1088.611) [-1085.004] (-1082.089) (-1082.616) -- 0:00:10
829000 -- (-1083.275) [-1085.115] (-1081.892) (-1084.093) * (-1083.699) (-1083.123) [-1082.506] (-1084.289) -- 0:00:10
829500 -- (-1081.686) [-1085.338] (-1083.330) (-1082.034) * [-1083.005] (-1083.300) (-1085.885) (-1084.220) -- 0:00:10
830000 -- (-1081.572) [-1085.981] (-1084.290) (-1083.722) * [-1083.200] (-1081.904) (-1082.286) (-1082.021) -- 0:00:10
Average standard deviation of split frequencies: 0.009612
830500 -- (-1083.055) (-1088.906) (-1081.793) [-1082.373] * (-1083.093) (-1082.941) (-1082.373) [-1082.060] -- 0:00:10
831000 -- (-1083.559) (-1084.755) (-1081.725) [-1080.927] * (-1082.269) [-1082.337] (-1082.946) (-1086.559) -- 0:00:10
831500 -- [-1083.820] (-1083.516) (-1082.565) (-1081.453) * [-1081.391] (-1086.893) (-1082.524) (-1082.200) -- 0:00:10
832000 -- (-1082.334) (-1082.162) [-1081.015] (-1083.342) * (-1082.013) (-1083.192) [-1082.089] (-1082.771) -- 0:00:10
832500 -- [-1083.381] (-1084.672) (-1081.860) (-1084.141) * (-1082.730) [-1084.533] (-1084.499) (-1081.879) -- 0:00:10
833000 -- (-1083.794) (-1086.133) [-1083.701] (-1083.709) * (-1082.855) [-1083.577] (-1084.739) (-1082.196) -- 0:00:10
833500 -- (-1084.953) (-1082.986) [-1081.862] (-1081.583) * (-1082.645) (-1083.259) (-1082.905) [-1086.420] -- 0:00:10
834000 -- (-1082.843) (-1084.502) (-1080.921) [-1084.191] * (-1085.461) [-1082.236] (-1081.668) (-1082.633) -- 0:00:10
834500 -- (-1084.565) (-1081.648) [-1080.655] (-1082.424) * (-1085.332) (-1082.002) [-1082.077] (-1081.084) -- 0:00:10
835000 -- (-1085.007) (-1082.424) (-1082.177) [-1082.035] * (-1085.689) (-1084.737) [-1083.316] (-1084.965) -- 0:00:10
Average standard deviation of split frequencies: 0.009797
835500 -- (-1084.934) [-1083.443] (-1082.835) (-1084.357) * (-1083.122) [-1083.939] (-1083.995) (-1086.306) -- 0:00:10
836000 -- (-1081.933) (-1082.149) (-1081.636) [-1084.007] * (-1089.669) (-1082.949) [-1086.950] (-1087.780) -- 0:00:10
836500 -- [-1082.598] (-1084.783) (-1081.508) (-1082.143) * (-1081.495) (-1087.034) (-1082.162) [-1084.267] -- 0:00:09
837000 -- (-1083.875) [-1084.212] (-1081.785) (-1083.375) * (-1081.303) (-1083.304) (-1085.006) [-1081.797] -- 0:00:09
837500 -- (-1083.164) [-1084.490] (-1083.768) (-1082.703) * (-1080.908) [-1083.229] (-1082.942) (-1088.680) -- 0:00:09
838000 -- (-1082.823) [-1082.007] (-1088.565) (-1082.801) * (-1083.298) (-1082.959) [-1082.268] (-1084.076) -- 0:00:09
838500 -- [-1084.114] (-1089.251) (-1082.513) (-1082.008) * [-1083.444] (-1085.777) (-1083.172) (-1082.977) -- 0:00:09
839000 -- [-1084.197] (-1084.227) (-1088.807) (-1081.395) * (-1081.630) (-1084.163) [-1082.172] (-1086.222) -- 0:00:09
839500 -- [-1081.943] (-1088.701) (-1084.963) (-1081.838) * [-1081.682] (-1082.524) (-1082.608) (-1086.494) -- 0:00:09
840000 -- (-1082.398) [-1087.691] (-1081.739) (-1081.267) * (-1081.870) (-1084.707) (-1081.684) [-1084.229] -- 0:00:09
Average standard deviation of split frequencies: 0.010654
840500 -- (-1084.392) (-1082.494) [-1081.146] (-1081.813) * (-1082.472) [-1081.508] (-1083.345) (-1083.249) -- 0:00:09
841000 -- (-1083.657) [-1083.749] (-1081.191) (-1081.433) * (-1083.273) (-1082.769) [-1083.037] (-1082.497) -- 0:00:09
841500 -- (-1082.475) (-1082.787) [-1082.216] (-1082.512) * (-1084.293) (-1082.165) (-1081.716) [-1083.939] -- 0:00:09
842000 -- (-1083.327) (-1084.564) (-1084.027) [-1085.373] * [-1084.838] (-1081.901) (-1081.633) (-1084.421) -- 0:00:09
842500 -- [-1081.520] (-1083.928) (-1082.901) (-1082.949) * (-1086.710) (-1084.252) (-1084.172) [-1084.180] -- 0:00:09
843000 -- (-1081.388) (-1083.720) [-1082.838] (-1085.284) * (-1083.146) [-1082.709] (-1081.586) (-1082.634) -- 0:00:09
843500 -- (-1082.552) (-1082.337) (-1082.375) [-1086.146] * [-1082.767] (-1085.896) (-1084.144) (-1084.202) -- 0:00:09
844000 -- (-1083.580) [-1081.794] (-1081.482) (-1085.438) * (-1082.947) (-1080.877) (-1084.274) [-1083.045] -- 0:00:09
844500 -- (-1083.549) (-1081.382) (-1084.091) [-1082.877] * (-1083.542) [-1081.761] (-1082.080) (-1082.083) -- 0:00:09
845000 -- (-1087.336) (-1085.664) (-1082.506) [-1082.876] * [-1082.842] (-1081.696) (-1081.323) (-1086.208) -- 0:00:09
Average standard deviation of split frequencies: 0.010587
845500 -- (-1086.994) (-1083.665) (-1082.957) [-1083.711] * (-1082.308) (-1082.345) (-1082.317) [-1084.093] -- 0:00:09
846000 -- (-1082.600) [-1081.337] (-1082.773) (-1081.871) * (-1082.699) (-1081.716) (-1083.974) [-1082.873] -- 0:00:09
846500 -- [-1083.233] (-1081.402) (-1083.411) (-1087.170) * (-1083.032) (-1082.189) [-1084.529] (-1084.658) -- 0:00:09
847000 -- (-1087.025) (-1081.375) [-1083.329] (-1084.155) * (-1083.732) [-1081.774] (-1082.955) (-1085.145) -- 0:00:09
847500 -- (-1083.380) [-1083.125] (-1082.949) (-1082.700) * (-1084.442) [-1081.096] (-1081.206) (-1082.375) -- 0:00:09
848000 -- [-1083.131] (-1083.301) (-1086.208) (-1085.879) * (-1085.570) (-1084.062) (-1081.168) [-1085.224] -- 0:00:09
848500 -- [-1083.447] (-1082.183) (-1082.434) (-1083.758) * (-1085.777) [-1086.913] (-1082.507) (-1084.836) -- 0:00:09
849000 -- [-1084.699] (-1080.939) (-1082.662) (-1082.569) * (-1082.623) (-1082.720) (-1082.523) [-1083.238] -- 0:00:09
849500 -- (-1082.569) (-1082.176) (-1083.339) [-1082.169] * [-1081.284] (-1082.876) (-1081.101) (-1082.585) -- 0:00:09
850000 -- [-1082.553] (-1083.170) (-1084.855) (-1081.601) * [-1081.207] (-1083.698) (-1081.692) (-1082.492) -- 0:00:09
Average standard deviation of split frequencies: 0.010757
850500 -- (-1083.819) (-1081.241) [-1082.559] (-1082.802) * [-1083.912] (-1082.726) (-1085.117) (-1083.515) -- 0:00:09
851000 -- (-1084.969) (-1082.510) [-1083.484] (-1081.989) * (-1082.706) (-1085.437) (-1082.009) [-1081.443] -- 0:00:09
851500 -- (-1083.291) [-1083.337] (-1086.940) (-1085.977) * [-1083.544] (-1081.605) (-1081.374) (-1084.867) -- 0:00:09
852000 -- [-1086.200] (-1085.021) (-1085.167) (-1085.088) * (-1084.221) (-1083.391) [-1081.547] (-1084.810) -- 0:00:09
852500 -- (-1082.481) (-1086.307) [-1081.143] (-1087.031) * [-1088.622] (-1086.772) (-1082.451) (-1085.231) -- 0:00:08
853000 -- (-1082.403) (-1084.822) [-1081.618] (-1087.163) * (-1083.598) [-1083.800] (-1082.454) (-1083.531) -- 0:00:08
853500 -- (-1082.642) (-1082.376) (-1083.190) [-1082.985] * (-1082.187) (-1086.787) (-1082.597) [-1083.339] -- 0:00:08
854000 -- (-1082.251) (-1083.905) (-1084.214) [-1082.569] * [-1082.536] (-1084.435) (-1085.135) (-1083.343) -- 0:00:08
854500 -- (-1082.575) [-1086.079] (-1085.163) (-1082.638) * [-1081.671] (-1081.682) (-1083.995) (-1086.548) -- 0:00:08
855000 -- [-1082.045] (-1081.465) (-1090.669) (-1082.486) * [-1082.761] (-1082.995) (-1083.711) (-1084.136) -- 0:00:08
Average standard deviation of split frequencies: 0.010885
855500 -- (-1083.420) [-1081.860] (-1082.059) (-1082.947) * (-1085.258) (-1080.750) [-1085.047] (-1084.456) -- 0:00:08
856000 -- (-1084.394) [-1081.345] (-1082.647) (-1082.036) * (-1085.796) [-1081.409] (-1082.544) (-1085.663) -- 0:00:08
856500 -- [-1082.551] (-1085.083) (-1087.217) (-1082.924) * (-1085.220) [-1084.068] (-1082.992) (-1083.978) -- 0:00:08
857000 -- (-1083.220) [-1083.089] (-1084.866) (-1083.460) * (-1082.265) (-1084.633) (-1081.380) [-1081.572] -- 0:00:08
857500 -- (-1084.157) (-1084.790) (-1082.957) [-1082.604] * (-1081.285) (-1085.801) [-1082.207] (-1084.846) -- 0:00:08
858000 -- [-1084.555] (-1085.371) (-1083.057) (-1082.280) * (-1084.286) (-1082.021) [-1081.879] (-1083.495) -- 0:00:08
858500 -- (-1084.065) (-1085.757) (-1082.122) [-1081.342] * (-1081.417) (-1082.537) (-1083.088) [-1082.617] -- 0:00:08
859000 -- (-1084.070) [-1084.566] (-1084.102) (-1084.819) * [-1081.644] (-1084.495) (-1081.897) (-1086.611) -- 0:00:08
859500 -- (-1083.788) (-1082.726) [-1081.890] (-1081.582) * (-1081.813) (-1083.016) [-1081.699] (-1083.651) -- 0:00:08
860000 -- [-1083.226] (-1081.528) (-1084.935) (-1083.173) * (-1082.790) [-1080.945] (-1081.199) (-1085.990) -- 0:00:08
Average standard deviation of split frequencies: 0.010826
860500 -- (-1081.136) (-1082.191) [-1083.101] (-1085.469) * [-1082.411] (-1081.520) (-1080.665) (-1084.965) -- 0:00:08
861000 -- (-1083.951) [-1083.798] (-1085.523) (-1085.538) * (-1082.571) (-1083.043) [-1080.674] (-1083.001) -- 0:00:08
861500 -- (-1084.287) (-1080.975) (-1086.199) [-1082.375] * (-1081.704) (-1083.201) [-1081.321] (-1082.239) -- 0:00:08
862000 -- [-1086.037] (-1080.904) (-1088.758) (-1080.943) * (-1080.886) (-1081.603) [-1081.648] (-1081.784) -- 0:00:08
862500 -- (-1083.586) (-1083.615) (-1081.935) [-1082.589] * (-1081.629) [-1083.162] (-1081.134) (-1085.796) -- 0:00:08
863000 -- [-1085.638] (-1082.047) (-1082.459) (-1087.062) * (-1082.334) (-1083.777) [-1086.214] (-1084.548) -- 0:00:08
863500 -- (-1081.060) (-1083.544) (-1085.686) [-1081.838] * (-1085.701) (-1080.861) [-1082.013] (-1081.727) -- 0:00:08
864000 -- (-1081.453) (-1081.072) (-1083.230) [-1081.413] * (-1088.843) (-1080.894) [-1081.248] (-1082.044) -- 0:00:08
864500 -- (-1081.790) (-1081.193) (-1083.151) [-1084.734] * [-1083.178] (-1082.036) (-1082.948) (-1081.787) -- 0:00:08
865000 -- (-1082.583) [-1083.720] (-1084.705) (-1082.384) * (-1083.241) (-1085.459) [-1085.117] (-1085.954) -- 0:00:08
Average standard deviation of split frequencies: 0.010471
865500 -- (-1083.357) (-1083.419) [-1084.908] (-1085.605) * [-1082.696] (-1082.359) (-1084.555) (-1085.393) -- 0:00:08
866000 -- [-1082.178] (-1082.698) (-1082.546) (-1083.613) * (-1082.759) [-1083.976] (-1086.870) (-1082.661) -- 0:00:08
866500 -- [-1081.959] (-1084.488) (-1083.451) (-1083.500) * (-1082.708) (-1083.213) [-1082.252] (-1083.304) -- 0:00:08
867000 -- (-1082.448) (-1083.041) [-1084.057] (-1082.070) * (-1081.715) [-1082.694] (-1082.506) (-1083.724) -- 0:00:08
867500 -- (-1080.784) (-1081.817) (-1082.944) [-1083.109] * (-1081.926) [-1081.635] (-1084.925) (-1082.462) -- 0:00:08
868000 -- (-1081.547) [-1081.905] (-1085.534) (-1085.014) * [-1083.181] (-1084.014) (-1082.257) (-1082.513) -- 0:00:08
868500 -- [-1086.960] (-1082.629) (-1081.883) (-1083.933) * (-1083.478) (-1083.249) [-1081.428] (-1083.544) -- 0:00:08
869000 -- [-1083.467] (-1082.536) (-1081.558) (-1082.165) * [-1084.560] (-1084.112) (-1081.908) (-1082.619) -- 0:00:07
869500 -- (-1083.271) [-1083.850] (-1084.033) (-1085.682) * [-1086.313] (-1086.350) (-1081.648) (-1084.286) -- 0:00:07
870000 -- (-1082.181) (-1086.255) (-1084.017) [-1085.572] * [-1083.945] (-1083.994) (-1082.820) (-1085.206) -- 0:00:07
Average standard deviation of split frequencies: 0.010574
870500 -- (-1082.194) (-1083.099) [-1083.025] (-1083.928) * (-1085.369) (-1083.516) (-1087.389) [-1083.300] -- 0:00:07
871000 -- (-1082.728) (-1081.351) [-1084.434] (-1092.742) * [-1082.212] (-1089.627) (-1081.233) (-1081.984) -- 0:00:07
871500 -- (-1082.020) (-1081.056) (-1087.758) [-1083.015] * [-1083.449] (-1082.934) (-1082.325) (-1083.922) -- 0:00:07
872000 -- (-1083.056) (-1081.467) [-1086.569] (-1081.547) * (-1086.453) (-1082.716) (-1080.995) [-1084.258] -- 0:00:07
872500 -- (-1090.948) (-1083.479) (-1082.860) [-1080.914] * (-1084.210) (-1082.280) (-1081.380) [-1082.662] -- 0:00:07
873000 -- (-1084.613) (-1086.839) (-1083.341) [-1081.312] * (-1082.885) (-1081.682) [-1081.683] (-1082.535) -- 0:00:07
873500 -- (-1083.699) (-1085.056) (-1081.204) [-1081.875] * (-1081.894) [-1081.587] (-1081.773) (-1083.137) -- 0:00:07
874000 -- (-1083.675) (-1085.676) (-1080.763) [-1083.119] * (-1081.934) (-1082.375) (-1081.490) [-1081.821] -- 0:00:07
874500 -- [-1084.605] (-1081.816) (-1082.791) (-1083.551) * [-1084.106] (-1084.800) (-1081.612) (-1083.792) -- 0:00:07
875000 -- (-1083.505) [-1082.544] (-1084.622) (-1084.043) * [-1083.566] (-1081.622) (-1081.585) (-1081.808) -- 0:00:07
Average standard deviation of split frequencies: 0.010699
875500 -- (-1083.362) [-1083.771] (-1083.881) (-1083.947) * (-1084.698) [-1081.557] (-1085.781) (-1082.890) -- 0:00:07
876000 -- [-1084.258] (-1083.542) (-1083.300) (-1083.453) * (-1085.209) (-1081.253) (-1082.450) [-1082.841] -- 0:00:07
876500 -- [-1082.530] (-1084.661) (-1081.224) (-1085.314) * [-1083.416] (-1081.870) (-1083.168) (-1083.460) -- 0:00:07
877000 -- (-1084.840) (-1081.646) (-1081.145) [-1081.759] * (-1084.786) (-1082.091) [-1085.687] (-1084.089) -- 0:00:07
877500 -- (-1085.445) [-1083.417] (-1085.550) (-1081.490) * (-1086.113) (-1082.011) [-1081.931] (-1089.359) -- 0:00:07
878000 -- (-1085.318) [-1081.886] (-1082.112) (-1082.923) * (-1083.516) (-1086.711) (-1081.005) [-1083.913] -- 0:00:07
878500 -- (-1083.237) [-1081.160] (-1083.234) (-1081.134) * (-1087.885) [-1082.305] (-1082.993) (-1083.010) -- 0:00:07
879000 -- (-1083.240) (-1082.313) (-1083.711) [-1081.363] * (-1090.978) (-1084.377) (-1081.332) [-1084.661] -- 0:00:07
879500 -- (-1083.194) (-1084.969) (-1081.314) [-1082.019] * (-1090.293) [-1082.978] (-1081.557) (-1082.476) -- 0:00:07
880000 -- (-1081.504) (-1084.381) [-1082.866] (-1082.231) * (-1087.832) (-1084.511) [-1080.813] (-1084.541) -- 0:00:07
Average standard deviation of split frequencies: 0.010769
880500 -- (-1081.568) (-1083.056) (-1082.141) [-1081.627] * (-1083.351) (-1083.132) (-1082.951) [-1084.376] -- 0:00:07
881000 -- (-1081.867) (-1083.528) [-1081.724] (-1081.592) * (-1085.687) (-1084.352) [-1084.008] (-1084.496) -- 0:00:07
881500 -- (-1082.686) (-1085.496) [-1082.868] (-1081.139) * (-1081.739) (-1081.371) (-1083.148) [-1083.270] -- 0:00:07
882000 -- (-1084.129) (-1083.635) (-1085.905) [-1081.350] * [-1086.212] (-1081.800) (-1081.767) (-1082.260) -- 0:00:07
882500 -- [-1082.563] (-1081.121) (-1084.107) (-1082.813) * (-1082.447) [-1082.280] (-1083.775) (-1080.804) -- 0:00:07
883000 -- (-1082.050) (-1083.578) [-1083.517] (-1081.159) * [-1081.520] (-1082.247) (-1081.805) (-1081.832) -- 0:00:07
883500 -- (-1087.493) (-1083.170) [-1082.993] (-1087.239) * (-1082.230) [-1084.561] (-1083.294) (-1084.744) -- 0:00:07
884000 -- (-1085.165) (-1082.805) [-1082.035] (-1085.495) * (-1085.342) (-1082.969) (-1083.716) [-1083.438] -- 0:00:07
884500 -- (-1085.318) (-1083.668) [-1081.905] (-1086.898) * (-1083.476) (-1081.260) [-1082.181] (-1084.793) -- 0:00:07
885000 -- [-1081.334] (-1082.584) (-1081.758) (-1085.716) * [-1081.383] (-1082.712) (-1082.500) (-1085.544) -- 0:00:07
Average standard deviation of split frequencies: 0.010829
885500 -- (-1081.805) (-1085.424) (-1084.259) [-1083.277] * (-1081.800) [-1082.550] (-1082.854) (-1082.633) -- 0:00:06
886000 -- (-1083.263) (-1084.996) (-1082.129) [-1082.086] * (-1084.011) [-1085.167] (-1089.956) (-1083.203) -- 0:00:06
886500 -- (-1085.990) (-1082.010) (-1082.490) [-1081.773] * (-1083.067) (-1082.982) (-1090.489) [-1082.129] -- 0:00:06
887000 -- (-1084.214) (-1082.820) (-1085.789) [-1081.187] * [-1082.362] (-1081.992) (-1085.435) (-1085.104) -- 0:00:06
887500 -- (-1086.245) [-1083.767] (-1083.360) (-1081.609) * (-1084.382) (-1082.792) [-1082.788] (-1083.791) -- 0:00:06
888000 -- (-1086.406) [-1083.178] (-1082.674) (-1082.959) * (-1086.289) (-1083.631) (-1085.190) [-1083.658] -- 0:00:06
888500 -- (-1084.777) (-1083.302) [-1082.829] (-1083.514) * (-1086.611) (-1081.232) (-1082.961) [-1081.302] -- 0:00:06
889000 -- (-1082.668) (-1084.617) [-1083.224] (-1084.347) * (-1082.877) (-1082.156) [-1082.911] (-1083.467) -- 0:00:06
889500 -- (-1082.377) [-1082.825] (-1082.633) (-1081.300) * [-1083.228] (-1081.320) (-1083.157) (-1084.001) -- 0:00:06
890000 -- (-1083.839) (-1083.996) [-1083.228] (-1081.579) * (-1083.658) (-1081.688) (-1084.241) [-1083.907] -- 0:00:06
Average standard deviation of split frequencies: 0.010897
890500 -- (-1085.145) (-1084.565) [-1082.834] (-1083.095) * (-1081.683) [-1082.045] (-1082.080) (-1084.110) -- 0:00:06
891000 -- (-1081.299) [-1081.352] (-1083.891) (-1083.951) * (-1083.396) (-1083.663) [-1081.764] (-1081.699) -- 0:00:06
891500 -- (-1082.700) (-1084.631) [-1083.524] (-1084.498) * (-1084.494) [-1083.183] (-1081.963) (-1083.080) -- 0:00:06
892000 -- (-1088.121) (-1081.689) (-1081.822) [-1081.808] * (-1082.523) [-1083.294] (-1082.724) (-1082.520) -- 0:00:06
892500 -- (-1082.930) [-1083.371] (-1082.071) (-1083.496) * [-1081.977] (-1087.867) (-1084.851) (-1083.432) -- 0:00:06
893000 -- [-1083.784] (-1083.900) (-1083.915) (-1082.082) * (-1085.577) (-1082.807) (-1082.184) [-1083.505] -- 0:00:06
893500 -- (-1083.400) [-1082.405] (-1081.882) (-1081.723) * (-1081.800) (-1082.004) [-1082.101] (-1084.344) -- 0:00:06
894000 -- (-1087.771) (-1084.902) (-1085.842) [-1081.309] * [-1082.909] (-1082.586) (-1087.667) (-1083.590) -- 0:00:06
894500 -- [-1081.557] (-1086.812) (-1085.998) (-1083.710) * (-1082.961) (-1083.004) (-1088.114) [-1082.709] -- 0:00:06
895000 -- (-1081.841) [-1085.124] (-1083.665) (-1082.857) * (-1081.353) [-1081.665] (-1082.777) (-1081.823) -- 0:00:06
Average standard deviation of split frequencies: 0.010956
895500 -- (-1082.099) [-1081.250] (-1085.374) (-1083.087) * (-1082.685) (-1082.529) (-1083.240) [-1081.984] -- 0:00:06
896000 -- (-1083.583) [-1081.328] (-1086.590) (-1082.160) * (-1083.091) (-1087.306) (-1081.841) [-1084.722] -- 0:00:06
896500 -- (-1084.551) [-1081.656] (-1084.910) (-1082.515) * [-1083.127] (-1082.873) (-1081.420) (-1084.560) -- 0:00:06
897000 -- (-1082.847) (-1082.723) (-1082.653) [-1081.602] * (-1084.231) (-1082.822) [-1085.302] (-1084.689) -- 0:00:06
897500 -- [-1082.134] (-1081.827) (-1082.728) (-1086.334) * (-1082.601) (-1082.464) (-1083.700) [-1082.852] -- 0:00:06
898000 -- (-1082.482) [-1081.052] (-1082.953) (-1083.968) * [-1085.143] (-1082.140) (-1084.087) (-1081.285) -- 0:00:06
898500 -- (-1082.993) (-1083.634) [-1081.398] (-1084.707) * (-1084.259) (-1081.380) (-1083.157) [-1081.282] -- 0:00:06
899000 -- (-1081.946) (-1084.628) (-1082.748) [-1089.488] * (-1084.767) (-1082.701) [-1081.226] (-1083.329) -- 0:00:06
899500 -- (-1082.157) (-1087.180) [-1083.269] (-1087.220) * [-1083.613] (-1083.484) (-1081.359) (-1084.099) -- 0:00:06
900000 -- (-1082.005) (-1086.958) (-1083.944) [-1086.612] * (-1083.679) (-1083.661) [-1081.192] (-1082.321) -- 0:00:06
Average standard deviation of split frequencies: 0.010304
900500 -- (-1083.932) [-1084.584] (-1085.984) (-1083.512) * (-1083.959) [-1082.479] (-1083.359) (-1082.014) -- 0:00:06
901000 -- (-1086.550) (-1085.644) [-1085.775] (-1083.390) * (-1084.529) (-1090.115) (-1082.323) [-1085.547] -- 0:00:06
901500 -- (-1083.654) (-1084.136) (-1088.807) [-1083.694] * (-1085.185) [-1081.859] (-1082.887) (-1087.794) -- 0:00:06
902000 -- [-1081.518] (-1081.241) (-1085.711) (-1082.385) * (-1086.504) [-1082.424] (-1082.656) (-1086.520) -- 0:00:05
902500 -- (-1081.430) (-1082.365) (-1082.838) [-1082.295] * (-1083.134) (-1084.349) [-1085.465] (-1086.035) -- 0:00:05
903000 -- [-1081.890] (-1082.624) (-1082.310) (-1082.589) * [-1082.314] (-1082.177) (-1082.525) (-1090.696) -- 0:00:05
903500 -- (-1082.598) [-1082.958] (-1085.568) (-1084.286) * (-1082.446) (-1081.037) [-1082.730] (-1086.498) -- 0:00:05
904000 -- (-1084.107) (-1082.724) [-1081.268] (-1082.982) * (-1082.582) [-1081.519] (-1082.902) (-1086.440) -- 0:00:05
904500 -- (-1081.932) (-1084.265) (-1082.713) [-1082.988] * (-1083.052) (-1081.738) (-1083.545) [-1083.628] -- 0:00:05
905000 -- (-1081.969) (-1085.062) (-1082.898) [-1081.858] * (-1083.482) [-1081.221] (-1083.603) (-1082.795) -- 0:00:05
Average standard deviation of split frequencies: 0.010439
905500 -- (-1084.458) (-1088.607) (-1085.759) [-1083.274] * (-1080.696) (-1081.054) (-1083.951) [-1083.838] -- 0:00:05
906000 -- (-1085.234) [-1082.089] (-1082.040) (-1081.279) * (-1081.342) (-1081.171) [-1086.464] (-1083.787) -- 0:00:05
906500 -- (-1082.712) (-1082.807) [-1081.918] (-1085.572) * (-1086.388) [-1083.061] (-1085.496) (-1084.847) -- 0:00:05
907000 -- (-1083.910) (-1087.683) (-1082.106) [-1081.577] * (-1089.920) [-1083.850] (-1082.804) (-1083.847) -- 0:00:05
907500 -- (-1082.294) (-1087.535) [-1081.608] (-1082.886) * (-1083.515) [-1087.096] (-1082.157) (-1084.988) -- 0:00:05
908000 -- [-1083.460] (-1089.713) (-1081.616) (-1083.469) * (-1084.145) (-1085.506) (-1083.770) [-1082.700] -- 0:00:05
908500 -- (-1082.127) (-1085.051) (-1082.927) [-1082.323] * [-1083.399] (-1082.052) (-1082.750) (-1084.513) -- 0:00:05
909000 -- (-1087.256) (-1088.209) (-1081.232) [-1085.146] * (-1085.732) [-1081.438] (-1081.786) (-1084.449) -- 0:00:05
909500 -- [-1081.202] (-1089.230) (-1081.856) (-1086.491) * (-1085.750) (-1082.211) (-1086.091) [-1083.838] -- 0:00:05
910000 -- (-1082.536) (-1081.629) (-1081.053) [-1084.479] * (-1081.344) (-1083.621) [-1081.358] (-1084.976) -- 0:00:05
Average standard deviation of split frequencies: 0.011053
910500 -- (-1083.297) [-1082.114] (-1081.035) (-1081.468) * (-1081.324) (-1081.490) [-1080.830] (-1083.148) -- 0:00:05
911000 -- (-1082.998) [-1082.413] (-1086.164) (-1081.415) * (-1082.044) [-1081.565] (-1082.188) (-1082.660) -- 0:00:05
911500 -- [-1082.860] (-1082.883) (-1081.854) (-1082.655) * [-1081.373] (-1083.821) (-1081.712) (-1082.990) -- 0:00:05
912000 -- [-1084.524] (-1082.960) (-1081.758) (-1083.947) * [-1083.479] (-1084.370) (-1082.088) (-1081.376) -- 0:00:05
912500 -- (-1083.955) (-1082.899) [-1083.947] (-1083.143) * (-1085.151) [-1083.395] (-1081.555) (-1082.939) -- 0:00:05
913000 -- (-1081.439) (-1083.751) [-1087.212] (-1089.125) * (-1086.754) (-1083.691) (-1083.412) [-1081.311] -- 0:00:05
913500 -- (-1085.010) [-1081.892] (-1085.754) (-1087.112) * (-1084.644) [-1081.533] (-1083.933) (-1082.200) -- 0:00:05
914000 -- (-1085.946) (-1082.769) (-1084.126) [-1082.978] * [-1081.769] (-1085.187) (-1082.336) (-1081.045) -- 0:00:05
914500 -- [-1086.284] (-1083.627) (-1082.134) (-1082.527) * (-1083.242) (-1083.573) [-1083.857] (-1084.339) -- 0:00:05
915000 -- [-1080.977] (-1084.014) (-1083.139) (-1084.407) * [-1082.262] (-1082.476) (-1083.933) (-1081.109) -- 0:00:05
Average standard deviation of split frequencies: 0.010807
915500 -- (-1082.571) (-1084.704) [-1084.741] (-1085.718) * (-1085.165) [-1085.647] (-1084.437) (-1085.218) -- 0:00:05
916000 -- (-1091.057) [-1082.857] (-1082.292) (-1081.697) * [-1083.511] (-1083.975) (-1088.871) (-1084.622) -- 0:00:05
916500 -- (-1083.501) (-1082.483) (-1084.838) [-1081.295] * (-1083.775) (-1085.301) (-1088.104) [-1082.610] -- 0:00:05
917000 -- (-1082.446) [-1081.939] (-1084.551) (-1081.572) * (-1084.540) (-1083.948) [-1084.192] (-1082.640) -- 0:00:05
917500 -- (-1082.446) (-1082.756) [-1083.106] (-1082.163) * (-1081.871) (-1086.809) (-1086.365) [-1082.138] -- 0:00:05
918000 -- (-1082.310) (-1082.310) (-1082.381) [-1083.482] * (-1083.229) (-1091.580) [-1082.040] (-1083.227) -- 0:00:05
918500 -- [-1081.541] (-1081.897) (-1081.444) (-1083.938) * (-1082.104) (-1085.489) (-1083.483) [-1082.201] -- 0:00:04
919000 -- (-1081.759) (-1083.467) [-1082.014] (-1082.840) * (-1084.462) (-1081.331) [-1081.782] (-1080.967) -- 0:00:04
919500 -- (-1083.480) [-1083.864] (-1081.316) (-1086.496) * (-1082.069) (-1081.197) [-1081.657] (-1082.571) -- 0:00:04
920000 -- (-1081.935) (-1081.051) [-1084.745] (-1083.258) * (-1082.961) [-1083.702] (-1086.943) (-1083.726) -- 0:00:04
Average standard deviation of split frequencies: 0.010873
920500 -- (-1083.493) (-1081.441) (-1081.199) [-1080.877] * [-1082.717] (-1087.017) (-1086.018) (-1082.102) -- 0:00:04
921000 -- (-1088.571) (-1083.965) (-1082.365) [-1083.081] * (-1087.822) [-1083.374] (-1082.086) (-1083.817) -- 0:00:04
921500 -- (-1082.293) (-1085.006) [-1084.016] (-1083.417) * (-1082.528) [-1084.364] (-1082.116) (-1082.745) -- 0:00:04
922000 -- (-1082.564) (-1084.364) [-1082.564] (-1082.690) * (-1082.134) (-1082.977) (-1083.593) [-1082.933] -- 0:00:04
922500 -- (-1082.368) (-1082.766) (-1082.364) [-1082.725] * (-1085.170) (-1083.312) (-1083.396) [-1081.192] -- 0:00:04
923000 -- (-1083.596) [-1082.094] (-1084.901) (-1082.967) * (-1083.194) (-1081.324) [-1084.949] (-1085.001) -- 0:00:04
923500 -- (-1084.528) (-1081.186) (-1089.024) [-1081.656] * (-1086.832) (-1087.362) (-1083.121) [-1085.563] -- 0:00:04
924000 -- [-1084.101] (-1082.109) (-1090.208) (-1084.018) * (-1084.243) [-1083.431] (-1084.688) (-1083.698) -- 0:00:04
924500 -- (-1081.696) [-1083.294] (-1085.334) (-1085.929) * [-1084.434] (-1084.337) (-1083.011) (-1082.889) -- 0:00:04
925000 -- (-1081.353) (-1082.036) (-1084.083) [-1083.292] * [-1084.564] (-1085.487) (-1084.618) (-1085.510) -- 0:00:04
Average standard deviation of split frequencies: 0.010840
925500 -- (-1081.770) (-1082.223) (-1086.031) [-1083.496] * [-1083.716] (-1084.513) (-1081.895) (-1084.117) -- 0:00:04
926000 -- (-1081.740) (-1082.203) [-1083.182] (-1083.759) * (-1086.099) [-1084.731] (-1083.044) (-1089.660) -- 0:00:04
926500 -- (-1083.533) (-1084.359) [-1082.314] (-1085.258) * (-1084.308) (-1084.423) (-1090.779) [-1081.646] -- 0:00:04
927000 -- [-1082.204] (-1084.049) (-1086.349) (-1084.319) * [-1081.954] (-1087.359) (-1089.475) (-1081.496) -- 0:00:04
927500 -- [-1080.880] (-1081.655) (-1086.027) (-1084.658) * (-1081.162) [-1081.356] (-1090.391) (-1083.085) -- 0:00:04
928000 -- (-1083.915) (-1085.160) (-1087.216) [-1083.029] * (-1083.586) [-1081.796] (-1085.626) (-1082.240) -- 0:00:04
928500 -- (-1086.539) (-1085.514) (-1081.878) [-1084.590] * [-1084.245] (-1084.591) (-1083.875) (-1085.879) -- 0:00:04
929000 -- [-1082.891] (-1081.774) (-1082.391) (-1083.627) * (-1091.109) (-1081.178) (-1085.059) [-1088.242] -- 0:00:04
929500 -- [-1082.763] (-1082.752) (-1083.218) (-1081.742) * (-1085.116) (-1081.202) (-1082.566) [-1082.774] -- 0:00:04
930000 -- (-1084.262) (-1083.580) [-1083.253] (-1082.290) * (-1086.628) (-1082.251) [-1083.045] (-1081.657) -- 0:00:04
Average standard deviation of split frequencies: 0.010922
930500 -- (-1084.698) (-1082.590) (-1084.676) [-1083.917] * (-1081.456) (-1083.297) (-1085.257) [-1083.176] -- 0:00:04
931000 -- (-1083.624) (-1082.263) [-1082.557] (-1082.313) * (-1083.499) (-1081.382) (-1081.944) [-1085.778] -- 0:00:04
931500 -- (-1081.296) (-1084.850) [-1082.324] (-1082.129) * [-1085.143] (-1084.625) (-1083.849) (-1084.485) -- 0:00:04
932000 -- (-1081.074) (-1082.573) [-1085.214] (-1085.478) * (-1084.807) (-1082.571) (-1083.383) [-1083.292] -- 0:00:04
932500 -- (-1080.875) [-1085.994] (-1083.842) (-1085.733) * (-1082.078) (-1082.926) [-1088.724] (-1083.781) -- 0:00:04
933000 -- [-1081.832] (-1081.910) (-1086.050) (-1084.655) * [-1081.626] (-1083.956) (-1088.471) (-1085.423) -- 0:00:04
933500 -- (-1085.052) (-1088.252) (-1083.819) [-1085.663] * (-1081.633) [-1083.800] (-1085.710) (-1082.618) -- 0:00:04
934000 -- (-1086.532) (-1082.658) [-1083.380] (-1082.907) * (-1082.653) [-1083.373] (-1081.540) (-1083.349) -- 0:00:04
934500 -- (-1085.507) (-1083.784) [-1082.360] (-1081.362) * (-1081.654) [-1081.369] (-1081.623) (-1081.448) -- 0:00:03
935000 -- (-1082.836) (-1083.920) (-1082.051) [-1080.983] * [-1082.806] (-1082.827) (-1083.663) (-1083.035) -- 0:00:03
Average standard deviation of split frequencies: 0.010677
935500 -- (-1081.926) (-1084.437) [-1084.114] (-1081.481) * (-1081.577) (-1081.275) (-1084.147) [-1084.747] -- 0:00:03
936000 -- [-1082.691] (-1086.705) (-1086.378) (-1087.062) * [-1081.883] (-1082.049) (-1082.506) (-1086.485) -- 0:00:03
936500 -- (-1082.550) (-1082.014) (-1080.780) [-1083.656] * (-1081.760) (-1082.013) [-1081.082] (-1086.211) -- 0:00:03
937000 -- (-1082.638) (-1081.749) (-1085.454) [-1084.960] * (-1082.320) [-1081.229] (-1082.195) (-1083.046) -- 0:00:03
937500 -- [-1082.569] (-1083.129) (-1084.222) (-1083.759) * (-1085.219) (-1082.583) (-1081.638) [-1083.765] -- 0:00:03
938000 -- (-1083.195) (-1082.528) (-1083.838) [-1081.343] * (-1084.274) (-1084.330) [-1081.658] (-1083.678) -- 0:00:03
938500 -- [-1083.887] (-1081.984) (-1081.420) (-1081.248) * (-1086.603) (-1082.654) (-1084.086) [-1084.220] -- 0:00:03
939000 -- (-1082.765) (-1084.895) [-1082.409] (-1084.117) * (-1081.681) [-1082.301] (-1084.239) (-1081.400) -- 0:00:03
939500 -- (-1082.779) (-1081.950) (-1082.098) [-1084.143] * (-1082.137) (-1085.202) [-1084.356] (-1081.482) -- 0:00:03
940000 -- [-1084.143] (-1082.619) (-1081.635) (-1082.066) * (-1084.216) (-1083.830) [-1082.088] (-1082.434) -- 0:00:03
Average standard deviation of split frequencies: 0.010357
940500 -- (-1086.533) (-1084.747) (-1081.490) [-1081.869] * (-1083.701) [-1082.711] (-1081.142) (-1082.966) -- 0:00:03
941000 -- [-1086.174] (-1081.235) (-1084.162) (-1081.959) * (-1082.106) (-1081.466) (-1082.596) [-1083.701] -- 0:00:03
941500 -- (-1084.414) (-1084.413) [-1081.832] (-1084.806) * (-1084.607) [-1082.917] (-1082.224) (-1088.310) -- 0:00:03
942000 -- [-1082.489] (-1084.154) (-1083.666) (-1085.285) * (-1083.929) [-1082.881] (-1081.294) (-1084.827) -- 0:00:03
942500 -- (-1082.672) (-1083.880) [-1082.575] (-1087.145) * (-1082.071) [-1083.706] (-1086.023) (-1085.804) -- 0:00:03
943000 -- (-1082.158) (-1086.942) (-1083.407) [-1083.953] * (-1081.772) (-1083.106) (-1085.487) [-1081.921] -- 0:00:03
943500 -- (-1081.692) (-1082.279) [-1085.458] (-1083.684) * (-1084.791) (-1083.499) (-1082.985) [-1082.789] -- 0:00:03
944000 -- (-1082.201) [-1082.736] (-1082.546) (-1083.635) * (-1082.888) (-1081.914) [-1088.120] (-1085.300) -- 0:00:03
944500 -- (-1083.329) (-1085.718) [-1082.486] (-1085.091) * [-1082.319] (-1085.849) (-1084.319) (-1081.549) -- 0:00:03
945000 -- (-1084.082) (-1084.867) (-1082.149) [-1082.833] * [-1082.257] (-1083.005) (-1084.615) (-1083.199) -- 0:00:03
Average standard deviation of split frequencies: 0.010932
945500 -- (-1081.264) [-1086.689] (-1083.935) (-1081.555) * (-1085.633) (-1085.873) (-1083.536) [-1082.303] -- 0:00:03
946000 -- (-1082.169) (-1088.216) (-1084.153) [-1082.973] * (-1086.071) (-1082.171) (-1082.874) [-1082.191] -- 0:00:03
946500 -- [-1082.220] (-1083.891) (-1081.165) (-1085.562) * (-1084.444) (-1082.706) (-1081.596) [-1081.244] -- 0:00:03
947000 -- (-1083.512) (-1087.004) (-1084.014) [-1084.474] * [-1083.301] (-1084.025) (-1084.332) (-1083.154) -- 0:00:03
947500 -- (-1082.657) (-1082.893) (-1084.671) [-1082.574] * (-1083.682) (-1088.280) [-1081.551] (-1082.815) -- 0:00:03
948000 -- (-1083.091) (-1083.569) [-1082.461] (-1081.881) * [-1087.112] (-1082.793) (-1083.415) (-1084.491) -- 0:00:03
948500 -- (-1084.637) (-1088.155) (-1082.661) [-1083.019] * (-1084.875) (-1083.909) [-1086.138] (-1084.282) -- 0:00:03
949000 -- [-1083.129] (-1082.321) (-1086.753) (-1088.521) * (-1084.708) [-1081.779] (-1083.756) (-1084.288) -- 0:00:03
949500 -- [-1081.783] (-1082.205) (-1082.268) (-1082.768) * (-1082.187) (-1083.071) (-1081.652) [-1084.885] -- 0:00:03
950000 -- (-1084.838) (-1083.457) (-1082.054) [-1081.905] * (-1084.511) (-1081.084) (-1083.287) [-1083.564] -- 0:00:03
Average standard deviation of split frequencies: 0.011095
950500 -- (-1083.935) [-1081.833] (-1081.318) (-1084.417) * (-1084.567) (-1081.726) (-1081.209) [-1083.625] -- 0:00:03
951000 -- (-1082.471) (-1082.809) [-1082.703] (-1082.022) * (-1084.837) (-1082.834) [-1083.704] (-1082.440) -- 0:00:02
951500 -- (-1081.347) (-1082.697) [-1081.431] (-1081.846) * (-1087.324) (-1082.663) (-1082.876) [-1083.777] -- 0:00:02
952000 -- (-1084.061) (-1084.528) [-1082.162] (-1082.759) * (-1082.252) (-1081.387) [-1082.418] (-1083.237) -- 0:00:02
952500 -- (-1081.842) (-1084.823) [-1082.072] (-1081.250) * (-1082.472) [-1081.385] (-1081.967) (-1083.714) -- 0:00:02
953000 -- [-1081.591] (-1083.145) (-1082.336) (-1081.181) * (-1081.706) [-1082.273] (-1082.580) (-1084.603) -- 0:00:02
953500 -- (-1085.492) [-1082.981] (-1082.983) (-1083.598) * (-1082.029) (-1082.310) (-1081.501) [-1085.814] -- 0:00:02
954000 -- [-1088.460] (-1082.298) (-1083.968) (-1084.202) * [-1082.378] (-1081.584) (-1082.356) (-1084.283) -- 0:00:02
954500 -- (-1085.263) (-1081.885) (-1082.940) [-1081.568] * (-1081.487) [-1081.378] (-1082.056) (-1091.407) -- 0:00:02
955000 -- (-1087.352) [-1083.754] (-1083.423) (-1081.718) * (-1082.944) (-1083.687) [-1085.283] (-1083.113) -- 0:00:02
Average standard deviation of split frequencies: 0.010109
955500 -- (-1082.319) (-1086.975) [-1084.078] (-1082.702) * [-1082.135] (-1082.574) (-1084.211) (-1086.508) -- 0:00:02
956000 -- (-1082.097) [-1082.306] (-1083.876) (-1083.488) * (-1083.188) (-1085.942) (-1084.244) [-1084.197] -- 0:00:02
956500 -- (-1084.401) (-1083.256) [-1081.749] (-1082.541) * [-1081.167] (-1083.471) (-1088.162) (-1082.978) -- 0:00:02
957000 -- [-1082.469] (-1081.974) (-1086.706) (-1082.178) * (-1082.812) (-1082.102) (-1081.801) [-1085.315] -- 0:00:02
957500 -- (-1082.773) (-1082.075) (-1081.506) [-1086.227] * [-1084.935] (-1082.689) (-1082.100) (-1083.086) -- 0:00:02
958000 -- (-1082.734) (-1081.277) (-1082.004) [-1082.798] * [-1084.020] (-1085.248) (-1083.519) (-1081.914) -- 0:00:02
958500 -- (-1081.759) (-1081.505) (-1083.678) [-1084.292] * (-1082.848) [-1082.273] (-1084.359) (-1083.447) -- 0:00:02
959000 -- [-1082.210] (-1081.089) (-1087.691) (-1081.954) * (-1084.606) (-1083.937) [-1086.150] (-1088.241) -- 0:00:02
959500 -- (-1084.291) [-1081.885] (-1085.784) (-1084.419) * [-1082.832] (-1081.336) (-1082.614) (-1081.754) -- 0:00:02
960000 -- (-1081.712) (-1082.542) (-1084.894) [-1083.360] * (-1084.573) (-1082.160) (-1085.589) [-1082.557] -- 0:00:02
Average standard deviation of split frequencies: 0.010305
960500 -- [-1082.160] (-1083.032) (-1083.031) (-1081.816) * (-1085.283) (-1086.515) (-1083.243) [-1080.874] -- 0:00:02
961000 -- (-1082.640) [-1081.609] (-1081.593) (-1081.764) * (-1085.002) (-1083.785) (-1087.772) [-1082.199] -- 0:00:02
961500 -- (-1086.624) (-1082.438) [-1081.626] (-1081.684) * [-1082.773] (-1084.535) (-1082.761) (-1087.874) -- 0:00:02
962000 -- (-1082.178) (-1081.981) [-1082.148] (-1083.324) * (-1082.627) (-1086.896) [-1084.731] (-1087.059) -- 0:00:02
962500 -- (-1081.631) (-1084.640) [-1082.623] (-1086.677) * [-1087.526] (-1082.177) (-1085.438) (-1082.017) -- 0:00:02
963000 -- (-1083.060) (-1084.414) [-1084.346] (-1083.467) * (-1086.027) (-1082.062) [-1082.710] (-1081.927) -- 0:00:02
963500 -- (-1082.478) (-1082.019) (-1085.817) [-1083.999] * (-1085.517) [-1081.644] (-1082.142) (-1082.180) -- 0:00:02
964000 -- (-1085.478) [-1081.501] (-1083.783) (-1082.387) * [-1083.035] (-1081.851) (-1088.120) (-1083.377) -- 0:00:02
964500 -- (-1083.247) (-1082.088) (-1084.149) [-1083.230] * (-1082.141) (-1082.288) [-1082.194] (-1081.976) -- 0:00:02
965000 -- (-1082.494) (-1083.069) [-1082.724] (-1087.166) * [-1081.708] (-1084.518) (-1081.751) (-1081.689) -- 0:00:02
Average standard deviation of split frequencies: 0.010420
965500 -- (-1084.886) [-1082.660] (-1083.441) (-1085.783) * [-1084.206] (-1085.510) (-1081.972) (-1081.926) -- 0:00:02
966000 -- (-1089.920) (-1090.811) [-1083.170] (-1089.248) * (-1083.311) (-1082.992) (-1083.454) [-1082.771] -- 0:00:02
966500 -- (-1082.939) (-1085.216) (-1081.765) [-1081.042] * (-1083.199) (-1081.835) [-1085.592] (-1084.265) -- 0:00:02
967000 -- (-1087.405) (-1086.698) [-1084.117] (-1081.794) * (-1082.303) (-1082.071) (-1083.721) [-1084.297] -- 0:00:02
967500 -- [-1083.374] (-1082.127) (-1085.131) (-1083.461) * (-1082.388) (-1081.807) (-1084.762) [-1082.338] -- 0:00:01
968000 -- (-1083.600) (-1084.605) (-1082.813) [-1084.879] * (-1082.516) [-1085.986] (-1083.065) (-1082.952) -- 0:00:01
968500 -- [-1084.075] (-1084.136) (-1083.302) (-1085.760) * (-1081.683) (-1085.252) (-1081.405) [-1084.307] -- 0:00:01
969000 -- (-1082.980) (-1084.424) (-1084.574) [-1085.012] * (-1085.045) [-1083.724] (-1081.572) (-1083.938) -- 0:00:01
969500 -- (-1081.767) [-1083.466] (-1084.404) (-1082.591) * [-1082.942] (-1083.919) (-1082.050) (-1083.190) -- 0:00:01
970000 -- (-1083.389) (-1081.743) [-1084.700] (-1081.785) * (-1083.551) (-1082.775) [-1082.067] (-1085.008) -- 0:00:01
Average standard deviation of split frequencies: 0.009713
970500 -- (-1085.215) [-1082.249] (-1081.713) (-1081.235) * (-1084.140) [-1081.094] (-1084.331) (-1082.343) -- 0:00:01
971000 -- (-1084.698) [-1086.414] (-1084.266) (-1085.588) * (-1082.597) [-1082.050] (-1086.820) (-1082.108) -- 0:00:01
971500 -- (-1084.402) (-1083.036) (-1083.036) [-1087.691] * (-1082.219) (-1081.307) (-1085.656) [-1081.529] -- 0:00:01
972000 -- [-1083.563] (-1083.978) (-1081.217) (-1085.350) * (-1083.842) (-1083.192) (-1085.493) [-1082.804] -- 0:00:01
972500 -- [-1081.128] (-1082.845) (-1081.845) (-1083.968) * (-1082.392) (-1084.495) (-1083.126) [-1082.685] -- 0:00:01
973000 -- [-1082.213] (-1087.357) (-1084.265) (-1087.319) * (-1083.372) (-1081.158) (-1081.829) [-1082.971] -- 0:00:01
973500 -- (-1082.258) (-1085.228) (-1084.463) [-1084.454] * (-1084.332) [-1081.464] (-1082.036) (-1086.228) -- 0:00:01
974000 -- [-1082.527] (-1084.109) (-1082.315) (-1082.799) * (-1085.177) (-1082.316) (-1084.087) [-1085.410] -- 0:00:01
974500 -- [-1081.945] (-1085.155) (-1085.650) (-1082.303) * (-1091.235) [-1083.599] (-1082.321) (-1084.033) -- 0:00:01
975000 -- (-1083.603) (-1085.181) (-1082.181) [-1081.424] * (-1089.264) [-1084.888] (-1084.733) (-1081.726) -- 0:00:01
Average standard deviation of split frequencies: 0.009499
975500 -- [-1083.136] (-1081.257) (-1082.587) (-1084.036) * (-1083.404) (-1084.533) [-1082.167] (-1084.207) -- 0:00:01
976000 -- [-1082.750] (-1082.673) (-1081.431) (-1083.064) * (-1083.769) (-1082.074) (-1081.332) [-1081.776] -- 0:00:01
976500 -- (-1081.748) [-1084.368] (-1083.400) (-1084.986) * (-1083.508) [-1082.272] (-1084.760) (-1086.318) -- 0:00:01
977000 -- (-1082.980) [-1085.178] (-1084.327) (-1085.063) * [-1081.448] (-1083.442) (-1084.305) (-1086.143) -- 0:00:01
977500 -- (-1086.475) (-1081.772) [-1081.312] (-1086.143) * (-1082.331) (-1083.333) [-1083.348] (-1085.484) -- 0:00:01
978000 -- (-1083.053) (-1084.095) (-1082.413) [-1087.331] * (-1082.991) [-1083.818] (-1081.595) (-1082.406) -- 0:00:01
978500 -- (-1084.483) (-1084.688) [-1081.380] (-1084.859) * (-1084.928) (-1088.599) (-1081.598) [-1081.641] -- 0:00:01
979000 -- (-1085.277) (-1088.986) [-1081.586] (-1081.338) * (-1082.047) [-1081.889] (-1081.241) (-1083.757) -- 0:00:01
979500 -- [-1083.049] (-1086.849) (-1082.622) (-1085.709) * [-1082.421] (-1083.543) (-1083.723) (-1085.864) -- 0:00:01
980000 -- (-1082.699) [-1086.923] (-1084.037) (-1084.451) * (-1082.848) (-1081.391) (-1083.723) [-1083.427] -- 0:00:01
Average standard deviation of split frequencies: 0.009358
980500 -- (-1084.366) (-1082.272) (-1081.937) [-1081.819] * (-1085.410) (-1081.754) [-1083.571] (-1083.618) -- 0:00:01
981000 -- (-1081.398) (-1081.344) (-1080.879) [-1085.451] * [-1084.620] (-1084.110) (-1083.566) (-1081.545) -- 0:00:01
981500 -- (-1082.158) (-1083.727) [-1081.234] (-1085.576) * (-1083.340) [-1081.687] (-1084.273) (-1086.492) -- 0:00:01
982000 -- [-1083.108] (-1084.209) (-1081.706) (-1083.017) * [-1082.830] (-1081.773) (-1083.697) (-1084.625) -- 0:00:01
982500 -- [-1081.313] (-1083.253) (-1081.402) (-1082.775) * (-1082.841) (-1082.526) [-1084.379] (-1086.118) -- 0:00:01
983000 -- (-1083.529) [-1082.316] (-1081.406) (-1083.559) * (-1081.291) [-1081.119] (-1084.759) (-1083.564) -- 0:00:01
983500 -- [-1081.363] (-1081.443) (-1081.713) (-1083.716) * (-1083.462) [-1083.428] (-1083.673) (-1083.804) -- 0:00:01
984000 -- (-1085.149) (-1084.503) [-1082.757] (-1085.840) * (-1081.328) (-1086.641) (-1083.952) [-1082.137] -- 0:00:00
984500 -- [-1081.229] (-1083.186) (-1081.501) (-1083.123) * (-1080.841) (-1086.158) [-1082.407] (-1083.777) -- 0:00:00
985000 -- (-1081.688) (-1082.148) [-1082.294] (-1082.036) * (-1086.233) [-1083.584] (-1083.075) (-1082.529) -- 0:00:00
Average standard deviation of split frequencies: 0.008815
985500 -- (-1081.663) [-1083.787] (-1082.966) (-1085.648) * (-1083.628) (-1086.188) (-1083.797) [-1083.211] -- 0:00:00
986000 -- (-1081.846) (-1083.022) [-1085.097] (-1083.602) * [-1084.589] (-1086.156) (-1088.012) (-1082.257) -- 0:00:00
986500 -- (-1083.539) (-1080.864) [-1087.065] (-1085.097) * (-1082.593) (-1084.316) (-1084.741) [-1082.549] -- 0:00:00
987000 -- [-1082.884] (-1082.971) (-1085.080) (-1083.846) * (-1085.093) (-1081.434) [-1083.031] (-1081.128) -- 0:00:00
987500 -- (-1081.401) (-1082.738) (-1084.216) [-1082.543] * (-1083.810) (-1083.089) (-1083.044) [-1081.987] -- 0:00:00
988000 -- [-1082.210] (-1081.850) (-1084.045) (-1082.934) * (-1084.363) (-1084.888) [-1085.711] (-1086.079) -- 0:00:00
988500 -- (-1084.350) (-1083.172) [-1081.453] (-1081.761) * (-1087.657) [-1085.012] (-1085.321) (-1086.773) -- 0:00:00
989000 -- (-1083.040) (-1083.422) [-1080.957] (-1084.092) * (-1087.275) (-1082.865) (-1083.265) [-1082.283] -- 0:00:00
989500 -- (-1082.148) [-1081.643] (-1082.934) (-1087.377) * [-1081.973] (-1083.891) (-1081.638) (-1083.681) -- 0:00:00
990000 -- [-1081.378] (-1081.707) (-1083.969) (-1083.203) * (-1084.275) (-1082.199) [-1081.355] (-1084.652) -- 0:00:00
Average standard deviation of split frequencies: 0.008803
990500 -- (-1082.128) [-1083.062] (-1083.213) (-1084.307) * (-1082.285) (-1084.892) [-1082.245] (-1081.212) -- 0:00:00
991000 -- (-1083.479) (-1083.408) [-1083.904] (-1082.108) * (-1082.013) (-1084.259) (-1085.152) [-1082.037] -- 0:00:00
991500 -- [-1082.509] (-1082.069) (-1081.301) (-1085.834) * [-1085.196] (-1081.643) (-1082.724) (-1087.241) -- 0:00:00
992000 -- [-1082.868] (-1083.313) (-1080.922) (-1085.480) * (-1083.501) [-1081.568] (-1084.042) (-1085.376) -- 0:00:00
992500 -- (-1084.709) [-1081.815] (-1082.754) (-1082.752) * (-1083.598) (-1083.841) [-1082.695] (-1087.333) -- 0:00:00
993000 -- [-1084.853] (-1082.408) (-1083.337) (-1082.727) * (-1083.026) [-1083.715] (-1081.233) (-1082.289) -- 0:00:00
993500 -- [-1082.996] (-1081.246) (-1082.824) (-1082.883) * [-1085.561] (-1083.537) (-1081.536) (-1090.983) -- 0:00:00
994000 -- (-1084.172) [-1082.393] (-1083.877) (-1088.178) * (-1082.688) (-1080.997) [-1082.784] (-1084.176) -- 0:00:00
994500 -- (-1083.680) (-1081.481) [-1082.983] (-1085.466) * [-1081.495] (-1084.324) (-1088.599) (-1081.891) -- 0:00:00
995000 -- (-1087.195) [-1081.734] (-1082.458) (-1081.532) * (-1081.806) [-1083.391] (-1082.962) (-1081.721) -- 0:00:00
Average standard deviation of split frequencies: 0.008874
995500 -- [-1082.226] (-1082.785) (-1081.322) (-1083.032) * [-1082.771] (-1086.391) (-1081.204) (-1083.176) -- 0:00:00
996000 -- (-1081.935) [-1086.783] (-1081.573) (-1081.993) * (-1083.003) (-1081.631) (-1083.788) [-1081.764] -- 0:00:00
996500 -- [-1081.605] (-1081.901) (-1081.677) (-1081.822) * (-1084.010) (-1083.308) [-1082.029] (-1086.758) -- 0:00:00
997000 -- [-1082.170] (-1081.580) (-1085.013) (-1085.577) * (-1084.821) [-1083.851] (-1081.354) (-1081.817) -- 0:00:00
997500 -- [-1082.694] (-1084.077) (-1083.884) (-1083.346) * [-1082.047] (-1081.482) (-1081.534) (-1081.366) -- 0:00:00
998000 -- [-1081.294] (-1083.290) (-1083.813) (-1082.028) * (-1084.156) (-1084.208) [-1082.382] (-1083.350) -- 0:00:00
998500 -- (-1086.725) (-1084.072) (-1083.430) [-1083.790] * (-1083.711) (-1082.371) [-1084.551] (-1084.259) -- 0:00:00
999000 -- (-1083.671) (-1085.346) [-1081.485] (-1082.538) * (-1081.035) (-1082.447) (-1084.540) [-1081.284] -- 0:00:00
999500 -- (-1081.779) (-1082.775) (-1081.742) [-1083.461] * (-1083.618) [-1083.499] (-1081.756) (-1085.986) -- 0:00:00
1000000 -- (-1095.092) (-1087.356) [-1081.199] (-1084.830) * (-1083.348) (-1081.757) [-1081.691] (-1085.923) -- 0:00:00
Average standard deviation of split frequencies: 0.008568
Analysis completed in 1 mins 1 seconds
Analysis used 60.43 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1080.60
Likelihood of best state for "cold" chain of run 2 was -1080.60
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.7 % ( 19 %) Dirichlet(Pi{all})
28.1 % ( 24 %) Slider(Pi{all})
78.7 % ( 59 %) Multiplier(Alpha{1,2})
78.0 % ( 55 %) Multiplier(Alpha{3})
19.1 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 87 %) ParsSPR(Tau{all},V{all})
28.3 % ( 30 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.5 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 71 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.6 % ( 23 %) Dirichlet(Pi{all})
28.7 % ( 29 %) Slider(Pi{all})
78.1 % ( 50 %) Multiplier(Alpha{1,2})
77.9 % ( 47 %) Multiplier(Alpha{3})
20.6 % ( 21 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
69.9 % ( 62 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 93 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.9 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166601 0.82 0.67
3 | 166644 166565 0.84
4 | 166122 167086 166982
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166688 0.82 0.67
3 | 167126 166380 0.84
4 | 166369 166853 166584
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1082.23
| 2 1 |
| 1 |
| 1 1 2 2 2 2 1|
| 212 1 2 1 1 1 2 1 22 1 |
|1 2 2 1 2 2 1 2 1 22|
| 1 21 2 2*1 1 2 1 2 * |
| 21 21 1 1 12 2 22 212 12122 * |
| 22 1 2 2 1 1 2 11 1 11 1*221 |
| 2 1 1 2 1 1 2 1 1 2 |
|2 1 1 1 21 1 1 2 2 1 1 |
| 2 1 12 2 2 1 2 |
| 2 |
| |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1084.26
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1082.31 -1085.70
2 -1082.35 -1084.97
--------------------------------------
TOTAL -1082.33 -1085.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895768 0.088666 0.384468 1.514126 0.851679 1501.00 1501.00 1.000
r(A<->C){all} 0.159037 0.019516 0.000026 0.439721 0.119704 217.64 257.81 1.001
r(A<->G){all} 0.168038 0.019223 0.000119 0.442640 0.131999 263.01 275.90 1.000
r(A<->T){all} 0.160925 0.018683 0.000007 0.441953 0.126776 194.20 240.25 1.009
r(C<->G){all} 0.173394 0.020280 0.000298 0.455375 0.138724 201.59 237.74 1.012
r(C<->T){all} 0.169690 0.019807 0.000023 0.457279 0.130953 197.83 257.80 1.000
r(G<->T){all} 0.168916 0.020677 0.000155 0.466121 0.130777 142.33 200.77 1.000
pi(A){all} 0.175859 0.000181 0.150252 0.202568 0.175906 1140.16 1320.58 1.000
pi(C){all} 0.324158 0.000270 0.290580 0.354524 0.323899 1169.50 1253.81 1.000
pi(G){all} 0.319426 0.000270 0.286415 0.350550 0.319400 1161.04 1331.02 1.000
pi(T){all} 0.180556 0.000180 0.155942 0.207413 0.179934 1063.66 1206.28 1.000
alpha{1,2} 0.425547 0.219989 0.000160 1.363022 0.271998 1043.27 1123.88 1.000
alpha{3} 0.454365 0.245710 0.000158 1.434273 0.296466 1194.51 1209.57 1.000
pinvar{all} 0.998123 0.000005 0.993807 0.999999 0.998878 1042.04 1178.70 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- .**...
9 -- ..****
10 -- .**.**
11 -- .****.
12 -- .*.*..
13 -- .*..*.
14 -- .*...*
15 -- ..*.*.
16 -- .*.***
17 -- ....**
18 -- ..*..*
19 -- ...**.
20 -- .***.*
21 -- ..**..
22 -- ..**.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 448 0.149234 0.016959 0.137242 0.161226 2
8 440 0.146569 0.000000 0.146569 0.146569 2
9 439 0.146236 0.003298 0.143904 0.148568 2
10 435 0.144903 0.002355 0.143238 0.146569 2
11 432 0.143904 0.005653 0.139907 0.147901 2
12 430 0.143238 0.003769 0.140573 0.145903 2
13 428 0.142572 0.016017 0.131246 0.153897 2
14 428 0.142572 0.026381 0.123917 0.161226 2
15 427 0.142239 0.023083 0.125916 0.158561 2
16 426 0.141905 0.011306 0.133911 0.149900 2
17 422 0.140573 0.000000 0.140573 0.140573 2
18 421 0.140240 0.009893 0.133245 0.147235 2
19 415 0.138241 0.003298 0.135909 0.140573 2
20 410 0.136576 0.007537 0.131246 0.141905 2
21 406 0.135243 0.000942 0.134577 0.135909 2
22 288 0.095936 0.006595 0.091272 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/1res/deoD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098710 0.009887 0.000035 0.291852 0.067666 1.000 2
length{all}[2] 0.103123 0.010701 0.000007 0.309409 0.070655 1.000 2
length{all}[3] 0.097404 0.009442 0.000006 0.294837 0.067660 1.000 2
length{all}[4] 0.099560 0.009990 0.000007 0.295545 0.066958 1.000 2
length{all}[5] 0.099408 0.009727 0.000119 0.301587 0.070605 1.000 2
length{all}[6] 0.100442 0.009850 0.000074 0.297203 0.072688 1.000 2
length{all}[7] 0.102572 0.010652 0.000010 0.351204 0.076173 1.004 2
length{all}[8] 0.098956 0.009508 0.001782 0.319366 0.064148 0.998 2
length{all}[9] 0.106446 0.013079 0.000175 0.335114 0.073034 0.999 2
length{all}[10] 0.093546 0.007486 0.000330 0.261890 0.069276 0.999 2
length{all}[11] 0.097069 0.009314 0.000023 0.269737 0.068988 0.998 2
length{all}[12] 0.103929 0.009521 0.000034 0.313920 0.073871 0.998 2
length{all}[13] 0.088836 0.006845 0.000116 0.247744 0.066026 0.999 2
length{all}[14] 0.095720 0.009353 0.000044 0.286662 0.063876 0.998 2
length{all}[15] 0.093839 0.008941 0.000113 0.292914 0.062876 0.999 2
length{all}[16] 0.100730 0.010536 0.000056 0.303620 0.068887 0.999 2
length{all}[17] 0.106974 0.010602 0.000106 0.308407 0.078984 0.998 2
length{all}[18] 0.098435 0.009057 0.000181 0.271616 0.072498 0.998 2
length{all}[19] 0.101837 0.010447 0.000378 0.304524 0.071369 0.999 2
length{all}[20] 0.097228 0.011140 0.000257 0.295965 0.065884 0.998 2
length{all}[21] 0.098366 0.010580 0.000325 0.288192 0.064770 1.003 2
length{all}[22] 0.090339 0.007972 0.000190 0.272843 0.059423 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008568
Maximum standard deviation of split frequencies = 0.026381
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------ C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 804
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 58 patterns at 268 / 268 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 58 patterns at 268 / 268 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
56608 bytes for conP
5104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.059550 0.051066 0.013132 0.061309 0.037539 0.101121 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1128.376822
Iterating by ming2
Initial: fx= 1128.376822
x= 0.05955 0.05107 0.01313 0.06131 0.03754 0.10112 0.30000 1.30000
1 h-m-p 0.0000 0.0000 645.5336 ++ 1107.752709 m 0.0000 13 | 1/8
2 h-m-p 0.0009 0.0102 31.1929 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 589.8360 ++ 1075.558955 m 0.0001 44 | 2/8
4 h-m-p 0.0024 0.0176 19.8606 ------------.. | 2/8
5 h-m-p 0.0000 0.0001 529.3959 ++ 1061.162763 m 0.0001 76 | 3/8
6 h-m-p 0.0021 0.0478 11.1603 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 459.1484 ++ 1054.363636 m 0.0000 108 | 4/8
8 h-m-p 0.0015 0.1250 7.9801 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 374.9810 ++ 1053.423667 m 0.0000 139 | 5/8
10 h-m-p 0.0003 0.1355 5.6732 ----------.. | 5/8
11 h-m-p 0.0000 0.0002 264.2280 ++ 1042.739403 m 0.0002 169 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 C 1042.739403 0 1.6000 180 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 ++ 1042.739403 m 8.0000 193 | 6/8
14 h-m-p 0.0160 8.0000 0.0008 +++++ 1042.739403 m 8.0000 209 | 6/8
15 h-m-p 0.0160 8.0000 0.6809 ------C 1042.739403 0 0.0000 228 | 6/8
16 h-m-p 0.0160 8.0000 0.0003 ---------C 1042.739403 0 0.0000 250 | 6/8
17 h-m-p 0.0160 8.0000 0.0000 C 1042.739403 0 0.0160 263
Out..
lnL = -1042.739403
264 lfun, 264 eigenQcodon, 1584 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.033373 0.078758 0.049718 0.069484 0.076707 0.064739 0.299952 0.847964 0.471319
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.524162
np = 9
lnL0 = -1140.418487
Iterating by ming2
Initial: fx= 1140.418487
x= 0.03337 0.07876 0.04972 0.06948 0.07671 0.06474 0.29995 0.84796 0.47132
1 h-m-p 0.0000 0.0001 632.7897 ++ 1088.625774 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0002 351.7348 ++ 1067.010415 m 0.0002 26 | 2/9
3 h-m-p 0.0000 0.0000 6672.5545 ++ 1050.644924 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0001 505.9489 ++ 1046.939691 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0001 2790.8579 ++ 1043.182126 m 0.0001 62 | 5/9
6 h-m-p 0.0000 0.0000 8629.6375 ++ 1042.739402 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 1042.739402 m 8.0000 86 | 6/9
8 h-m-p 0.6856 8.0000 0.0008 ++ 1042.739402 m 8.0000 101 | 6/9
9 h-m-p 0.0404 0.7053 0.1560 +++ 1042.739402 m 0.7053 117 | 7/9
10 h-m-p 0.1359 1.2063 0.3761 ++ 1042.739398 m 1.2063 132 | 8/9
11 h-m-p 0.9966 7.2144 0.0426 ++ 1042.739390 m 7.2144 146 | 9/9
12 h-m-p 0.0160 8.0000 0.0000 Y 1042.739390 0 0.0160 159
Out..
lnL = -1042.739390
160 lfun, 480 eigenQcodon, 1920 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.040027 0.066824 0.071699 0.087933 0.033318 0.044243 0.000100 1.073224 0.239751 0.462841 1.485713
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.564749
np = 11
lnL0 = -1131.452094
Iterating by ming2
Initial: fx= 1131.452094
x= 0.04003 0.06682 0.07170 0.08793 0.03332 0.04424 0.00011 1.07322 0.23975 0.46284 1.48571
1 h-m-p 0.0000 0.0000 613.2751 ++ 1129.080845 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0008 273.8194 +++ 1079.085950 m 0.0008 31 | 2/11
3 h-m-p 0.0000 0.0000 1262.5808 ++ 1071.143886 m 0.0000 45 | 3/11
4 h-m-p 0.0001 0.0003 230.9448 ++ 1065.203100 m 0.0003 59 | 4/11
5 h-m-p 0.0000 0.0000 3303.7891 ++ 1047.555993 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0001 619.4755 ++ 1045.517969 m 0.0001 87 | 6/11
7 h-m-p 0.0000 0.0000 3677.7658 ++ 1045.464884 m 0.0000 101 | 7/11
8 h-m-p 0.0001 0.0484 14.6492 ---------.. | 7/11
9 h-m-p 0.0000 0.0000 263.3618 ++ 1042.739403 m 0.0000 136 | 8/11
10 h-m-p 0.1083 8.0000 0.0000 ++++ 1042.739403 m 8.0000 152 | 8/11
11 h-m-p 0.1900 8.0000 0.0001 +++ 1042.739403 m 8.0000 170 | 8/11
12 h-m-p 0.0005 0.2326 3.1378 +++++ 1042.739400 m 0.2326 190 | 9/11
13 h-m-p 0.1520 8.0000 2.4871 -------------C 1042.739400 0 0.0000 217 | 9/11
14 h-m-p 0.0160 8.0000 0.0000 Y 1042.739400 0 0.0040 231
Out..
lnL = -1042.739400
232 lfun, 928 eigenQcodon, 4176 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1042.758905 S = -1042.736782 -0.008489
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:03
did 20 / 58 patterns 0:03
did 30 / 58 patterns 0:03
did 40 / 58 patterns 0:03
did 50 / 58 patterns 0:03
did 58 / 58 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.070200 0.094798 0.034032 0.052210 0.042947 0.033350 0.000100 0.560138 1.380430
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.945870
np = 9
lnL0 = -1126.304969
Iterating by ming2
Initial: fx= 1126.304969
x= 0.07020 0.09480 0.03403 0.05221 0.04295 0.03335 0.00011 0.56014 1.38043
1 h-m-p 0.0000 0.0000 601.7262 ++ 1124.962250 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0110 51.6269 ++++ 1108.605143 m 0.0110 28 | 2/9
3 h-m-p 0.0001 0.0004 517.5662 ++ 1083.077915 m 0.0004 40 | 3/9
4 h-m-p 0.0009 0.0050 214.7868 +
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
+ 1054.127592 m 0.0050 52
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228665e-160 2000 rounds
| 4/9
5 h-m-p 0.0001 0.0003 137.4457
QuantileBeta(0.15, 0.00500, 2.14227) = 1.234887e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14869) = 1.230216e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15029) = 1.229053e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15070) = 1.228763e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15080) = 1.228690e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15082) = 1.228672e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228668e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228667e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228665e-160 2000 rounds
| 4/9
6 h-m-p 0.0000 0.0000 525.9173
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
+ 1049.007997 m 0.0000 83
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228665e-160 2000 rounds
| 5/9
7 h-m-p 0.0160 8.0000 1.7966
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228665e-160 2000 rounds
| 5/9
8 h-m-p 0.0000 0.0000 456.7245
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
+ 1045.623432 m 0.0000 118
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228665e-160 2000 rounds
| 6/9
9 h-m-p 0.0160 8.0000 1.4702
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228665e-160 2000 rounds
| 6/9
10 h-m-p 0.0000 0.0000 373.7959
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
+ 1042.852730 m 0.0000 153
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228665e-160 2000 rounds
| 7/9
11 h-m-p 0.0160 8.0000 1.0446
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228665e-160 2000 rounds
| 7/9
12 h-m-p 0.0000 0.0000 265.5886
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
+ 1042.739390 m 0.0000 188
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228665e-160 2000 rounds
| 8/9
13 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
N 1042.739390 0 0.0160 200
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15095) = 1.228579e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15071) = 1.228753e-160 2000 rounds
| 8/9
14 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
N 1042.739390 0 1.6000 213
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
Out..
lnL = -1042.739390
214 lfun, 2354 eigenQcodon, 12840 P(t)
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15083) = 1.228666e-160 2000 rounds
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.104255 0.088518 0.045362 0.018810 0.084772 0.021118 0.000100 0.900000 0.408638 1.395304 1.293524
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.870214
np = 11
lnL0 = -1132.080742
Iterating by ming2
Initial: fx= 1132.080742
x= 0.10425 0.08852 0.04536 0.01881 0.08477 0.02112 0.00011 0.90000 0.40864 1.39530 1.29352
1 h-m-p 0.0000 0.0000 565.2263 ++ 1131.240682 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0004 270.6819 +++ 1104.996678 m 0.0004 31 | 2/11
3 h-m-p 0.0000 0.0000 316.3854 ++ 1102.058649 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0014 181.2518 +++ 1078.015173 m 0.0014 60 | 4/11
5 h-m-p 0.0000 0.0001 1774.3102 ++ 1050.799344 m 0.0001 74 | 5/11
6 h-m-p 0.0011 0.0056 11.6825 -----------.. | 5/11
7 h-m-p 0.0000 0.0000 446.2299 ++ 1049.456919 m 0.0000 111 | 6/11
8 h-m-p 0.0002 0.0217 13.2299 ++++ 1049.308879 m 0.0217 127 | 6/11
9 h-m-p 0.0574 0.2870 0.3029 --------------.. | 6/11
10 h-m-p 0.0000 0.0000 371.2825 ++ 1044.996833 m 0.0000 172 | 7/11
11 h-m-p 0.0000 0.0001 224.0295 ++ 1042.739391 m 0.0001 186 | 8/11
12 h-m-p 1.6000 8.0000 0.0000 ++ 1042.739391 m 8.0000 200 | 8/11
13 h-m-p 0.0160 8.0000 0.0114 ---------Y 1042.739391 0 0.0000 226 | 8/11
14 h-m-p 0.0160 8.0000 0.0003 +++++ 1042.739391 m 8.0000 246 | 8/11
15 h-m-p 0.0160 8.0000 0.1336 ---------Y 1042.739391 0 0.0000 272 | 8/11
16 h-m-p 0.0127 6.3412 0.0019 +++++ 1042.739390 m 6.3412 292 | 9/11
17 h-m-p 1.6000 8.0000 0.0000 --N 1042.739390 0 0.0250 311 | 9/11
18 h-m-p 0.0160 8.0000 2.5982 ----Y 1042.739390 0 0.0000 331 | 9/11
19 h-m-p 1.0018 8.0000 0.0000 --Y 1042.739390 0 0.0157 347 | 9/11
20 h-m-p 1.6000 8.0000 0.0000 N 1042.739390 0 1.6000 363
Out..
lnL = -1042.739390
364 lfun, 4368 eigenQcodon, 24024 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1042.795352 S = -1042.740263 -0.024450
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:13
did 20 / 58 patterns 0:13
did 30 / 58 patterns 0:13
did 40 / 58 patterns 0:13
did 50 / 58 patterns 0:13
did 58 / 58 patterns 0:13
Time used: 0:13
CodeML output code: -1