--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 10:24:06 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/1res/desA1/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1387.70 -1390.90 2 -1387.76 -1390.51 -------------------------------------- TOTAL -1387.73 -1390.72 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.898071 0.088465 0.383982 1.494533 0.862297 1501.00 1501.00 1.000 r(A<->C){all} 0.158294 0.018088 0.000074 0.432477 0.121114 152.73 211.12 1.000 r(A<->G){all} 0.165175 0.019707 0.000026 0.447007 0.128568 150.02 191.53 1.003 r(A<->T){all} 0.174112 0.020685 0.000053 0.464534 0.137661 123.30 191.44 1.002 r(C<->G){all} 0.158754 0.018783 0.000039 0.442194 0.120150 110.01 230.93 1.002 r(C<->T){all} 0.183141 0.021868 0.000005 0.476931 0.148045 247.05 253.39 1.000 r(G<->T){all} 0.160525 0.019304 0.000026 0.445375 0.123819 162.14 224.81 1.009 pi(A){all} 0.239342 0.000188 0.213714 0.266805 0.238970 1239.23 1303.89 1.001 pi(C){all} 0.288202 0.000199 0.261400 0.315453 0.288248 1058.76 1091.99 1.000 pi(G){all} 0.296758 0.000205 0.269197 0.323569 0.296626 1249.17 1287.94 1.000 pi(T){all} 0.175698 0.000143 0.153310 0.200038 0.175628 1350.64 1410.17 1.000 alpha{1,2} 0.434347 0.235962 0.000234 1.398609 0.261147 1207.74 1254.06 1.000 alpha{3} 0.470431 0.247287 0.000261 1.527438 0.295765 1351.36 1421.87 1.000 pinvar{all} 0.998503 0.000003 0.995269 0.999999 0.999059 964.64 1069.80 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1313.751892 Model 2: PositiveSelection -1313.751892 Model 0: one-ratio -1313.752321 Model 7: beta -1313.751892 Model 8: beta&w>1 -1313.751892 Model 0 vs 1 8.579999998801213E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0
>C1 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR >C2 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR >C3 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR >C4 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR >C5 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR >C6 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=338 C1 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG C2 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG C3 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG C4 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG C5 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG C6 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG ************************************************** C1 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV C2 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV C3 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV C4 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV C5 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV C6 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV ************************************************** C1 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG C2 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG C3 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG C4 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG C5 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG C6 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG ************************************************** C1 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH C2 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH C3 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH C4 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH C5 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH C6 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH ************************************************** C1 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG C2 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG C3 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG C4 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG C5 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG C6 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG ************************************************** C1 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC C2 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC C3 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC C4 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC C5 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC C6 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC ************************************************** C1 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR C2 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR C3 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR C4 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR C5 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR C6 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR ************************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 338 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 338 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10140] Library Relaxation: Multi_proc [96] Relaxation Summary: [10140]--->[10140] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.517 Mb, Max= 30.907 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG C2 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG C3 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG C4 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG C5 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG C6 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG ************************************************** C1 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV C2 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV C3 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV C4 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV C5 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV C6 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV ************************************************** C1 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG C2 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG C3 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG C4 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG C5 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG C6 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG ************************************************** C1 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH C2 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH C3 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH C4 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH C5 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH C6 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH ************************************************** C1 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG C2 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG C3 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG C4 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG C5 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG C6 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG ************************************************** C1 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC C2 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC C3 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC C4 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC C5 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC C6 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC ************************************************** C1 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR C2 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR C3 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR C4 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR C5 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR C6 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR ************************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT C2 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT C3 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT C4 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT C5 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT C6 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT ************************************************** C1 CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC C2 CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC C3 CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC C4 CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC C5 CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC C6 CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC ************************************************** C1 CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC C2 CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC C3 CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC C4 CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC C5 CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC C6 CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC ************************************************** C1 GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT C2 GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT C3 GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT C4 GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT C5 GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT C6 GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT ************************************************** C1 AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC C2 AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC C3 AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC C4 AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC C5 AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC C6 AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC ************************************************** C1 GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC C2 GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC C3 GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC C4 GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC C5 GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC C6 GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC ************************************************** C1 AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA C2 AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA C3 AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA C4 AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA C5 AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA C6 AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA ************************************************** C1 TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA C2 TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA C3 TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA C4 TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA C5 TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA C6 TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA ************************************************** C1 TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA C2 TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA C3 TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA C4 TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA C5 TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA C6 TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA ************************************************** C1 CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA C2 CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA C3 CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA C4 CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA C5 CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA C6 CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA ************************************************** C1 GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA C2 GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA C3 GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA C4 GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA C5 GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA C6 GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA ************************************************** C1 CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC C2 CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC C3 CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC C4 CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC C5 CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC C6 CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC ************************************************** C1 ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA C2 ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA C3 ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA C4 ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA C5 ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA C6 ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA ************************************************** C1 CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG C2 CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG C3 CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG C4 CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG C5 CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG C6 CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG ************************************************** C1 GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT C2 GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT C3 GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT C4 GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT C5 GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT C6 GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT ************************************************** C1 GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT C2 GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT C3 GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT C4 GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT C5 GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT C6 GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT ************************************************** C1 CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC C2 CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC C3 CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC C4 CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC C5 CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC C6 CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC ************************************************** C1 GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC C2 GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC C3 GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC C4 GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC C5 GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC C6 GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC ************************************************** C1 GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG C2 GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG C3 GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG C4 GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG C5 GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG C6 GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG ************************************************** C1 GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA C2 GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA C3 GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA C4 GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA C5 GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA C6 GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA ************************************************** C1 GGATGAGTGGGCGG C2 GGATGAGTGGGCGG C3 GGATGAGTGGGCGG C4 GGATGAGTGGGCGG C5 GGATGAGTGGGCGG C6 GGATGAGTGGGCGG ************** >C1 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA GGATGAGTGGGCGG >C2 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA GGATGAGTGGGCGG >C3 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA GGATGAGTGGGCGG >C4 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA GGATGAGTGGGCGG >C5 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA GGATGAGTGGGCGG >C6 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA GGATGAGTGGGCGG >C1 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR >C2 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR >C3 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR >C4 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR >C5 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR >C6 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1014 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579774967 Setting output file names to "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1619720365 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9990930618 Seed = 441417645 Swapseed = 1579774967 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2269.380487 -- -24.965149 Chain 2 -- -2269.380271 -- -24.965149 Chain 3 -- -2269.380271 -- -24.965149 Chain 4 -- -2269.380487 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2269.380617 -- -24.965149 Chain 2 -- -2269.380487 -- -24.965149 Chain 3 -- -2269.380617 -- -24.965149 Chain 4 -- -2269.380487 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2269.380] (-2269.380) (-2269.380) (-2269.380) * [-2269.381] (-2269.380) (-2269.381) (-2269.380) 500 -- (-1406.290) (-1395.462) (-1400.454) [-1404.216] * [-1402.335] (-1401.274) (-1415.498) (-1420.342) -- 0:00:00 1000 -- (-1393.929) [-1400.168] (-1400.479) (-1395.990) * [-1394.781] (-1400.004) (-1401.162) (-1408.316) -- 0:00:00 1500 -- (-1394.486) [-1393.492] (-1396.618) (-1396.843) * [-1397.593] (-1394.580) (-1393.506) (-1399.991) -- 0:00:00 2000 -- [-1394.893] (-1394.673) (-1400.747) (-1397.275) * (-1401.998) (-1397.109) (-1398.887) [-1395.558] -- 0:00:00 2500 -- (-1395.516) (-1396.718) (-1397.734) [-1401.177] * (-1399.657) [-1393.361] (-1394.004) (-1395.672) -- 0:00:00 3000 -- (-1398.735) [-1400.507] (-1400.567) (-1394.965) * (-1393.035) (-1412.456) [-1396.516] (-1398.697) -- 0:00:00 3500 -- (-1397.876) (-1407.005) [-1392.710] (-1394.803) * (-1405.388) [-1395.114] (-1399.391) (-1394.188) -- 0:00:00 4000 -- (-1401.662) (-1394.280) [-1395.093] (-1391.333) * [-1398.934] (-1405.729) (-1394.865) (-1391.893) -- 0:00:00 4500 -- [-1393.258] (-1393.552) (-1399.199) (-1397.518) * (-1395.413) (-1395.817) [-1399.275] (-1402.812) -- 0:00:00 5000 -- (-1403.201) [-1394.448] (-1401.344) (-1403.070) * [-1397.929] (-1396.156) (-1395.363) (-1399.517) -- 0:00:00 Average standard deviation of split frequencies: 0.102479 5500 -- (-1396.405) (-1397.362) [-1400.152] (-1398.532) * (-1397.118) [-1394.267] (-1399.480) (-1398.897) -- 0:00:00 6000 -- [-1397.817] (-1396.816) (-1397.141) (-1402.210) * (-1398.373) (-1394.675) (-1396.899) [-1400.467] -- 0:00:00 6500 -- (-1395.733) (-1398.967) [-1394.211] (-1392.348) * (-1397.800) [-1398.107] (-1397.238) (-1400.034) -- 0:00:00 7000 -- (-1395.069) (-1401.415) (-1396.806) [-1392.557] * (-1398.175) [-1394.004] (-1399.304) (-1395.857) -- 0:00:00 7500 -- [-1392.983] (-1399.655) (-1391.648) (-1397.440) * (-1396.703) (-1396.590) (-1398.697) [-1394.312] -- 0:00:00 8000 -- (-1394.070) (-1401.042) (-1400.358) [-1394.816] * (-1396.943) [-1395.799] (-1391.316) (-1408.062) -- 0:00:00 8500 -- [-1402.669] (-1398.388) (-1410.227) (-1395.165) * (-1399.534) (-1407.549) (-1401.005) [-1392.488] -- 0:01:56 9000 -- (-1393.705) (-1395.796) (-1398.204) [-1398.180] * (-1400.998) (-1399.139) [-1392.255] (-1398.433) -- 0:01:50 9500 -- (-1399.993) [-1398.222] (-1396.659) (-1399.752) * (-1396.700) (-1395.334) (-1396.786) [-1397.442] -- 0:01:44 10000 -- (-1400.322) [-1391.971] (-1396.394) (-1403.094) * (-1392.446) [-1396.525] (-1397.421) (-1394.681) -- 0:01:39 Average standard deviation of split frequencies: 0.075761 10500 -- (-1406.588) [-1393.350] (-1398.787) (-1403.269) * (-1399.904) (-1411.866) (-1398.699) [-1397.389] -- 0:01:34 11000 -- [-1398.263] (-1408.811) (-1406.251) (-1398.302) * (-1395.325) (-1393.200) (-1397.360) [-1397.156] -- 0:01:29 11500 -- (-1389.908) [-1401.410] (-1399.813) (-1398.460) * [-1396.820] (-1396.418) (-1395.603) (-1403.675) -- 0:01:25 12000 -- (-1400.436) (-1395.745) (-1393.896) [-1395.295] * (-1397.106) (-1396.465) [-1396.998] (-1398.399) -- 0:01:22 12500 -- (-1399.378) [-1393.600] (-1400.032) (-1399.247) * [-1398.113] (-1396.257) (-1395.956) (-1397.424) -- 0:01:19 13000 -- (-1397.431) (-1396.657) [-1396.542] (-1393.433) * [-1394.962] (-1399.689) (-1393.158) (-1401.602) -- 0:01:15 13500 -- [-1403.096] (-1400.137) (-1400.969) (-1399.308) * [-1393.115] (-1401.767) (-1397.218) (-1398.959) -- 0:01:13 14000 -- (-1393.410) (-1398.105) [-1397.958] (-1394.130) * (-1401.032) (-1400.634) (-1396.060) [-1391.936] -- 0:01:10 14500 -- (-1400.999) [-1392.609] (-1395.939) (-1396.208) * (-1398.227) (-1399.180) (-1400.708) [-1395.883] -- 0:01:07 15000 -- [-1397.642] (-1397.801) (-1396.613) (-1398.622) * (-1396.647) (-1394.356) [-1397.191] (-1394.503) -- 0:01:05 Average standard deviation of split frequencies: 0.057289 15500 -- [-1399.663] (-1396.374) (-1399.071) (-1394.757) * (-1401.644) (-1398.264) (-1401.295) [-1396.699] -- 0:01:03 16000 -- [-1402.019] (-1407.682) (-1396.604) (-1398.553) * (-1391.873) (-1396.560) [-1394.620] (-1392.892) -- 0:01:01 16500 -- [-1396.139] (-1397.182) (-1396.836) (-1404.355) * (-1398.733) (-1396.918) [-1400.035] (-1403.396) -- 0:00:59 17000 -- (-1400.542) (-1411.650) [-1394.334] (-1393.374) * [-1392.964] (-1396.004) (-1395.832) (-1392.224) -- 0:00:57 17500 -- [-1395.188] (-1399.002) (-1400.110) (-1398.488) * [-1399.185] (-1399.361) (-1396.835) (-1396.239) -- 0:00:56 18000 -- (-1396.978) (-1403.518) (-1400.957) [-1399.884] * (-1397.373) [-1401.371] (-1399.868) (-1396.039) -- 0:00:54 18500 -- (-1396.817) (-1398.827) [-1400.448] (-1397.775) * (-1395.872) [-1391.785] (-1399.250) (-1398.100) -- 0:00:53 19000 -- [-1392.606] (-1399.280) (-1401.947) (-1400.906) * (-1392.886) (-1404.545) [-1395.351] (-1418.267) -- 0:00:51 19500 -- (-1398.846) [-1401.331] (-1397.567) (-1398.371) * (-1410.507) [-1396.131] (-1400.166) (-1396.743) -- 0:00:50 20000 -- [-1391.154] (-1395.989) (-1397.161) (-1399.235) * (-1394.905) (-1405.180) [-1396.328] (-1406.435) -- 0:00:49 Average standard deviation of split frequencies: 0.057025 20500 -- (-1395.666) [-1398.895] (-1402.375) (-1396.428) * (-1397.359) [-1397.132] (-1399.011) (-1395.441) -- 0:00:47 21000 -- [-1394.361] (-1398.685) (-1399.270) (-1394.292) * [-1398.868] (-1397.152) (-1397.790) (-1405.382) -- 0:00:46 21500 -- [-1398.308] (-1394.444) (-1401.654) (-1398.422) * [-1396.050] (-1394.360) (-1395.498) (-1398.142) -- 0:00:45 22000 -- (-1412.087) (-1403.437) [-1392.999] (-1396.723) * (-1394.320) [-1398.162] (-1397.008) (-1397.841) -- 0:00:44 22500 -- [-1398.089] (-1399.934) (-1394.642) (-1396.961) * (-1398.807) (-1394.272) [-1394.244] (-1395.489) -- 0:00:43 23000 -- (-1406.338) (-1395.979) [-1397.165] (-1394.218) * [-1394.783] (-1395.681) (-1394.122) (-1393.460) -- 0:01:24 23500 -- (-1399.009) (-1397.006) (-1393.828) [-1396.349] * (-1396.048) (-1391.519) (-1398.870) [-1393.692] -- 0:01:23 24000 -- (-1400.922) (-1398.318) (-1394.111) [-1393.724] * [-1399.427] (-1398.232) (-1399.840) (-1397.394) -- 0:01:21 24500 -- (-1397.053) (-1394.145) [-1393.632] (-1396.414) * (-1397.212) [-1392.234] (-1405.579) (-1403.484) -- 0:01:19 25000 -- [-1397.436] (-1393.485) (-1400.721) (-1399.996) * (-1397.040) (-1402.240) (-1405.656) [-1392.617] -- 0:01:18 Average standard deviation of split frequencies: 0.043169 25500 -- (-1403.459) [-1396.961] (-1404.305) (-1391.040) * [-1391.414] (-1400.237) (-1392.469) (-1398.828) -- 0:01:16 26000 -- (-1400.080) (-1398.751) (-1399.090) [-1406.233] * (-1394.431) [-1390.666] (-1401.948) (-1395.223) -- 0:01:14 26500 -- (-1394.294) (-1403.428) [-1390.895] (-1401.956) * [-1395.125] (-1403.264) (-1405.805) (-1398.060) -- 0:01:13 27000 -- (-1400.934) [-1400.738] (-1395.406) (-1398.627) * (-1401.348) (-1402.380) [-1400.372] (-1394.959) -- 0:01:12 27500 -- (-1394.614) (-1396.292) [-1395.828] (-1396.151) * (-1395.922) (-1400.564) (-1387.588) [-1391.860] -- 0:01:10 28000 -- (-1394.458) (-1397.839) [-1392.207] (-1400.421) * (-1395.227) (-1395.835) [-1386.951] (-1400.616) -- 0:01:09 28500 -- (-1405.713) (-1398.214) (-1396.158) [-1399.708] * [-1395.293] (-1400.485) (-1389.038) (-1396.298) -- 0:01:08 29000 -- [-1398.993] (-1396.163) (-1395.149) (-1401.392) * (-1397.339) [-1402.104] (-1389.370) (-1396.975) -- 0:01:06 29500 -- [-1395.603] (-1396.487) (-1403.961) (-1399.867) * (-1396.645) [-1390.864] (-1387.394) (-1403.622) -- 0:01:05 30000 -- [-1394.799] (-1405.511) (-1396.889) (-1418.866) * (-1392.389) [-1396.452] (-1388.645) (-1400.420) -- 0:01:04 Average standard deviation of split frequencies: 0.034936 30500 -- [-1399.015] (-1396.285) (-1396.062) (-1390.783) * (-1399.289) (-1396.696) [-1387.611] (-1395.674) -- 0:01:03 31000 -- [-1391.722] (-1391.736) (-1396.446) (-1391.008) * (-1399.329) (-1393.488) [-1387.431] (-1391.307) -- 0:01:02 31500 -- [-1398.269] (-1399.833) (-1395.328) (-1391.454) * (-1405.609) [-1400.177] (-1387.198) (-1396.148) -- 0:01:01 32000 -- (-1401.464) [-1395.291] (-1397.300) (-1392.627) * (-1397.864) (-1394.080) [-1387.087] (-1405.131) -- 0:01:00 32500 -- (-1394.169) (-1405.685) [-1396.720] (-1389.811) * [-1394.689] (-1400.494) (-1387.540) (-1403.390) -- 0:00:59 33000 -- (-1394.863) (-1397.561) [-1395.099] (-1393.214) * (-1403.122) (-1395.874) [-1390.849] (-1411.020) -- 0:00:58 33500 -- (-1410.192) (-1399.367) [-1396.145] (-1390.130) * (-1401.519) [-1396.406] (-1392.738) (-1396.445) -- 0:00:57 34000 -- (-1410.377) (-1397.099) (-1399.493) [-1387.979] * [-1394.625] (-1395.508) (-1388.900) (-1390.101) -- 0:00:56 34500 -- (-1399.134) [-1393.089] (-1404.087) (-1391.188) * (-1397.028) [-1394.267] (-1390.214) (-1386.871) -- 0:00:55 35000 -- (-1395.412) (-1396.072) (-1401.630) [-1389.373] * (-1402.130) [-1394.073] (-1389.545) (-1386.606) -- 0:00:55 Average standard deviation of split frequencies: 0.036527 35500 -- (-1399.348) [-1393.252] (-1401.990) (-1387.700) * (-1395.734) [-1401.081] (-1389.389) (-1389.531) -- 0:00:54 36000 -- (-1396.778) [-1393.726] (-1394.713) (-1387.760) * (-1396.091) (-1392.768) (-1388.414) [-1388.713] -- 0:00:53 36500 -- (-1395.733) (-1400.352) (-1392.168) [-1386.965] * (-1404.081) (-1400.379) [-1388.412] (-1387.196) -- 0:00:52 37000 -- (-1398.087) [-1395.391] (-1400.897) (-1387.706) * (-1398.423) [-1402.577] (-1386.626) (-1386.952) -- 0:00:52 37500 -- (-1400.237) (-1403.771) (-1402.777) [-1386.844] * [-1396.607] (-1402.160) (-1388.322) (-1386.970) -- 0:01:17 38000 -- (-1401.194) (-1401.212) (-1403.752) [-1387.561] * [-1396.139] (-1399.130) (-1388.191) (-1387.987) -- 0:01:15 38500 -- (-1404.029) (-1398.112) (-1396.636) [-1388.441] * [-1399.424] (-1394.895) (-1389.480) (-1388.442) -- 0:01:14 39000 -- (-1397.790) (-1392.665) [-1390.675] (-1387.887) * (-1395.056) [-1398.567] (-1388.437) (-1390.320) -- 0:01:13 39500 -- (-1396.323) [-1399.644] (-1403.283) (-1388.867) * [-1396.233] (-1397.075) (-1387.535) (-1388.585) -- 0:01:12 40000 -- [-1395.830] (-1395.968) (-1395.406) (-1388.772) * (-1408.324) [-1401.375] (-1388.166) (-1391.502) -- 0:01:12 Average standard deviation of split frequencies: 0.036225 40500 -- (-1394.675) [-1397.267] (-1396.308) (-1387.612) * (-1400.142) (-1397.316) (-1387.427) [-1387.567] -- 0:01:11 41000 -- (-1399.972) (-1397.873) [-1391.382] (-1388.499) * (-1396.769) [-1394.988] (-1387.465) (-1389.450) -- 0:01:10 41500 -- (-1402.467) (-1396.641) (-1394.466) [-1390.791] * (-1400.159) (-1398.696) (-1387.705) [-1387.368] -- 0:01:09 42000 -- [-1398.323] (-1397.830) (-1396.656) (-1390.919) * (-1401.510) [-1400.096] (-1387.489) (-1389.484) -- 0:01:08 42500 -- [-1401.455] (-1390.835) (-1394.627) (-1390.962) * [-1396.613] (-1396.898) (-1387.206) (-1386.924) -- 0:01:07 43000 -- [-1393.709] (-1411.000) (-1393.667) (-1389.896) * [-1398.188] (-1390.391) (-1386.717) (-1386.206) -- 0:01:06 43500 -- (-1401.676) (-1392.830) (-1402.472) [-1387.994] * [-1399.076] (-1401.764) (-1386.722) (-1391.482) -- 0:01:05 44000 -- (-1399.197) (-1388.947) [-1390.872] (-1391.908) * (-1393.313) (-1397.423) [-1386.627] (-1393.065) -- 0:01:05 44500 -- (-1395.707) (-1389.238) [-1400.209] (-1389.862) * (-1401.500) [-1398.559] (-1387.753) (-1388.849) -- 0:01:04 45000 -- [-1393.815] (-1389.647) (-1400.226) (-1387.302) * (-1398.940) (-1393.559) [-1388.000] (-1389.067) -- 0:01:03 Average standard deviation of split frequencies: 0.030744 45500 -- (-1401.826) (-1392.105) [-1395.300] (-1388.604) * (-1401.994) (-1406.088) (-1386.489) [-1388.999] -- 0:01:02 46000 -- (-1398.010) [-1388.529] (-1403.296) (-1387.798) * (-1402.094) (-1399.709) [-1387.103] (-1387.872) -- 0:01:02 46500 -- (-1396.815) [-1388.885] (-1401.628) (-1390.988) * [-1400.604] (-1398.701) (-1386.488) (-1386.975) -- 0:01:01 47000 -- (-1400.984) (-1387.208) [-1394.455] (-1389.034) * (-1394.049) [-1397.432] (-1387.876) (-1387.432) -- 0:01:00 47500 -- (-1399.325) [-1390.648] (-1401.428) (-1389.621) * (-1396.670) [-1401.253] (-1388.092) (-1388.085) -- 0:01:00 48000 -- (-1395.661) [-1389.758] (-1400.874) (-1389.341) * (-1397.696) (-1401.906) (-1388.226) [-1388.632] -- 0:00:59 48500 -- (-1397.959) (-1388.673) (-1393.612) [-1389.399] * (-1398.348) (-1400.814) (-1387.861) [-1391.128] -- 0:00:58 49000 -- (-1399.630) [-1388.327] (-1397.446) (-1388.532) * (-1399.270) (-1400.731) (-1390.425) [-1387.598] -- 0:00:58 49500 -- (-1395.275) (-1387.957) [-1401.283] (-1388.033) * [-1401.119] (-1398.843) (-1389.795) (-1388.289) -- 0:00:57 50000 -- (-1393.037) (-1388.988) [-1392.478] (-1387.676) * (-1403.291) (-1400.263) (-1389.115) [-1392.128] -- 0:00:57 Average standard deviation of split frequencies: 0.028377 50500 -- [-1397.011] (-1387.983) (-1401.345) (-1389.388) * (-1396.786) (-1403.296) [-1388.092] (-1387.226) -- 0:00:56 51000 -- [-1394.701] (-1386.398) (-1398.263) (-1389.438) * (-1396.865) [-1402.833] (-1386.807) (-1388.470) -- 0:00:55 51500 -- (-1398.977) (-1388.266) (-1395.685) [-1393.688] * [-1401.592] (-1395.964) (-1386.672) (-1388.583) -- 0:00:55 52000 -- (-1406.407) (-1387.524) [-1392.579] (-1389.560) * (-1393.947) [-1394.325] (-1387.866) (-1388.604) -- 0:01:12 52500 -- (-1397.222) (-1387.863) [-1391.777] (-1389.038) * (-1397.636) [-1400.254] (-1386.960) (-1388.559) -- 0:01:12 53000 -- [-1393.360] (-1387.346) (-1399.865) (-1386.615) * (-1403.481) (-1399.129) [-1386.942] (-1387.925) -- 0:01:11 53500 -- (-1394.323) (-1388.890) (-1402.424) [-1388.146] * (-1400.432) (-1390.758) [-1387.263] (-1387.654) -- 0:01:10 54000 -- (-1398.073) (-1388.583) (-1400.115) [-1386.906] * (-1391.634) (-1398.182) (-1387.122) [-1389.306] -- 0:01:10 54500 -- (-1399.439) (-1386.390) [-1398.488] (-1387.660) * (-1397.718) [-1399.932] (-1386.787) (-1387.554) -- 0:01:09 55000 -- (-1396.536) (-1388.149) [-1391.847] (-1387.762) * (-1396.450) (-1403.145) [-1388.883] (-1393.029) -- 0:01:08 Average standard deviation of split frequencies: 0.029684 55500 -- [-1399.632] (-1389.211) (-1395.862) (-1387.840) * (-1398.036) [-1394.562] (-1388.336) (-1388.569) -- 0:01:08 56000 -- (-1400.723) [-1387.672] (-1400.992) (-1389.191) * (-1392.807) (-1395.071) [-1389.142] (-1389.344) -- 0:01:07 56500 -- (-1392.320) (-1387.345) [-1401.596] (-1391.313) * [-1392.771] (-1400.458) (-1396.815) (-1387.707) -- 0:01:06 57000 -- (-1396.157) (-1391.973) (-1412.787) [-1387.907] * [-1393.489] (-1402.885) (-1388.300) (-1387.692) -- 0:01:06 57500 -- [-1393.771] (-1389.713) (-1402.088) (-1389.881) * (-1395.550) (-1401.322) [-1388.301] (-1388.191) -- 0:01:05 58000 -- (-1410.895) [-1392.006] (-1396.933) (-1390.371) * (-1391.756) [-1390.907] (-1388.652) (-1391.362) -- 0:01:04 58500 -- [-1389.229] (-1390.311) (-1393.018) (-1390.407) * (-1396.082) [-1392.497] (-1390.034) (-1390.364) -- 0:01:04 59000 -- (-1388.988) (-1391.631) (-1394.906) [-1389.551] * [-1394.371] (-1396.072) (-1388.979) (-1390.948) -- 0:01:03 59500 -- (-1389.706) (-1391.771) [-1398.858] (-1389.135) * (-1397.217) (-1390.800) (-1387.073) [-1389.059] -- 0:01:03 60000 -- (-1388.530) (-1393.649) (-1398.804) [-1387.785] * (-1397.087) [-1393.340] (-1393.720) (-1389.190) -- 0:01:02 Average standard deviation of split frequencies: 0.032377 60500 -- (-1387.344) (-1390.236) (-1397.834) [-1391.359] * [-1394.574] (-1402.475) (-1387.904) (-1390.676) -- 0:01:02 61000 -- (-1390.234) (-1388.694) [-1393.478] (-1393.570) * [-1399.833] (-1406.042) (-1388.603) (-1388.407) -- 0:01:01 61500 -- (-1391.109) (-1387.816) (-1399.478) [-1390.420] * [-1398.792] (-1399.769) (-1388.646) (-1387.622) -- 0:01:01 62000 -- (-1387.357) (-1387.856) [-1398.875] (-1388.584) * (-1392.110) (-1399.453) (-1389.589) [-1391.808] -- 0:01:00 62500 -- [-1388.193] (-1389.941) (-1395.723) (-1389.289) * (-1395.886) (-1401.478) (-1389.631) [-1391.422] -- 0:01:00 63000 -- (-1391.849) (-1386.886) [-1399.791] (-1394.618) * [-1390.817] (-1396.459) (-1389.237) (-1391.649) -- 0:00:59 63500 -- (-1390.223) [-1386.449] (-1402.543) (-1391.728) * (-1394.499) (-1401.886) [-1387.280] (-1387.855) -- 0:00:58 64000 -- (-1391.003) [-1390.073] (-1397.663) (-1391.804) * (-1398.550) (-1403.836) (-1386.879) [-1389.608] -- 0:00:58 64500 -- (-1391.175) (-1387.477) [-1401.133] (-1390.183) * (-1402.659) (-1391.793) (-1389.599) [-1387.189] -- 0:00:58 65000 -- (-1391.814) (-1393.072) [-1393.517] (-1388.921) * [-1394.993] (-1393.222) (-1390.387) (-1389.134) -- 0:00:57 Average standard deviation of split frequencies: 0.026784 65500 -- (-1392.474) (-1388.462) (-1393.417) [-1389.215] * (-1397.331) [-1394.243] (-1390.595) (-1389.365) -- 0:00:57 66000 -- (-1389.396) [-1388.848] (-1400.983) (-1394.937) * [-1398.044] (-1398.665) (-1387.274) (-1386.174) -- 0:00:56 66500 -- [-1389.329] (-1389.388) (-1402.488) (-1386.584) * [-1399.903] (-1399.823) (-1389.997) (-1387.578) -- 0:00:56 67000 -- (-1388.596) (-1387.269) (-1399.765) [-1387.325] * [-1396.409] (-1399.621) (-1390.545) (-1386.154) -- 0:00:55 67500 -- [-1386.938] (-1391.082) (-1400.931) (-1390.169) * (-1396.713) (-1407.643) [-1389.280] (-1387.968) -- 0:00:55 68000 -- [-1387.838] (-1388.909) (-1403.540) (-1390.609) * (-1388.644) (-1392.317) [-1389.505] (-1386.370) -- 0:01:08 68500 -- [-1387.874] (-1388.897) (-1395.898) (-1390.957) * (-1389.821) (-1390.923) (-1389.105) [-1386.625] -- 0:01:07 69000 -- (-1386.748) [-1389.151] (-1393.826) (-1392.566) * (-1389.402) (-1391.364) [-1388.074] (-1387.278) -- 0:01:07 69500 -- (-1387.584) [-1390.642] (-1397.660) (-1390.394) * (-1389.578) (-1389.368) [-1389.083] (-1386.387) -- 0:01:06 70000 -- [-1389.209] (-1388.328) (-1404.015) (-1387.488) * [-1388.916] (-1388.745) (-1391.642) (-1387.290) -- 0:01:06 Average standard deviation of split frequencies: 0.025683 70500 -- (-1386.952) [-1386.787] (-1394.009) (-1391.323) * [-1388.461] (-1387.635) (-1390.051) (-1387.422) -- 0:01:05 71000 -- [-1387.634] (-1386.486) (-1393.897) (-1390.002) * (-1392.622) (-1387.634) (-1390.906) [-1386.664] -- 0:01:05 71500 -- (-1387.749) (-1391.248) [-1394.413] (-1389.386) * (-1389.188) [-1390.016] (-1386.893) (-1386.434) -- 0:01:04 72000 -- (-1388.201) (-1392.790) [-1393.363] (-1390.004) * (-1391.186) (-1387.666) [-1386.411] (-1387.719) -- 0:01:04 72500 -- [-1388.723] (-1388.406) (-1402.971) (-1387.923) * [-1388.552] (-1390.599) (-1387.052) (-1388.304) -- 0:01:03 73000 -- (-1390.185) (-1386.719) [-1393.502] (-1387.973) * (-1389.459) (-1387.967) (-1388.025) [-1390.645] -- 0:01:03 73500 -- (-1388.562) (-1388.111) [-1396.953] (-1389.514) * (-1389.517) (-1387.855) (-1387.087) [-1388.876] -- 0:01:03 74000 -- [-1387.674] (-1386.477) (-1400.003) (-1389.606) * (-1388.465) [-1389.806] (-1388.338) (-1387.589) -- 0:01:02 74500 -- (-1390.866) [-1387.754] (-1392.919) (-1393.734) * (-1392.120) (-1389.704) (-1388.348) [-1388.361] -- 0:01:02 75000 -- (-1387.314) [-1387.536] (-1397.948) (-1389.415) * (-1390.795) [-1388.034] (-1388.591) (-1388.309) -- 0:01:01 Average standard deviation of split frequencies: 0.030718 75500 -- (-1389.375) (-1387.611) [-1396.381] (-1390.812) * (-1387.476) (-1387.969) [-1387.380] (-1389.680) -- 0:01:01 76000 -- (-1391.758) (-1388.786) [-1391.552] (-1389.695) * [-1389.200] (-1388.892) (-1390.846) (-1387.482) -- 0:01:00 76500 -- [-1387.710] (-1387.544) (-1402.117) (-1390.612) * [-1386.968] (-1389.249) (-1389.637) (-1388.259) -- 0:01:00 77000 -- (-1388.220) (-1386.576) [-1394.281] (-1387.374) * (-1386.281) (-1388.307) [-1387.224] (-1389.864) -- 0:00:59 77500 -- (-1388.129) (-1387.766) (-1403.057) [-1388.324] * (-1389.474) [-1387.998] (-1386.967) (-1388.399) -- 0:00:59 78000 -- [-1387.854] (-1386.311) (-1398.191) (-1390.052) * [-1386.825] (-1386.633) (-1387.981) (-1390.498) -- 0:00:59 78500 -- (-1391.416) (-1386.466) [-1392.763] (-1390.571) * (-1389.709) (-1392.625) [-1387.685] (-1388.592) -- 0:00:58 79000 -- [-1386.937] (-1389.239) (-1394.842) (-1389.354) * (-1388.782) (-1391.073) (-1387.774) [-1389.893] -- 0:00:58 79500 -- (-1388.988) (-1387.403) (-1402.565) [-1386.678] * [-1386.716] (-1388.991) (-1388.079) (-1389.216) -- 0:00:57 80000 -- [-1388.110] (-1389.320) (-1394.387) (-1390.764) * (-1386.552) (-1388.686) (-1388.618) [-1390.556] -- 0:00:57 Average standard deviation of split frequencies: 0.028343 80500 -- (-1388.359) (-1386.785) [-1398.709] (-1392.515) * [-1387.667] (-1387.305) (-1386.977) (-1388.140) -- 0:00:57 81000 -- [-1393.525] (-1388.386) (-1397.852) (-1389.926) * (-1386.700) (-1389.065) (-1387.190) [-1387.313] -- 0:00:56 81500 -- (-1391.413) (-1387.300) [-1398.420] (-1388.277) * (-1388.924) [-1387.291] (-1387.748) (-1391.041) -- 0:00:56 82000 -- (-1389.391) (-1390.871) (-1401.549) [-1388.891] * [-1390.638] (-1389.800) (-1387.606) (-1388.974) -- 0:00:55 82500 -- (-1389.634) [-1391.479] (-1404.110) (-1388.804) * (-1388.472) [-1391.141] (-1386.993) (-1389.614) -- 0:00:55 83000 -- (-1389.356) [-1391.384] (-1392.845) (-1388.277) * (-1387.478) [-1388.298] (-1386.840) (-1388.600) -- 0:00:55 83500 -- [-1389.151] (-1392.271) (-1397.481) (-1386.624) * [-1387.394] (-1390.864) (-1391.009) (-1387.515) -- 0:00:54 84000 -- (-1390.656) [-1391.881] (-1406.756) (-1387.323) * (-1391.325) [-1386.946] (-1389.180) (-1387.659) -- 0:01:05 84500 -- [-1387.086] (-1393.141) (-1394.564) (-1388.014) * (-1393.389) (-1387.594) (-1389.295) [-1387.151] -- 0:01:05 85000 -- [-1386.822] (-1391.352) (-1395.092) (-1388.027) * (-1391.916) (-1387.709) (-1392.597) [-1387.569] -- 0:01:04 Average standard deviation of split frequencies: 0.029495 85500 -- (-1386.794) (-1395.516) [-1396.892] (-1387.894) * [-1387.795] (-1389.005) (-1388.468) (-1388.866) -- 0:01:04 86000 -- (-1387.594) (-1389.268) [-1399.244] (-1388.603) * (-1387.863) (-1388.686) [-1388.317] (-1390.386) -- 0:01:03 86500 -- [-1387.507] (-1388.094) (-1400.430) (-1387.674) * (-1388.662) [-1388.119] (-1389.829) (-1392.647) -- 0:01:03 87000 -- [-1390.181] (-1388.408) (-1402.527) (-1388.813) * (-1387.756) [-1387.593] (-1388.220) (-1393.170) -- 0:01:02 87500 -- (-1388.074) [-1387.998] (-1397.367) (-1388.111) * (-1391.847) [-1388.594] (-1387.882) (-1388.193) -- 0:01:02 88000 -- (-1391.376) (-1390.576) (-1389.556) [-1387.366] * [-1390.111] (-1387.861) (-1387.984) (-1390.277) -- 0:01:02 88500 -- (-1389.286) (-1387.699) (-1389.355) [-1387.369] * [-1388.757] (-1389.535) (-1390.751) (-1391.365) -- 0:01:01 89000 -- (-1388.200) (-1388.115) (-1388.483) [-1387.946] * [-1389.874] (-1387.425) (-1390.447) (-1387.192) -- 0:01:01 89500 -- (-1387.472) (-1388.812) [-1387.899] (-1387.915) * (-1389.341) (-1387.715) (-1388.889) [-1387.106] -- 0:01:01 90000 -- [-1387.538] (-1388.235) (-1390.703) (-1388.022) * (-1388.610) (-1388.651) (-1392.159) [-1386.866] -- 0:01:00 Average standard deviation of split frequencies: 0.026739 90500 -- [-1386.920] (-1386.651) (-1389.736) (-1387.004) * (-1389.602) (-1389.891) (-1390.490) [-1387.034] -- 0:01:00 91000 -- (-1387.616) [-1387.381] (-1388.893) (-1387.373) * (-1389.211) [-1389.068] (-1393.235) (-1389.304) -- 0:00:59 91500 -- (-1391.938) (-1386.519) (-1389.086) [-1387.627] * [-1392.601] (-1388.017) (-1394.067) (-1389.814) -- 0:00:59 92000 -- (-1390.745) (-1390.987) (-1389.640) [-1388.854] * (-1388.816) [-1388.967] (-1392.635) (-1390.883) -- 0:00:59 92500 -- (-1390.036) (-1393.049) (-1389.230) [-1389.388] * (-1387.286) (-1389.699) (-1390.230) [-1388.054] -- 0:00:58 93000 -- (-1389.401) (-1389.451) (-1387.840) [-1392.249] * (-1388.173) (-1390.078) [-1391.280] (-1388.317) -- 0:00:58 93500 -- [-1390.697] (-1392.129) (-1387.984) (-1392.454) * [-1388.109] (-1391.052) (-1386.912) (-1387.722) -- 0:00:58 94000 -- (-1389.393) [-1390.785] (-1388.564) (-1389.230) * (-1388.126) [-1388.591] (-1386.805) (-1388.069) -- 0:00:57 94500 -- (-1393.014) (-1386.450) [-1390.976] (-1390.847) * (-1391.156) (-1388.560) [-1387.566] (-1386.800) -- 0:00:57 95000 -- (-1387.662) (-1386.243) (-1388.809) [-1389.780] * (-1393.603) (-1390.578) (-1388.073) [-1387.237] -- 0:00:57 Average standard deviation of split frequencies: 0.029217 95500 -- [-1387.822] (-1387.104) (-1393.681) (-1391.481) * (-1393.960) (-1388.170) (-1389.072) [-1388.926] -- 0:00:56 96000 -- [-1386.598] (-1387.106) (-1389.981) (-1388.778) * (-1390.058) (-1387.913) [-1387.868] (-1388.982) -- 0:00:56 96500 -- (-1388.431) [-1386.273] (-1393.123) (-1388.562) * (-1388.103) [-1387.405] (-1386.541) (-1388.924) -- 0:00:56 97000 -- (-1387.209) (-1388.904) [-1388.162] (-1388.485) * (-1387.418) (-1390.173) [-1386.958] (-1390.540) -- 0:00:55 97500 -- (-1387.784) [-1388.343] (-1389.828) (-1388.674) * (-1388.481) [-1388.728] (-1386.391) (-1392.721) -- 0:00:55 98000 -- (-1388.767) (-1390.672) (-1389.590) [-1389.071] * (-1389.304) [-1387.539] (-1386.387) (-1391.824) -- 0:00:55 98500 -- (-1390.202) (-1387.903) [-1388.938] (-1389.438) * (-1387.324) (-1392.710) (-1388.209) [-1387.954] -- 0:00:54 99000 -- (-1388.873) (-1386.741) (-1391.785) [-1390.654] * [-1386.522] (-1389.661) (-1387.918) (-1387.804) -- 0:00:54 99500 -- (-1390.675) (-1388.541) [-1389.716] (-1390.605) * (-1388.359) (-1393.291) (-1386.998) [-1387.911] -- 0:00:54 100000 -- (-1390.709) [-1387.207] (-1391.263) (-1392.115) * (-1390.416) (-1389.980) (-1389.193) [-1390.638] -- 0:01:02 Average standard deviation of split frequencies: 0.022745 100500 -- (-1391.210) (-1387.773) (-1389.311) [-1388.362] * (-1388.683) (-1391.005) (-1389.002) [-1391.054] -- 0:01:02 101000 -- (-1391.334) (-1393.555) [-1388.817] (-1387.178) * (-1388.254) (-1394.913) [-1394.205] (-1391.475) -- 0:01:02 101500 -- [-1389.545] (-1387.535) (-1387.073) (-1391.413) * (-1390.643) [-1389.068] (-1391.858) (-1394.267) -- 0:01:01 102000 -- (-1387.123) [-1387.925] (-1389.025) (-1393.768) * (-1387.240) (-1388.106) [-1391.317] (-1390.760) -- 0:01:01 102500 -- (-1387.123) [-1388.763] (-1391.189) (-1391.037) * [-1386.943] (-1388.326) (-1391.870) (-1391.171) -- 0:01:01 103000 -- (-1387.184) (-1391.387) (-1388.817) [-1389.024] * (-1388.974) (-1387.940) [-1390.757] (-1392.153) -- 0:01:00 103500 -- (-1388.454) (-1388.538) [-1390.004] (-1389.365) * (-1388.606) [-1390.494] (-1390.469) (-1392.090) -- 0:01:00 104000 -- (-1387.996) [-1388.923] (-1387.489) (-1387.344) * (-1387.661) (-1388.636) (-1389.747) [-1387.888] -- 0:01:00 104500 -- (-1390.447) [-1387.796] (-1387.211) (-1389.145) * (-1387.299) (-1386.776) (-1389.520) [-1389.745] -- 0:00:59 105000 -- [-1387.739] (-1387.238) (-1388.448) (-1389.483) * [-1391.016] (-1387.494) (-1388.294) (-1389.414) -- 0:00:59 Average standard deviation of split frequencies: 0.024566 105500 -- (-1386.614) [-1386.739] (-1386.278) (-1388.779) * [-1394.512] (-1388.966) (-1388.442) (-1390.660) -- 0:00:59 106000 -- (-1388.953) (-1386.596) (-1387.650) [-1388.752] * [-1388.817] (-1392.358) (-1388.889) (-1388.933) -- 0:00:59 106500 -- (-1392.253) (-1386.458) (-1390.020) [-1387.863] * (-1388.906) (-1389.915) (-1389.115) [-1388.548] -- 0:00:58 107000 -- (-1391.866) [-1387.045] (-1387.096) (-1388.335) * [-1388.773] (-1390.618) (-1387.896) (-1387.241) -- 0:00:58 107500 -- [-1389.443] (-1387.611) (-1387.278) (-1396.416) * [-1387.289] (-1387.149) (-1387.546) (-1386.168) -- 0:00:58 108000 -- (-1392.108) (-1393.039) [-1386.465] (-1387.769) * (-1387.917) (-1387.724) (-1389.178) [-1387.151] -- 0:00:57 108500 -- (-1387.263) (-1390.549) (-1386.482) [-1386.648] * [-1386.472] (-1387.367) (-1387.717) (-1388.573) -- 0:00:57 109000 -- (-1391.536) (-1390.362) (-1387.627) [-1387.998] * [-1387.083] (-1387.548) (-1387.811) (-1387.814) -- 0:00:57 109500 -- (-1391.623) (-1386.586) [-1388.466] (-1386.544) * (-1388.189) (-1389.587) [-1387.058] (-1387.773) -- 0:00:56 110000 -- (-1388.891) (-1387.992) (-1388.710) [-1387.195] * (-1390.167) (-1388.390) [-1387.875] (-1387.474) -- 0:00:56 Average standard deviation of split frequencies: 0.025152 110500 -- (-1391.173) [-1388.000] (-1387.738) (-1388.696) * (-1386.871) (-1388.015) [-1387.607] (-1388.022) -- 0:00:56 111000 -- (-1390.255) (-1387.916) (-1390.823) [-1388.406] * [-1386.416] (-1389.283) (-1387.423) (-1389.995) -- 0:00:56 111500 -- [-1388.485] (-1386.996) (-1390.219) (-1389.847) * [-1389.493] (-1389.794) (-1388.215) (-1395.708) -- 0:00:55 112000 -- (-1390.047) [-1386.288] (-1391.124) (-1391.990) * (-1387.655) (-1388.731) (-1388.328) [-1389.488] -- 0:00:55 112500 -- [-1387.241] (-1386.707) (-1387.645) (-1387.595) * (-1387.219) (-1387.565) [-1391.341] (-1389.737) -- 0:00:55 113000 -- (-1387.500) (-1386.482) (-1387.947) [-1389.411] * (-1388.555) (-1389.254) (-1392.197) [-1389.143] -- 0:00:54 113500 -- (-1387.740) [-1387.469] (-1390.835) (-1386.583) * (-1387.974) (-1392.498) [-1390.801] (-1389.367) -- 0:00:54 114000 -- [-1391.941] (-1388.495) (-1387.967) (-1389.790) * [-1387.474] (-1389.196) (-1389.859) (-1388.142) -- 0:00:54 114500 -- (-1388.587) (-1388.366) (-1387.614) [-1387.347] * (-1387.209) (-1388.117) [-1389.694] (-1388.781) -- 0:00:54 115000 -- (-1387.940) [-1387.556] (-1390.591) (-1387.504) * [-1387.181] (-1392.230) (-1388.797) (-1387.878) -- 0:00:53 Average standard deviation of split frequencies: 0.023222 115500 -- (-1389.010) [-1386.711] (-1389.008) (-1388.460) * (-1388.675) (-1390.401) [-1386.966] (-1389.943) -- 0:01:01 116000 -- (-1389.403) (-1386.795) (-1393.184) [-1387.540] * (-1386.591) (-1389.701) [-1387.565] (-1389.825) -- 0:01:00 116500 -- (-1389.871) (-1387.490) (-1391.162) [-1388.246] * [-1386.469] (-1391.311) (-1392.096) (-1392.087) -- 0:01:00 117000 -- (-1391.200) [-1390.036] (-1390.709) (-1387.221) * [-1388.817] (-1389.618) (-1389.174) (-1390.126) -- 0:01:00 117500 -- (-1388.677) (-1388.164) (-1392.764) [-1387.475] * (-1389.566) (-1390.495) [-1388.480] (-1391.551) -- 0:01:00 118000 -- [-1386.449] (-1388.164) (-1390.268) (-1389.857) * (-1388.560) [-1389.906] (-1387.541) (-1391.887) -- 0:00:59 118500 -- (-1388.560) (-1390.157) [-1389.985] (-1388.825) * (-1389.547) [-1389.871] (-1388.839) (-1392.197) -- 0:00:59 119000 -- (-1387.876) (-1389.366) [-1386.406] (-1388.054) * (-1389.932) (-1387.024) [-1394.365] (-1390.513) -- 0:00:59 119500 -- [-1387.777] (-1387.693) (-1387.478) (-1386.519) * (-1390.436) (-1390.502) (-1387.388) [-1387.375] -- 0:00:58 120000 -- (-1388.174) (-1387.071) [-1386.842] (-1387.751) * (-1389.562) (-1388.458) [-1387.475] (-1388.306) -- 0:00:58 Average standard deviation of split frequencies: 0.020277 120500 -- (-1386.784) (-1387.365) [-1386.640] (-1392.553) * (-1386.258) (-1390.253) (-1387.551) [-1388.168] -- 0:00:58 121000 -- (-1386.818) (-1387.461) [-1386.638] (-1388.454) * (-1389.422) (-1390.118) (-1387.635) [-1386.993] -- 0:00:58 121500 -- (-1386.271) (-1387.319) (-1386.122) [-1386.526] * (-1401.809) (-1388.857) [-1387.109] (-1389.025) -- 0:00:57 122000 -- (-1388.750) (-1390.601) [-1386.122] (-1390.825) * (-1398.254) (-1390.759) [-1387.780] (-1390.899) -- 0:00:57 122500 -- (-1389.010) (-1389.482) (-1390.558) [-1386.305] * (-1388.469) [-1390.681] (-1387.725) (-1386.215) -- 0:00:57 123000 -- (-1386.297) (-1393.157) [-1390.419] (-1390.222) * (-1388.425) (-1391.947) (-1387.602) [-1388.371] -- 0:00:57 123500 -- (-1391.118) (-1389.287) (-1392.789) [-1386.971] * (-1388.019) (-1388.246) (-1388.734) [-1388.210] -- 0:00:56 124000 -- [-1392.661] (-1390.911) (-1393.198) (-1388.036) * (-1389.017) (-1387.182) [-1387.303] (-1387.965) -- 0:00:56 124500 -- (-1392.207) (-1389.835) (-1393.034) [-1389.422] * (-1390.040) [-1388.516] (-1386.424) (-1387.768) -- 0:00:56 125000 -- (-1389.887) [-1386.572] (-1389.175) (-1389.607) * (-1388.196) (-1387.509) (-1386.993) [-1388.285] -- 0:00:56 Average standard deviation of split frequencies: 0.020407 125500 -- (-1389.182) (-1388.999) (-1395.801) [-1392.582] * (-1388.637) (-1388.400) [-1387.431] (-1390.793) -- 0:00:55 126000 -- [-1386.679] (-1389.739) (-1392.850) (-1386.832) * (-1388.171) (-1389.334) (-1386.645) [-1391.665] -- 0:00:55 126500 -- (-1386.744) [-1388.946] (-1392.833) (-1390.717) * (-1389.251) (-1389.724) (-1386.762) [-1387.216] -- 0:00:55 127000 -- [-1387.730] (-1389.565) (-1387.684) (-1390.169) * (-1388.657) (-1386.438) (-1386.804) [-1387.199] -- 0:00:54 127500 -- (-1389.987) (-1390.338) (-1388.304) [-1388.546] * [-1386.654] (-1389.245) (-1388.522) (-1387.711) -- 0:00:54 128000 -- (-1392.858) (-1392.005) [-1388.405] (-1387.000) * (-1387.867) [-1386.633] (-1389.083) (-1388.073) -- 0:00:54 128500 -- (-1390.477) (-1394.453) [-1386.785] (-1387.647) * (-1386.628) (-1387.442) [-1387.041] (-1387.914) -- 0:00:54 129000 -- (-1390.851) (-1393.763) [-1386.760] (-1386.562) * (-1391.750) (-1387.767) [-1388.319] (-1389.924) -- 0:00:54 129500 -- [-1388.721] (-1393.489) (-1388.636) (-1387.264) * (-1396.487) (-1388.187) (-1387.830) [-1389.792] -- 0:00:53 130000 -- (-1390.643) (-1386.578) [-1389.128] (-1386.425) * (-1392.989) [-1387.918] (-1386.642) (-1391.984) -- 0:00:53 Average standard deviation of split frequencies: 0.022548 130500 -- (-1393.475) [-1388.090] (-1388.872) (-1386.427) * (-1393.778) (-1387.825) (-1388.666) [-1387.619] -- 0:00:53 131000 -- (-1393.753) [-1388.666] (-1387.350) (-1386.910) * (-1388.232) (-1388.572) [-1389.984] (-1388.994) -- 0:00:53 131500 -- [-1389.351] (-1388.877) (-1390.607) (-1386.946) * (-1387.796) (-1388.850) [-1390.328] (-1392.632) -- 0:00:59 132000 -- (-1387.855) (-1386.474) (-1388.523) [-1386.991] * (-1388.916) (-1389.336) [-1388.701] (-1390.751) -- 0:00:59 132500 -- (-1386.054) (-1389.583) [-1387.592] (-1386.250) * (-1387.587) (-1387.737) (-1386.816) [-1389.353] -- 0:00:58 133000 -- (-1387.395) [-1390.195] (-1394.642) (-1387.010) * (-1392.481) [-1387.371] (-1388.278) (-1388.026) -- 0:00:58 133500 -- (-1388.668) (-1388.396) (-1387.289) [-1387.882] * (-1394.484) [-1386.864] (-1386.569) (-1390.093) -- 0:00:58 134000 -- (-1387.871) [-1388.317] (-1387.893) (-1388.080) * [-1387.518] (-1386.343) (-1387.888) (-1388.841) -- 0:00:58 134500 -- (-1387.588) [-1387.656] (-1387.263) (-1389.250) * (-1391.133) [-1386.300] (-1389.643) (-1386.813) -- 0:00:57 135000 -- [-1388.875] (-1391.309) (-1387.307) (-1388.697) * [-1388.268] (-1388.681) (-1389.145) (-1387.329) -- 0:00:57 Average standard deviation of split frequencies: 0.018718 135500 -- (-1390.498) (-1392.276) [-1387.202] (-1388.097) * (-1389.190) (-1388.459) (-1388.103) [-1386.798] -- 0:00:57 136000 -- (-1390.819) [-1391.917] (-1387.365) (-1390.768) * [-1389.475] (-1389.893) (-1387.089) (-1387.415) -- 0:00:57 136500 -- (-1387.673) (-1393.528) (-1389.717) [-1389.848] * [-1389.329] (-1389.462) (-1386.898) (-1387.766) -- 0:00:56 137000 -- [-1388.125] (-1394.810) (-1390.279) (-1391.838) * (-1389.261) (-1389.436) [-1389.618] (-1387.278) -- 0:00:56 137500 -- [-1388.775] (-1391.037) (-1386.760) (-1386.310) * (-1388.335) (-1387.717) (-1390.171) [-1386.559] -- 0:00:56 138000 -- (-1388.600) (-1391.344) [-1386.528] (-1388.383) * (-1388.220) [-1388.192] (-1389.329) (-1390.106) -- 0:00:56 138500 -- (-1388.375) (-1388.198) (-1388.140) [-1391.193] * [-1386.388] (-1387.997) (-1397.699) (-1387.102) -- 0:00:55 139000 -- (-1389.663) (-1389.904) (-1386.839) [-1387.852] * (-1386.962) (-1388.294) (-1392.414) [-1387.102] -- 0:00:55 139500 -- (-1388.120) (-1390.629) (-1386.914) [-1389.111] * [-1390.442] (-1387.983) (-1389.557) (-1388.825) -- 0:00:55 140000 -- (-1392.420) [-1387.842] (-1389.644) (-1388.943) * (-1387.981) [-1389.049] (-1389.687) (-1387.749) -- 0:00:55 Average standard deviation of split frequencies: 0.018831 140500 -- (-1387.913) (-1386.892) (-1389.195) [-1390.011] * [-1389.826] (-1387.569) (-1387.641) (-1387.010) -- 0:00:55 141000 -- (-1392.359) (-1390.928) [-1388.216] (-1387.540) * (-1387.101) [-1387.537] (-1387.239) (-1386.738) -- 0:00:54 141500 -- (-1394.190) (-1391.435) (-1387.495) [-1388.056] * (-1386.603) [-1386.652] (-1386.899) (-1387.353) -- 0:00:54 142000 -- [-1388.927] (-1388.115) (-1387.044) (-1389.437) * [-1386.433] (-1386.732) (-1387.639) (-1386.348) -- 0:00:54 142500 -- (-1386.035) (-1388.224) [-1389.445] (-1388.973) * [-1386.445] (-1388.428) (-1386.929) (-1387.344) -- 0:00:54 143000 -- (-1387.938) (-1388.338) [-1389.212] (-1392.907) * (-1387.090) (-1386.744) (-1387.381) [-1387.551] -- 0:00:53 143500 -- (-1388.508) (-1390.543) (-1388.427) [-1390.547] * [-1386.822] (-1390.702) (-1389.016) (-1388.079) -- 0:00:53 144000 -- (-1388.238) [-1388.193] (-1387.771) (-1388.132) * (-1387.655) [-1387.048] (-1386.472) (-1389.373) -- 0:00:53 144500 -- (-1387.882) (-1388.501) [-1390.143] (-1389.155) * (-1390.576) (-1388.407) (-1386.829) [-1387.541] -- 0:00:53 145000 -- (-1392.578) (-1392.700) (-1387.881) [-1389.382] * (-1387.742) (-1389.451) [-1387.383] (-1386.489) -- 0:00:53 Average standard deviation of split frequencies: 0.017682 145500 -- (-1391.604) (-1387.830) [-1387.114] (-1389.571) * [-1386.679] (-1393.333) (-1386.443) (-1386.290) -- 0:00:52 146000 -- (-1388.555) (-1389.611) [-1387.133] (-1389.371) * [-1386.679] (-1389.612) (-1389.342) (-1387.786) -- 0:00:52 146500 -- (-1389.036) (-1389.066) [-1388.185] (-1388.712) * [-1386.656] (-1388.060) (-1386.756) (-1390.308) -- 0:00:52 147000 -- (-1389.674) (-1387.592) [-1388.468] (-1387.499) * (-1389.879) [-1388.629] (-1386.892) (-1389.201) -- 0:00:52 147500 -- (-1387.315) (-1389.333) [-1387.552] (-1387.586) * (-1390.475) (-1392.425) [-1386.864] (-1390.249) -- 0:00:57 148000 -- [-1386.720] (-1387.484) (-1387.617) (-1387.747) * (-1388.260) (-1389.285) (-1387.264) [-1388.326] -- 0:00:57 148500 -- [-1388.049] (-1388.703) (-1388.475) (-1389.521) * (-1389.250) [-1387.362] (-1387.261) (-1389.653) -- 0:00:57 149000 -- (-1387.875) [-1388.033] (-1387.280) (-1391.524) * [-1390.839] (-1386.979) (-1387.921) (-1391.053) -- 0:00:57 149500 -- [-1391.553] (-1389.141) (-1394.658) (-1387.915) * (-1387.951) [-1389.363] (-1390.738) (-1387.721) -- 0:00:56 150000 -- (-1388.704) [-1390.634] (-1389.022) (-1389.943) * (-1387.222) [-1388.156] (-1391.086) (-1389.767) -- 0:00:56 Average standard deviation of split frequencies: 0.019071 150500 -- (-1390.602) [-1389.155] (-1389.343) (-1388.783) * (-1387.231) [-1386.876] (-1387.691) (-1391.908) -- 0:00:56 151000 -- [-1388.041] (-1387.335) (-1389.375) (-1392.669) * (-1388.730) (-1388.690) [-1391.281] (-1392.922) -- 0:00:56 151500 -- (-1391.102) [-1388.096] (-1389.824) (-1393.485) * (-1388.987) [-1391.347] (-1391.968) (-1389.949) -- 0:00:56 152000 -- [-1387.325] (-1388.139) (-1391.027) (-1388.844) * (-1387.800) (-1393.650) (-1389.351) [-1386.883] -- 0:00:55 152500 -- (-1392.054) (-1388.902) (-1388.019) [-1387.417] * [-1388.920] (-1389.499) (-1390.676) (-1387.654) -- 0:00:55 153000 -- [-1390.036] (-1388.454) (-1387.889) (-1386.899) * (-1388.030) [-1390.815] (-1392.600) (-1387.121) -- 0:00:55 153500 -- (-1390.863) [-1388.773] (-1390.046) (-1387.137) * [-1388.998] (-1391.020) (-1387.533) (-1387.813) -- 0:00:55 154000 -- (-1391.072) [-1390.409] (-1388.453) (-1386.183) * (-1387.299) (-1390.230) [-1388.308] (-1388.653) -- 0:00:54 154500 -- [-1388.367] (-1389.472) (-1387.339) (-1392.790) * (-1387.868) (-1388.766) (-1389.023) [-1387.016] -- 0:00:54 155000 -- (-1386.960) [-1388.694] (-1388.183) (-1389.498) * [-1390.044] (-1386.790) (-1391.295) (-1387.561) -- 0:00:54 Average standard deviation of split frequencies: 0.017829 155500 -- (-1391.382) (-1390.780) [-1387.810] (-1401.856) * [-1387.617] (-1386.617) (-1389.359) (-1387.401) -- 0:00:54 156000 -- [-1390.985] (-1387.924) (-1387.053) (-1394.642) * (-1388.224) (-1387.973) [-1387.737] (-1392.287) -- 0:00:54 156500 -- (-1391.200) [-1387.846] (-1388.021) (-1388.159) * [-1387.577] (-1387.447) (-1393.041) (-1391.501) -- 0:00:53 157000 -- (-1387.407) (-1386.806) [-1389.356] (-1388.637) * (-1388.666) (-1390.837) (-1389.106) [-1387.806] -- 0:00:53 157500 -- (-1387.062) (-1394.284) (-1387.317) [-1389.009] * [-1388.944] (-1389.331) (-1387.454) (-1387.457) -- 0:00:53 158000 -- (-1387.553) (-1393.764) (-1386.987) [-1388.358] * (-1389.893) [-1390.003] (-1390.150) (-1387.318) -- 0:00:53 158500 -- (-1386.577) (-1392.081) (-1387.109) [-1388.181] * (-1389.538) [-1389.466] (-1396.312) (-1386.977) -- 0:00:53 159000 -- [-1386.753] (-1388.241) (-1389.633) (-1387.785) * (-1391.239) (-1390.672) (-1394.429) [-1387.146] -- 0:00:52 159500 -- (-1388.631) (-1388.320) (-1387.282) [-1388.263] * (-1395.249) (-1388.260) (-1390.995) [-1386.818] -- 0:00:52 160000 -- (-1389.046) (-1390.483) [-1387.153] (-1387.755) * (-1387.903) (-1389.159) [-1389.367] (-1387.535) -- 0:00:52 Average standard deviation of split frequencies: 0.017295 160500 -- (-1390.596) (-1387.796) [-1388.438] (-1388.322) * [-1386.347] (-1390.106) (-1387.404) (-1386.369) -- 0:00:52 161000 -- [-1389.537] (-1392.189) (-1390.688) (-1389.848) * (-1387.267) (-1389.787) (-1388.093) [-1387.228] -- 0:00:52 161500 -- [-1388.350] (-1392.104) (-1387.212) (-1390.528) * (-1387.454) (-1387.782) (-1388.186) [-1387.100] -- 0:00:51 162000 -- (-1389.425) (-1391.242) [-1388.036] (-1387.642) * (-1387.467) [-1387.646] (-1389.877) (-1387.252) -- 0:00:51 162500 -- (-1387.965) (-1389.245) (-1389.744) [-1388.461] * (-1389.485) (-1386.528) (-1388.980) [-1386.516] -- 0:00:51 163000 -- (-1387.811) [-1389.211] (-1391.158) (-1391.969) * (-1390.254) [-1388.164] (-1388.426) (-1389.676) -- 0:00:51 163500 -- [-1388.352] (-1390.123) (-1391.410) (-1389.779) * [-1389.206] (-1387.319) (-1387.006) (-1391.606) -- 0:00:56 164000 -- (-1393.318) (-1388.684) (-1390.529) [-1389.935] * (-1388.962) (-1387.149) [-1386.368] (-1391.633) -- 0:00:56 164500 -- (-1390.680) (-1388.076) [-1390.384] (-1387.985) * (-1388.781) [-1385.980] (-1386.617) (-1393.383) -- 0:00:55 165000 -- (-1394.034) (-1389.297) [-1391.343] (-1387.294) * [-1389.360] (-1389.641) (-1388.793) (-1393.280) -- 0:00:55 Average standard deviation of split frequencies: 0.017354 165500 -- (-1395.331) (-1389.741) (-1392.927) [-1387.112] * (-1390.176) [-1386.365] (-1388.874) (-1389.003) -- 0:00:55 166000 -- [-1388.903] (-1390.134) (-1391.570) (-1389.524) * (-1389.688) (-1386.392) (-1388.413) [-1387.092] -- 0:00:55 166500 -- (-1392.768) (-1389.603) (-1386.603) [-1388.044] * (-1389.405) [-1387.883] (-1395.585) (-1394.490) -- 0:00:55 167000 -- (-1394.457) (-1394.681) [-1386.679] (-1388.098) * (-1389.371) (-1390.655) [-1391.520] (-1388.310) -- 0:00:54 167500 -- (-1390.085) (-1391.086) (-1387.649) [-1387.032] * (-1387.251) (-1386.866) [-1390.277] (-1388.261) -- 0:00:54 168000 -- (-1388.576) (-1391.194) (-1387.649) [-1392.446] * (-1387.776) (-1388.041) [-1390.920] (-1388.269) -- 0:00:54 168500 -- (-1388.904) (-1387.249) [-1389.998] (-1392.225) * (-1387.606) (-1388.949) [-1388.838] (-1391.388) -- 0:00:54 169000 -- (-1388.490) (-1387.188) (-1388.467) [-1390.065] * (-1390.065) [-1389.845] (-1388.552) (-1392.756) -- 0:00:54 169500 -- (-1389.461) [-1388.108] (-1387.504) (-1387.354) * (-1388.664) (-1388.588) (-1388.376) [-1386.073] -- 0:00:53 170000 -- (-1388.109) (-1390.194) [-1386.898] (-1387.069) * (-1393.811) (-1388.606) [-1390.514] (-1389.313) -- 0:00:53 Average standard deviation of split frequencies: 0.016880 170500 -- [-1386.540] (-1388.571) (-1389.761) (-1387.105) * (-1390.369) (-1389.547) (-1388.600) [-1387.063] -- 0:00:53 171000 -- [-1387.953] (-1389.456) (-1387.821) (-1388.571) * [-1391.498] (-1388.641) (-1389.446) (-1387.396) -- 0:00:53 171500 -- (-1387.167) (-1388.199) (-1387.926) [-1387.535] * (-1390.678) (-1390.240) [-1387.664] (-1387.132) -- 0:00:53 172000 -- (-1390.211) (-1388.995) (-1388.123) [-1386.144] * (-1388.660) (-1390.214) [-1391.458] (-1388.100) -- 0:00:52 172500 -- (-1387.953) [-1389.203] (-1386.866) (-1386.089) * (-1389.526) [-1391.749] (-1393.129) (-1387.785) -- 0:00:52 173000 -- (-1389.246) (-1390.658) [-1387.248] (-1386.281) * [-1389.815] (-1388.213) (-1387.835) (-1391.908) -- 0:00:52 173500 -- (-1389.648) (-1390.562) [-1389.520] (-1389.228) * (-1392.892) (-1388.447) [-1388.951] (-1387.703) -- 0:00:52 174000 -- (-1389.635) (-1392.699) [-1387.157] (-1388.490) * [-1394.752] (-1388.741) (-1387.351) (-1387.344) -- 0:00:52 174500 -- (-1386.472) (-1392.036) (-1387.122) [-1386.839] * (-1387.410) (-1390.999) (-1391.361) [-1386.666] -- 0:00:52 175000 -- [-1386.530] (-1388.491) (-1386.328) (-1390.724) * (-1388.216) (-1388.397) (-1388.687) [-1387.445] -- 0:00:51 Average standard deviation of split frequencies: 0.016517 175500 -- (-1388.771) (-1390.851) (-1388.876) [-1389.975] * (-1388.607) (-1389.121) (-1388.594) [-1387.157] -- 0:00:51 176000 -- [-1386.852] (-1389.159) (-1386.540) (-1389.724) * (-1391.035) (-1388.560) (-1390.774) [-1387.063] -- 0:00:51 176500 -- (-1387.857) [-1387.657] (-1386.496) (-1391.050) * [-1388.906] (-1387.437) (-1390.138) (-1387.464) -- 0:00:51 177000 -- [-1388.372] (-1386.912) (-1387.936) (-1391.987) * [-1387.707] (-1387.251) (-1390.321) (-1392.701) -- 0:00:51 177500 -- [-1387.727] (-1392.438) (-1387.533) (-1391.424) * (-1388.481) (-1387.283) (-1393.172) [-1387.282] -- 0:00:50 178000 -- (-1386.959) (-1388.538) [-1390.630] (-1389.452) * (-1386.582) (-1388.387) (-1389.059) [-1387.783] -- 0:00:50 178500 -- [-1387.874] (-1388.343) (-1388.013) (-1390.715) * (-1386.770) [-1387.680] (-1389.983) (-1388.248) -- 0:00:50 179000 -- [-1387.362] (-1393.033) (-1388.968) (-1390.627) * [-1387.995] (-1387.045) (-1392.607) (-1386.693) -- 0:00:50 179500 -- (-1388.804) (-1392.019) (-1391.273) [-1389.272] * [-1387.100] (-1390.031) (-1387.433) (-1386.474) -- 0:00:54 180000 -- (-1388.495) [-1387.357] (-1388.094) (-1388.151) * (-1389.232) (-1391.905) [-1389.111] (-1391.326) -- 0:00:54 Average standard deviation of split frequencies: 0.015366 180500 -- (-1388.163) (-1390.743) (-1386.491) [-1387.169] * [-1390.593] (-1391.387) (-1392.608) (-1389.890) -- 0:00:54 181000 -- [-1387.492] (-1388.280) (-1389.037) (-1391.355) * (-1387.852) (-1391.512) (-1391.086) [-1386.490] -- 0:00:54 181500 -- [-1387.762] (-1388.246) (-1387.167) (-1389.180) * (-1389.308) (-1394.792) (-1391.934) [-1387.197] -- 0:00:54 182000 -- [-1388.806] (-1388.432) (-1387.236) (-1399.661) * (-1387.610) (-1391.289) (-1387.275) [-1387.825] -- 0:00:53 182500 -- (-1387.513) (-1387.626) (-1388.398) [-1388.546] * (-1390.538) (-1393.505) (-1389.016) [-1389.240] -- 0:00:53 183000 -- (-1389.542) (-1388.112) (-1391.140) [-1388.792] * [-1386.527] (-1391.497) (-1388.832) (-1391.707) -- 0:00:53 183500 -- [-1389.618] (-1388.337) (-1390.610) (-1391.388) * [-1386.529] (-1389.781) (-1390.213) (-1387.410) -- 0:00:53 184000 -- (-1387.270) (-1388.075) (-1387.338) [-1391.594] * (-1387.567) (-1388.971) [-1388.708] (-1389.685) -- 0:00:53 184500 -- (-1391.583) (-1388.074) [-1386.928] (-1391.203) * (-1388.020) (-1387.369) (-1386.515) [-1388.869] -- 0:00:53 185000 -- (-1387.780) (-1390.282) [-1386.899] (-1392.167) * (-1387.830) [-1388.692] (-1387.413) (-1393.179) -- 0:00:52 Average standard deviation of split frequencies: 0.015340 185500 -- [-1388.364] (-1388.371) (-1392.801) (-1389.774) * (-1387.483) [-1390.052] (-1386.762) (-1389.287) -- 0:00:52 186000 -- (-1387.639) (-1388.662) (-1396.060) [-1393.049] * [-1389.484] (-1390.478) (-1387.974) (-1388.291) -- 0:00:52 186500 -- (-1390.272) (-1387.566) [-1389.904] (-1388.108) * [-1391.497] (-1386.716) (-1387.922) (-1389.297) -- 0:00:52 187000 -- (-1388.191) (-1387.327) [-1388.238] (-1388.852) * [-1390.286] (-1387.882) (-1392.354) (-1389.263) -- 0:00:52 187500 -- (-1386.822) (-1388.892) [-1387.266] (-1389.609) * (-1388.601) (-1390.451) (-1389.483) [-1389.463] -- 0:00:52 188000 -- [-1386.796] (-1388.195) (-1386.329) (-1389.205) * (-1388.894) (-1391.040) (-1391.458) [-1389.583] -- 0:00:51 188500 -- (-1386.048) [-1388.735] (-1386.361) (-1389.421) * [-1389.317] (-1393.552) (-1389.995) (-1388.169) -- 0:00:51 189000 -- (-1386.059) (-1386.584) [-1386.942] (-1388.496) * (-1391.238) (-1388.454) [-1390.303] (-1388.589) -- 0:00:51 189500 -- (-1386.059) [-1387.136] (-1386.638) (-1389.125) * (-1387.260) (-1389.919) [-1387.300] (-1390.912) -- 0:00:51 190000 -- (-1388.388) (-1387.775) (-1386.699) [-1387.767] * (-1388.559) (-1394.660) [-1389.868] (-1390.519) -- 0:00:51 Average standard deviation of split frequencies: 0.012637 190500 -- [-1388.003] (-1387.304) (-1389.090) (-1389.162) * (-1389.064) (-1395.734) [-1386.495] (-1388.670) -- 0:00:50 191000 -- (-1387.075) (-1387.902) (-1389.856) [-1387.140] * (-1389.266) (-1389.420) (-1393.551) [-1387.540] -- 0:00:50 191500 -- (-1391.254) (-1392.343) (-1388.920) [-1387.372] * (-1392.850) (-1387.768) (-1387.984) [-1388.570] -- 0:00:50 192000 -- (-1389.235) (-1387.149) [-1389.455] (-1387.372) * (-1392.433) (-1388.946) (-1390.236) [-1389.451] -- 0:00:50 192500 -- (-1396.762) (-1386.466) (-1389.141) [-1390.200] * (-1392.636) (-1388.893) (-1387.292) [-1392.850] -- 0:00:50 193000 -- (-1391.483) [-1386.985] (-1386.536) (-1388.511) * (-1391.181) (-1388.164) (-1390.252) [-1391.178] -- 0:00:50 193500 -- (-1389.110) (-1387.704) (-1390.596) [-1392.182] * (-1388.772) (-1391.566) [-1390.117] (-1387.822) -- 0:00:50 194000 -- [-1390.847] (-1389.359) (-1388.661) (-1391.697) * (-1391.045) (-1394.076) [-1387.150] (-1386.523) -- 0:00:49 194500 -- (-1389.373) (-1392.787) [-1388.275] (-1390.109) * (-1391.173) (-1397.756) [-1391.172] (-1388.619) -- 0:00:49 195000 -- (-1389.248) [-1388.432] (-1387.692) (-1389.161) * (-1390.517) (-1393.653) [-1389.216] (-1386.367) -- 0:00:49 Average standard deviation of split frequencies: 0.012694 195500 -- [-1389.399] (-1387.201) (-1388.783) (-1391.071) * (-1393.412) [-1388.730] (-1389.854) (-1386.427) -- 0:00:53 196000 -- (-1389.477) [-1388.043] (-1388.548) (-1388.226) * (-1395.000) (-1386.700) [-1389.361] (-1386.716) -- 0:00:53 196500 -- (-1394.887) [-1387.981] (-1387.656) (-1386.636) * (-1390.064) (-1388.558) [-1390.087] (-1386.328) -- 0:00:53 197000 -- (-1389.708) (-1388.049) [-1388.531] (-1386.915) * (-1389.153) [-1388.826] (-1389.493) (-1387.203) -- 0:00:52 197500 -- (-1388.752) (-1387.768) (-1387.820) [-1387.716] * [-1390.481] (-1386.919) (-1388.893) (-1389.512) -- 0:00:52 198000 -- (-1387.486) [-1388.534] (-1390.194) (-1387.451) * (-1390.037) [-1387.332] (-1388.566) (-1391.282) -- 0:00:52 198500 -- [-1387.119] (-1388.764) (-1389.962) (-1387.473) * (-1392.539) [-1386.869] (-1389.019) (-1386.951) -- 0:00:52 199000 -- (-1387.619) (-1387.242) (-1386.678) [-1388.566] * [-1387.825] (-1386.404) (-1389.867) (-1387.136) -- 0:00:52 199500 -- (-1388.751) (-1392.317) [-1387.804] (-1388.123) * (-1390.885) [-1387.848] (-1388.034) (-1386.874) -- 0:00:52 200000 -- (-1386.219) (-1389.815) [-1388.446] (-1389.302) * (-1386.601) (-1394.222) [-1389.776] (-1388.097) -- 0:00:51 Average standard deviation of split frequencies: 0.013573 200500 -- (-1386.479) (-1390.337) [-1386.354] (-1388.845) * (-1391.743) (-1387.509) (-1393.469) [-1388.079] -- 0:00:51 201000 -- (-1387.136) [-1389.136] (-1390.216) (-1388.681) * (-1387.543) (-1387.286) [-1387.407] (-1388.278) -- 0:00:51 201500 -- [-1388.851] (-1388.747) (-1390.046) (-1388.131) * [-1387.223] (-1386.791) (-1388.254) (-1387.797) -- 0:00:51 202000 -- (-1388.618) [-1387.992] (-1389.300) (-1389.225) * (-1387.207) (-1389.568) [-1388.017] (-1387.406) -- 0:00:51 202500 -- (-1388.385) [-1387.011] (-1390.940) (-1388.263) * [-1387.051] (-1389.142) (-1387.233) (-1386.872) -- 0:00:51 203000 -- [-1386.655] (-1389.270) (-1394.458) (-1388.196) * (-1390.396) (-1390.601) (-1389.853) [-1386.916] -- 0:00:51 203500 -- (-1391.073) [-1388.743] (-1391.101) (-1389.032) * (-1389.622) (-1390.603) [-1388.568] (-1387.534) -- 0:00:50 204000 -- (-1387.295) (-1388.082) [-1390.295] (-1389.414) * (-1389.923) (-1388.490) (-1391.111) [-1386.858] -- 0:00:50 204500 -- (-1387.241) (-1387.743) (-1390.597) [-1388.574] * [-1389.488] (-1388.815) (-1391.702) (-1386.385) -- 0:00:50 205000 -- (-1389.828) [-1388.538] (-1394.116) (-1387.263) * (-1387.575) (-1391.094) [-1392.973] (-1386.502) -- 0:00:50 Average standard deviation of split frequencies: 0.015055 205500 -- (-1389.251) [-1391.586] (-1389.925) (-1388.132) * (-1387.707) (-1392.129) (-1387.969) [-1386.551] -- 0:00:50 206000 -- (-1389.251) (-1388.932) [-1388.216] (-1389.271) * (-1386.728) (-1390.104) (-1387.954) [-1391.165] -- 0:00:50 206500 -- (-1393.360) [-1389.146] (-1389.546) (-1389.301) * (-1386.930) (-1391.540) [-1387.100] (-1390.239) -- 0:00:49 207000 -- (-1388.461) (-1389.219) [-1389.453] (-1387.196) * (-1387.095) (-1389.674) (-1387.110) [-1391.172] -- 0:00:49 207500 -- (-1388.275) (-1388.075) [-1387.563] (-1387.291) * [-1387.289] (-1391.324) (-1389.778) (-1391.218) -- 0:00:49 208000 -- [-1389.573] (-1387.138) (-1387.305) (-1388.725) * (-1387.496) (-1389.445) (-1387.791) [-1386.641] -- 0:00:49 208500 -- (-1392.551) [-1388.765] (-1387.861) (-1387.663) * [-1387.871] (-1390.346) (-1389.675) (-1386.640) -- 0:00:49 209000 -- (-1389.722) (-1388.728) (-1388.224) [-1387.696] * [-1389.031] (-1392.176) (-1390.528) (-1387.022) -- 0:00:49 209500 -- (-1391.164) (-1390.015) (-1387.150) [-1387.446] * (-1387.755) [-1391.442] (-1388.576) (-1387.411) -- 0:00:49 210000 -- (-1389.801) (-1388.437) [-1389.123] (-1388.836) * [-1388.938] (-1391.668) (-1388.534) (-1387.509) -- 0:00:48 Average standard deviation of split frequencies: 0.012556 210500 -- (-1393.107) (-1389.293) (-1390.246) [-1394.235] * (-1388.414) (-1388.865) (-1388.292) [-1387.885] -- 0:00:48 211000 -- [-1389.292] (-1389.129) (-1390.683) (-1386.747) * (-1386.471) (-1388.775) (-1387.756) [-1387.387] -- 0:00:48 211500 -- (-1392.084) (-1388.713) [-1389.531] (-1389.041) * (-1389.323) (-1387.012) [-1388.744] (-1386.735) -- 0:00:52 212000 -- (-1386.608) (-1391.330) [-1390.443] (-1387.896) * (-1387.907) [-1387.608] (-1390.172) (-1387.951) -- 0:00:52 212500 -- (-1387.022) (-1389.057) [-1389.597] (-1387.577) * (-1387.801) [-1387.183] (-1388.007) (-1388.316) -- 0:00:51 213000 -- (-1387.941) (-1393.575) (-1387.147) [-1389.063] * [-1388.124] (-1387.435) (-1389.147) (-1387.170) -- 0:00:51 213500 -- [-1386.513] (-1390.844) (-1387.373) (-1388.710) * (-1386.520) [-1387.998] (-1386.555) (-1386.977) -- 0:00:51 214000 -- [-1386.916] (-1387.083) (-1388.381) (-1387.516) * (-1387.124) (-1389.223) [-1387.580] (-1387.879) -- 0:00:51 214500 -- (-1389.774) (-1386.355) (-1388.545) [-1387.130] * (-1387.778) (-1389.166) (-1387.063) [-1389.192] -- 0:00:51 215000 -- (-1386.717) (-1389.569) [-1391.892] (-1387.005) * [-1389.254] (-1392.438) (-1386.985) (-1388.249) -- 0:00:51 Average standard deviation of split frequencies: 0.011761 215500 -- (-1389.690) (-1391.982) [-1393.006] (-1386.914) * [-1389.791] (-1388.628) (-1388.433) (-1387.160) -- 0:00:50 216000 -- (-1386.428) (-1389.852) (-1390.115) [-1386.671] * (-1388.544) [-1387.915] (-1387.649) (-1388.251) -- 0:00:50 216500 -- [-1386.640] (-1388.945) (-1392.515) (-1388.000) * (-1386.984) (-1388.100) [-1389.438] (-1386.720) -- 0:00:50 217000 -- [-1388.097] (-1389.465) (-1393.614) (-1389.198) * [-1388.068] (-1388.577) (-1387.641) (-1386.900) -- 0:00:50 217500 -- [-1388.605] (-1391.733) (-1390.355) (-1389.735) * (-1387.171) [-1388.793] (-1386.880) (-1387.725) -- 0:00:50 218000 -- (-1388.758) (-1391.378) (-1387.362) [-1388.397] * (-1386.449) [-1387.994] (-1387.427) (-1387.995) -- 0:00:50 218500 -- (-1389.757) (-1391.871) (-1391.619) [-1388.170] * (-1387.532) [-1388.791] (-1389.699) (-1389.127) -- 0:00:50 219000 -- (-1388.460) (-1390.360) [-1386.579] (-1391.482) * (-1388.324) (-1387.909) (-1388.407) [-1387.606] -- 0:00:49 219500 -- (-1387.648) (-1387.692) (-1389.114) [-1390.085] * (-1387.865) (-1388.771) (-1390.485) [-1387.606] -- 0:00:49 220000 -- [-1388.345] (-1389.286) (-1389.495) (-1387.417) * (-1387.033) [-1391.380] (-1391.928) (-1388.003) -- 0:00:49 Average standard deviation of split frequencies: 0.010681 220500 -- (-1387.024) (-1386.848) [-1387.021] (-1388.075) * (-1389.027) [-1387.434] (-1389.697) (-1390.661) -- 0:00:49 221000 -- [-1387.908] (-1391.297) (-1387.131) (-1386.660) * (-1390.826) [-1389.610] (-1387.669) (-1388.366) -- 0:00:49 221500 -- (-1387.864) [-1387.188] (-1386.964) (-1390.632) * (-1392.260) [-1388.617] (-1388.594) (-1387.863) -- 0:00:49 222000 -- (-1389.004) [-1386.861] (-1387.718) (-1386.804) * (-1387.529) [-1391.214] (-1388.763) (-1389.992) -- 0:00:49 222500 -- [-1387.173] (-1386.787) (-1390.166) (-1386.889) * (-1387.799) [-1387.427] (-1388.798) (-1388.827) -- 0:00:48 223000 -- (-1389.252) [-1390.774] (-1387.314) (-1386.876) * (-1387.438) [-1387.614] (-1388.257) (-1387.535) -- 0:00:48 223500 -- (-1390.022) (-1390.236) (-1387.468) [-1390.765] * [-1388.028] (-1392.585) (-1396.531) (-1386.832) -- 0:00:48 224000 -- [-1388.183] (-1387.993) (-1387.905) (-1390.916) * (-1386.956) (-1389.607) (-1390.853) [-1387.256] -- 0:00:48 224500 -- (-1388.874) (-1387.427) [-1386.846] (-1386.697) * (-1386.614) (-1391.017) (-1389.387) [-1387.882] -- 0:00:48 225000 -- (-1389.009) (-1390.625) (-1386.506) [-1391.068] * (-1386.638) (-1389.218) (-1388.606) [-1387.743] -- 0:00:48 Average standard deviation of split frequencies: 0.011966 225500 -- (-1389.230) (-1387.165) (-1386.382) [-1388.841] * (-1389.384) (-1390.034) (-1392.705) [-1389.420] -- 0:00:48 226000 -- (-1390.125) (-1386.941) (-1389.772) [-1387.969] * (-1392.613) [-1389.443] (-1390.061) (-1394.457) -- 0:00:47 226500 -- (-1391.408) [-1389.902] (-1387.402) (-1388.653) * [-1388.381] (-1390.233) (-1391.669) (-1388.274) -- 0:00:47 227000 -- [-1386.945] (-1387.951) (-1388.339) (-1387.489) * (-1387.220) [-1390.219] (-1390.409) (-1386.855) -- 0:00:47 227500 -- (-1386.945) [-1386.958] (-1388.852) (-1387.024) * [-1387.463] (-1388.525) (-1389.663) (-1387.947) -- 0:00:50 228000 -- (-1387.060) (-1387.601) [-1386.938] (-1387.525) * (-1388.895) (-1388.743) (-1388.145) [-1388.819] -- 0:00:50 228500 -- (-1386.280) (-1387.529) [-1386.910] (-1388.404) * (-1392.962) (-1390.957) [-1388.145] (-1386.920) -- 0:00:50 229000 -- (-1386.465) [-1386.991] (-1386.535) (-1388.725) * (-1394.090) (-1389.952) (-1390.486) [-1388.816] -- 0:00:50 229500 -- (-1386.143) [-1387.646] (-1388.639) (-1388.711) * (-1392.828) (-1387.728) (-1390.211) [-1390.926] -- 0:00:50 230000 -- (-1388.922) (-1393.941) (-1387.768) [-1387.806] * [-1393.280] (-1387.269) (-1389.244) (-1388.217) -- 0:00:50 Average standard deviation of split frequencies: 0.011581 230500 -- (-1388.034) (-1397.471) [-1391.548] (-1388.096) * (-1390.504) (-1389.642) (-1388.177) [-1388.497] -- 0:00:50 231000 -- [-1387.847] (-1388.232) (-1387.267) (-1387.923) * [-1388.580] (-1387.259) (-1387.156) (-1389.334) -- 0:00:49 231500 -- (-1388.035) (-1386.882) [-1386.992] (-1387.306) * [-1387.371] (-1390.388) (-1388.359) (-1386.421) -- 0:00:49 232000 -- [-1387.580] (-1386.780) (-1387.412) (-1389.563) * (-1386.509) (-1395.871) [-1387.816] (-1386.268) -- 0:00:49 232500 -- [-1387.726] (-1394.089) (-1393.117) (-1388.880) * (-1386.906) (-1388.341) (-1387.355) [-1387.603] -- 0:00:49 233000 -- (-1388.912) (-1391.603) (-1388.024) [-1388.154] * [-1397.119] (-1387.546) (-1388.547) (-1389.251) -- 0:00:49 233500 -- (-1393.352) (-1394.440) (-1388.527) [-1389.642] * (-1394.122) [-1386.715] (-1388.667) (-1388.370) -- 0:00:49 234000 -- (-1390.752) (-1388.286) (-1389.434) [-1390.019] * (-1391.063) (-1388.167) (-1388.617) [-1386.832] -- 0:00:49 234500 -- [-1388.542] (-1386.297) (-1388.667) (-1391.230) * (-1390.105) (-1389.349) (-1386.759) [-1388.124] -- 0:00:48 235000 -- (-1390.894) (-1396.954) (-1389.338) [-1388.418] * [-1388.895] (-1388.931) (-1387.258) (-1387.476) -- 0:00:48 Average standard deviation of split frequencies: 0.011874 235500 -- (-1388.730) (-1388.789) [-1388.213] (-1387.071) * (-1387.887) (-1389.852) (-1387.750) [-1386.487] -- 0:00:48 236000 -- (-1390.992) [-1388.113] (-1386.932) (-1387.983) * [-1389.640] (-1390.570) (-1393.340) (-1386.562) -- 0:00:48 236500 -- [-1388.089] (-1388.880) (-1389.883) (-1387.754) * [-1387.783] (-1387.646) (-1387.105) (-1387.114) -- 0:00:48 237000 -- (-1389.069) [-1388.525] (-1390.765) (-1388.426) * (-1387.733) [-1389.201] (-1388.712) (-1391.433) -- 0:00:48 237500 -- (-1386.291) (-1395.364) [-1389.564] (-1387.584) * [-1387.285] (-1388.052) (-1389.397) (-1391.544) -- 0:00:48 238000 -- (-1387.447) [-1389.311] (-1390.515) (-1388.961) * [-1387.289] (-1388.564) (-1390.157) (-1388.989) -- 0:00:48 238500 -- (-1387.486) (-1389.596) (-1387.284) [-1389.527] * (-1387.220) [-1388.187] (-1389.153) (-1389.916) -- 0:00:47 239000 -- (-1387.893) (-1386.917) [-1387.413] (-1390.364) * (-1386.751) (-1388.723) [-1387.537] (-1389.630) -- 0:00:47 239500 -- (-1390.163) (-1387.199) [-1387.772] (-1389.676) * [-1386.513] (-1389.254) (-1387.728) (-1389.587) -- 0:00:47 240000 -- (-1389.064) [-1387.226] (-1388.196) (-1387.572) * (-1387.212) [-1388.835] (-1393.469) (-1391.018) -- 0:00:47 Average standard deviation of split frequencies: 0.011970 240500 -- (-1388.251) (-1386.546) (-1388.884) [-1386.939] * (-1392.764) [-1389.707] (-1388.993) (-1389.726) -- 0:00:47 241000 -- (-1392.181) (-1387.177) [-1389.676] (-1389.754) * (-1388.331) (-1389.794) (-1390.126) [-1389.046] -- 0:00:47 241500 -- (-1387.120) (-1387.624) (-1387.438) [-1391.502] * (-1388.333) [-1388.011] (-1390.474) (-1388.183) -- 0:00:47 242000 -- (-1387.120) (-1387.375) [-1388.103] (-1388.371) * (-1388.625) (-1387.812) [-1389.748] (-1387.481) -- 0:00:46 242500 -- [-1387.259] (-1389.916) (-1387.427) (-1386.410) * (-1388.529) (-1387.720) (-1388.025) [-1387.520] -- 0:00:46 243000 -- (-1387.172) [-1387.557] (-1387.667) (-1389.092) * (-1389.095) (-1387.983) [-1388.243] (-1389.533) -- 0:00:46 243500 -- (-1388.189) (-1387.877) (-1387.038) [-1389.627] * (-1388.643) [-1386.440] (-1389.018) (-1388.500) -- 0:00:49 244000 -- (-1388.432) (-1388.511) [-1389.038] (-1388.357) * (-1388.286) [-1388.061] (-1388.313) (-1388.125) -- 0:00:49 244500 -- (-1388.638) [-1387.924] (-1390.133) (-1388.320) * (-1390.038) (-1386.720) [-1388.740] (-1388.465) -- 0:00:49 245000 -- (-1387.830) [-1387.342] (-1387.456) (-1388.607) * [-1387.136] (-1387.113) (-1386.563) (-1388.793) -- 0:00:49 Average standard deviation of split frequencies: 0.012243 245500 -- (-1386.639) (-1387.759) [-1389.464] (-1390.404) * (-1388.086) (-1389.800) (-1393.117) [-1387.871] -- 0:00:49 246000 -- (-1387.512) (-1390.013) (-1389.271) [-1394.425] * (-1387.225) [-1387.504] (-1392.122) (-1388.119) -- 0:00:49 246500 -- [-1388.777] (-1392.558) (-1388.623) (-1393.918) * (-1390.594) [-1387.447] (-1392.778) (-1386.524) -- 0:00:48 247000 -- (-1386.483) (-1390.836) [-1392.140] (-1390.456) * (-1388.166) (-1388.804) [-1391.139] (-1386.898) -- 0:00:48 247500 -- [-1387.797] (-1391.502) (-1393.310) (-1387.831) * (-1387.996) (-1389.480) [-1388.547] (-1386.433) -- 0:00:48 248000 -- [-1387.668] (-1388.964) (-1392.026) (-1389.160) * (-1386.573) [-1388.408] (-1387.783) (-1386.406) -- 0:00:48 248500 -- (-1389.208) [-1387.750] (-1387.903) (-1392.992) * (-1386.575) [-1389.202] (-1387.304) (-1386.146) -- 0:00:48 249000 -- (-1392.764) [-1387.629] (-1388.876) (-1389.089) * (-1393.604) (-1391.517) (-1387.271) [-1387.004] -- 0:00:48 249500 -- (-1394.633) (-1386.946) [-1389.247] (-1388.106) * (-1391.525) (-1393.852) [-1387.604] (-1386.725) -- 0:00:48 250000 -- (-1392.923) [-1386.674] (-1389.270) (-1386.363) * (-1392.413) (-1392.660) [-1388.639] (-1388.611) -- 0:00:48 Average standard deviation of split frequencies: 0.013164 250500 -- (-1389.463) [-1387.704] (-1387.928) (-1386.815) * (-1388.660) (-1389.163) (-1387.757) [-1388.984] -- 0:00:47 251000 -- [-1390.699] (-1390.324) (-1388.889) (-1386.618) * [-1391.651] (-1387.923) (-1388.016) (-1388.491) -- 0:00:47 251500 -- [-1387.601] (-1387.528) (-1393.710) (-1386.670) * [-1387.888] (-1390.489) (-1387.931) (-1391.004) -- 0:00:47 252000 -- (-1387.821) (-1388.251) (-1390.761) [-1386.847] * (-1387.260) [-1389.070] (-1390.340) (-1388.741) -- 0:00:47 252500 -- (-1388.935) [-1388.846] (-1390.463) (-1387.990) * (-1389.615) (-1387.881) (-1389.829) [-1387.695] -- 0:00:47 253000 -- [-1389.200] (-1388.761) (-1390.071) (-1387.405) * (-1389.158) (-1387.157) [-1389.234] (-1388.863) -- 0:00:47 253500 -- (-1394.220) [-1387.047] (-1390.107) (-1388.658) * (-1391.678) (-1388.007) (-1388.066) [-1389.907] -- 0:00:47 254000 -- (-1390.191) [-1388.672] (-1390.728) (-1386.583) * [-1388.371] (-1388.699) (-1391.161) (-1387.936) -- 0:00:46 254500 -- [-1388.834] (-1387.718) (-1396.084) (-1395.818) * (-1390.437) (-1387.740) (-1390.316) [-1387.194] -- 0:00:46 255000 -- [-1388.282] (-1388.004) (-1388.674) (-1391.684) * (-1388.168) [-1387.623] (-1387.681) (-1389.765) -- 0:00:46 Average standard deviation of split frequencies: 0.013095 255500 -- (-1392.178) (-1388.289) [-1389.044] (-1390.516) * (-1386.993) (-1387.591) [-1386.649] (-1390.849) -- 0:00:46 256000 -- (-1388.752) (-1386.836) [-1393.033] (-1389.978) * (-1388.662) (-1387.562) [-1387.427] (-1388.995) -- 0:00:46 256500 -- (-1388.088) [-1387.361] (-1390.057) (-1389.800) * (-1387.418) (-1386.682) [-1390.050] (-1390.697) -- 0:00:46 257000 -- (-1387.911) (-1387.342) (-1388.142) [-1390.612] * (-1387.284) (-1388.484) (-1389.383) [-1387.374] -- 0:00:46 257500 -- (-1388.174) (-1387.482) (-1386.622) [-1390.528] * (-1390.467) (-1388.295) (-1389.957) [-1388.016] -- 0:00:46 258000 -- (-1388.326) [-1387.200] (-1386.584) (-1388.648) * (-1388.920) (-1389.365) (-1387.855) [-1388.099] -- 0:00:46 258500 -- (-1393.676) (-1387.799) (-1388.581) [-1388.386] * (-1390.703) [-1387.100] (-1390.125) (-1388.290) -- 0:00:45 259000 -- [-1389.808] (-1387.705) (-1388.718) (-1388.668) * (-1390.889) (-1388.886) (-1391.577) [-1388.908] -- 0:00:45 259500 -- (-1390.093) (-1386.638) (-1387.627) [-1388.829] * [-1389.775] (-1387.054) (-1388.401) (-1387.930) -- 0:00:48 260000 -- (-1391.516) (-1389.244) [-1390.182] (-1388.790) * [-1387.789] (-1390.111) (-1387.772) (-1388.192) -- 0:00:48 Average standard deviation of split frequencies: 0.014970 260500 -- (-1389.431) (-1394.892) [-1388.435] (-1393.895) * (-1386.900) (-1388.680) (-1388.182) [-1389.145] -- 0:00:48 261000 -- (-1389.327) (-1389.747) (-1386.432) [-1387.866] * (-1387.383) (-1387.894) [-1386.846] (-1389.577) -- 0:00:48 261500 -- [-1387.254] (-1387.119) (-1388.503) (-1389.183) * (-1390.128) (-1391.006) (-1386.395) [-1389.680] -- 0:00:48 262000 -- (-1387.007) (-1387.169) (-1387.881) [-1392.801] * (-1386.884) (-1387.825) [-1388.403] (-1390.567) -- 0:00:47 262500 -- [-1387.172] (-1388.984) (-1393.395) (-1387.375) * (-1387.875) (-1388.099) (-1388.466) [-1389.798] -- 0:00:47 263000 -- [-1387.335] (-1388.352) (-1389.170) (-1386.699) * (-1386.806) (-1390.204) [-1387.735] (-1389.987) -- 0:00:47 263500 -- (-1391.144) (-1388.216) (-1391.679) [-1386.736] * (-1386.665) (-1388.551) [-1387.499] (-1386.706) -- 0:00:47 264000 -- [-1391.668] (-1387.934) (-1391.758) (-1389.586) * (-1387.045) [-1388.467] (-1388.234) (-1386.727) -- 0:00:47 264500 -- (-1386.868) [-1387.264] (-1390.580) (-1389.244) * (-1388.817) (-1387.879) [-1389.037] (-1386.264) -- 0:00:47 265000 -- (-1393.247) (-1388.085) (-1388.086) [-1388.014] * [-1387.765] (-1388.277) (-1390.792) (-1386.761) -- 0:00:47 Average standard deviation of split frequencies: 0.013587 265500 -- (-1386.977) (-1388.097) [-1389.076] (-1387.272) * [-1386.847] (-1387.713) (-1390.827) (-1387.735) -- 0:00:47 266000 -- [-1386.926] (-1388.329) (-1389.021) (-1388.066) * [-1388.296] (-1387.800) (-1389.747) (-1391.499) -- 0:00:46 266500 -- (-1387.049) (-1389.518) [-1386.726] (-1388.207) * [-1387.862] (-1388.911) (-1386.711) (-1389.217) -- 0:00:46 267000 -- [-1386.642] (-1387.969) (-1389.830) (-1387.563) * (-1386.909) (-1387.654) (-1387.518) [-1388.326] -- 0:00:46 267500 -- (-1389.217) (-1388.341) (-1387.190) [-1387.367] * (-1387.140) [-1385.985] (-1387.491) (-1387.232) -- 0:00:46 268000 -- [-1391.194] (-1388.162) (-1389.019) (-1390.999) * [-1388.315] (-1386.261) (-1387.842) (-1386.829) -- 0:00:46 268500 -- [-1387.198] (-1387.840) (-1388.959) (-1390.424) * [-1387.809] (-1386.782) (-1387.797) (-1387.732) -- 0:00:46 269000 -- (-1388.541) (-1389.332) [-1388.830] (-1389.890) * (-1390.702) (-1392.202) (-1389.545) [-1388.775] -- 0:00:46 269500 -- [-1387.957] (-1389.607) (-1390.544) (-1396.383) * [-1390.381] (-1389.556) (-1388.688) (-1389.172) -- 0:00:46 270000 -- [-1391.890] (-1388.148) (-1390.250) (-1388.231) * (-1392.656) (-1391.348) (-1392.407) [-1388.870] -- 0:00:45 Average standard deviation of split frequencies: 0.012675 270500 -- [-1388.624] (-1386.885) (-1388.186) (-1388.124) * [-1389.154] (-1389.719) (-1391.718) (-1387.431) -- 0:00:45 271000 -- [-1387.978] (-1390.147) (-1388.465) (-1389.751) * (-1388.182) (-1389.290) [-1388.482] (-1390.964) -- 0:00:45 271500 -- (-1386.936) (-1387.192) [-1387.737] (-1387.986) * [-1387.661] (-1388.382) (-1391.125) (-1389.019) -- 0:00:45 272000 -- (-1390.588) (-1388.249) (-1386.642) [-1387.985] * [-1387.361] (-1392.036) (-1388.378) (-1389.491) -- 0:00:45 272500 -- [-1387.991] (-1386.565) (-1387.171) (-1394.450) * (-1387.785) (-1387.151) [-1386.813] (-1387.229) -- 0:00:45 273000 -- (-1389.454) [-1388.381] (-1387.802) (-1388.493) * (-1387.409) (-1390.437) (-1386.791) [-1388.571] -- 0:00:45 273500 -- (-1388.270) (-1388.012) (-1387.193) [-1388.270] * (-1386.959) [-1388.630] (-1388.605) (-1393.417) -- 0:00:45 274000 -- [-1387.999] (-1386.559) (-1388.670) (-1389.105) * (-1386.240) [-1387.035] (-1389.252) (-1401.673) -- 0:00:45 274500 -- (-1392.914) (-1388.119) (-1389.415) [-1388.757] * (-1386.206) (-1390.449) (-1387.885) [-1391.316] -- 0:00:44 275000 -- (-1387.602) (-1386.433) (-1389.069) [-1386.780] * (-1387.560) [-1391.247] (-1390.853) (-1389.983) -- 0:00:44 Average standard deviation of split frequencies: 0.013000 275500 -- (-1389.056) (-1386.899) [-1387.033] (-1391.393) * (-1389.572) (-1389.019) [-1387.722] (-1390.367) -- 0:00:47 276000 -- (-1391.838) (-1386.694) (-1387.362) [-1386.573] * [-1388.009] (-1387.460) (-1386.204) (-1390.350) -- 0:00:47 276500 -- (-1392.804) [-1386.419] (-1386.912) (-1386.577) * [-1387.121] (-1391.411) (-1386.894) (-1390.948) -- 0:00:47 277000 -- (-1392.124) [-1386.817] (-1386.944) (-1388.449) * (-1388.650) (-1387.939) [-1387.307] (-1390.777) -- 0:00:46 277500 -- (-1389.961) (-1386.184) (-1387.238) [-1387.949] * (-1390.344) [-1387.347] (-1386.574) (-1389.627) -- 0:00:46 278000 -- (-1390.323) [-1386.202] (-1389.129) (-1387.967) * (-1388.866) (-1387.916) [-1386.574] (-1387.157) -- 0:00:46 278500 -- (-1391.629) [-1386.813] (-1386.969) (-1386.609) * (-1386.730) (-1390.442) (-1389.316) [-1388.033] -- 0:00:46 279000 -- (-1390.310) [-1387.404] (-1388.976) (-1389.044) * [-1390.220] (-1388.877) (-1389.685) (-1388.392) -- 0:00:46 279500 -- (-1387.889) [-1388.109] (-1392.159) (-1389.957) * (-1389.039) (-1389.070) (-1387.431) [-1387.586] -- 0:00:46 280000 -- [-1387.203] (-1387.885) (-1390.481) (-1388.505) * [-1387.904] (-1389.667) (-1387.657) (-1389.602) -- 0:00:46 Average standard deviation of split frequencies: 0.014128 280500 -- (-1387.232) (-1387.885) [-1386.459] (-1388.542) * (-1388.307) (-1387.616) (-1386.903) [-1386.569] -- 0:00:46 281000 -- (-1386.614) (-1386.980) [-1386.191] (-1388.122) * (-1388.117) (-1392.734) (-1389.583) [-1388.508] -- 0:00:46 281500 -- [-1387.818] (-1388.102) (-1387.803) (-1389.541) * (-1387.589) [-1391.529] (-1388.201) (-1387.723) -- 0:00:45 282000 -- [-1387.080] (-1389.087) (-1387.070) (-1389.783) * (-1387.199) (-1390.081) (-1388.723) [-1389.770] -- 0:00:45 282500 -- [-1388.022] (-1387.960) (-1387.448) (-1386.789) * (-1389.379) [-1389.552] (-1386.632) (-1387.772) -- 0:00:45 283000 -- (-1388.976) (-1388.863) (-1387.548) [-1387.755] * (-1386.297) [-1388.482] (-1386.436) (-1388.969) -- 0:00:45 283500 -- (-1388.012) (-1387.150) (-1389.520) [-1391.678] * (-1388.935) (-1389.376) (-1390.559) [-1388.784] -- 0:00:45 284000 -- [-1386.430] (-1386.846) (-1390.199) (-1395.181) * (-1388.836) (-1391.012) [-1389.057] (-1388.828) -- 0:00:45 284500 -- [-1395.521] (-1387.042) (-1392.176) (-1388.673) * (-1387.593) (-1388.102) (-1388.015) [-1389.219] -- 0:00:45 285000 -- (-1389.437) (-1386.457) (-1389.070) [-1387.117] * (-1386.390) (-1391.476) (-1389.799) [-1387.353] -- 0:00:45 Average standard deviation of split frequencies: 0.012232 285500 -- (-1388.111) (-1386.820) [-1387.008] (-1387.494) * (-1387.529) (-1389.382) [-1387.998] (-1387.909) -- 0:00:45 286000 -- [-1390.064] (-1386.645) (-1390.200) (-1387.943) * [-1389.227] (-1392.640) (-1391.384) (-1391.132) -- 0:00:44 286500 -- (-1387.986) (-1386.645) (-1394.325) [-1387.348] * (-1386.910) (-1391.329) [-1388.603] (-1389.994) -- 0:00:44 287000 -- (-1389.751) (-1389.059) (-1393.797) [-1387.068] * (-1392.928) (-1388.728) [-1388.142] (-1390.313) -- 0:00:44 287500 -- (-1387.555) [-1387.920] (-1389.345) (-1387.261) * (-1394.793) [-1389.015] (-1392.297) (-1391.457) -- 0:00:44 288000 -- (-1387.659) (-1388.064) (-1388.993) [-1388.280] * (-1388.909) (-1390.993) (-1386.702) [-1386.737] -- 0:00:44 288500 -- (-1388.190) [-1389.462] (-1389.709) (-1388.048) * (-1388.328) (-1397.551) [-1386.700] (-1389.704) -- 0:00:44 289000 -- (-1389.879) (-1388.695) (-1389.624) [-1388.070] * (-1389.048) [-1389.468] (-1386.892) (-1387.530) -- 0:00:44 289500 -- (-1387.091) [-1390.905] (-1391.719) (-1387.876) * [-1388.236] (-1388.184) (-1387.801) (-1386.630) -- 0:00:44 290000 -- [-1387.684] (-1388.311) (-1388.764) (-1390.117) * (-1387.794) (-1390.044) (-1387.430) [-1388.782] -- 0:00:44 Average standard deviation of split frequencies: 0.012164 290500 -- [-1390.655] (-1386.833) (-1387.575) (-1389.578) * (-1387.317) (-1389.874) (-1387.236) [-1386.800] -- 0:00:43 291000 -- (-1386.710) [-1388.776] (-1389.598) (-1387.722) * (-1387.630) (-1388.775) (-1387.684) [-1387.639] -- 0:00:43 291500 -- (-1387.938) (-1388.894) [-1389.263] (-1387.694) * [-1386.144] (-1387.590) (-1388.564) (-1386.896) -- 0:00:46 292000 -- (-1387.098) [-1387.698] (-1389.183) (-1389.444) * (-1390.037) (-1389.082) (-1390.096) [-1387.511] -- 0:00:46 292500 -- (-1388.699) [-1387.833] (-1389.266) (-1387.927) * [-1388.326] (-1387.236) (-1388.087) (-1387.320) -- 0:00:45 293000 -- (-1390.006) [-1390.889] (-1390.587) (-1390.527) * (-1391.831) [-1387.251] (-1387.819) (-1387.664) -- 0:00:45 293500 -- (-1390.154) (-1391.012) (-1392.603) [-1392.292] * (-1387.614) [-1387.446] (-1389.444) (-1389.765) -- 0:00:45 294000 -- [-1387.150] (-1387.391) (-1391.380) (-1389.920) * (-1388.861) [-1387.102] (-1393.002) (-1387.248) -- 0:00:45 294500 -- (-1387.828) (-1390.787) (-1391.462) [-1390.415] * [-1387.366] (-1387.181) (-1390.275) (-1387.037) -- 0:00:45 295000 -- (-1387.572) (-1390.824) [-1387.580] (-1388.633) * (-1387.905) [-1387.522] (-1389.766) (-1387.764) -- 0:00:45 Average standard deviation of split frequencies: 0.012652 295500 -- (-1387.299) [-1391.220] (-1387.339) (-1387.135) * (-1388.411) (-1391.578) [-1389.088] (-1389.416) -- 0:00:45 296000 -- (-1386.743) [-1392.376] (-1387.029) (-1387.466) * (-1387.338) (-1386.467) (-1389.813) [-1387.520] -- 0:00:45 296500 -- (-1387.403) [-1388.707] (-1386.350) (-1386.910) * (-1386.596) (-1386.869) [-1390.083] (-1393.555) -- 0:00:45 297000 -- (-1386.248) [-1390.134] (-1386.098) (-1387.704) * (-1387.748) [-1386.192] (-1388.623) (-1397.523) -- 0:00:44 297500 -- (-1386.532) (-1388.789) (-1388.757) [-1387.941] * (-1387.088) (-1389.050) [-1386.931] (-1389.997) -- 0:00:44 298000 -- [-1387.536] (-1389.763) (-1386.437) (-1388.723) * (-1389.675) [-1387.778] (-1386.410) (-1395.505) -- 0:00:44 298500 -- (-1387.262) [-1388.833] (-1387.241) (-1388.425) * (-1392.010) (-1386.627) [-1387.421] (-1390.572) -- 0:00:44 299000 -- (-1390.661) (-1388.795) (-1386.919) [-1386.568] * (-1389.439) [-1387.374] (-1388.212) (-1389.884) -- 0:00:44 299500 -- (-1388.037) (-1386.974) (-1388.908) [-1386.776] * [-1389.338] (-1387.995) (-1387.463) (-1389.393) -- 0:00:44 300000 -- (-1388.009) (-1389.990) [-1388.098] (-1388.212) * [-1391.367] (-1387.323) (-1387.113) (-1389.362) -- 0:00:44 Average standard deviation of split frequencies: 0.012445 300500 -- (-1389.942) (-1388.083) [-1388.641] (-1388.212) * (-1390.444) (-1388.824) (-1389.461) [-1387.233] -- 0:00:44 301000 -- (-1389.897) [-1388.286] (-1386.721) (-1388.579) * (-1387.825) (-1388.332) [-1388.139] (-1388.125) -- 0:00:44 301500 -- (-1389.959) (-1388.345) [-1387.154] (-1394.330) * (-1387.717) (-1387.910) (-1389.639) [-1388.931] -- 0:00:44 302000 -- (-1388.769) [-1389.878] (-1388.777) (-1387.069) * [-1387.627] (-1388.693) (-1388.921) (-1387.638) -- 0:00:43 302500 -- [-1387.528] (-1392.924) (-1386.620) (-1386.528) * (-1389.559) [-1392.904] (-1388.183) (-1389.638) -- 0:00:43 303000 -- (-1387.664) (-1391.774) (-1387.372) [-1387.719] * (-1388.739) [-1387.690] (-1387.980) (-1392.912) -- 0:00:43 303500 -- [-1388.580] (-1388.867) (-1386.437) (-1393.491) * [-1390.484] (-1388.889) (-1388.238) (-1387.046) -- 0:00:43 304000 -- [-1388.104] (-1387.290) (-1386.677) (-1390.072) * (-1391.339) (-1387.430) (-1388.805) [-1387.062] -- 0:00:43 304500 -- (-1387.923) (-1387.699) [-1388.049] (-1387.400) * (-1386.780) (-1387.653) (-1389.300) [-1387.055] -- 0:00:43 305000 -- (-1387.944) (-1388.652) (-1386.544) [-1388.319] * (-1388.351) [-1386.881] (-1387.852) (-1392.136) -- 0:00:43 Average standard deviation of split frequencies: 0.011458 305500 -- (-1388.041) [-1388.479] (-1387.077) (-1390.315) * [-1386.366] (-1389.910) (-1391.786) (-1388.946) -- 0:00:43 306000 -- (-1388.939) (-1393.004) [-1386.599] (-1390.969) * (-1389.162) (-1390.817) [-1387.487] (-1389.165) -- 0:00:43 306500 -- (-1389.766) [-1386.373] (-1386.622) (-1387.410) * (-1387.567) (-1391.616) [-1387.294] (-1387.545) -- 0:00:42 307000 -- [-1391.115] (-1386.381) (-1388.740) (-1387.149) * (-1387.897) (-1386.748) (-1387.312) [-1387.217] -- 0:00:42 307500 -- (-1391.944) (-1388.526) (-1390.582) [-1387.865] * [-1388.678] (-1387.281) (-1390.262) (-1386.340) -- 0:00:45 308000 -- [-1388.153] (-1391.433) (-1387.197) (-1387.750) * (-1389.771) (-1389.630) [-1390.356] (-1386.300) -- 0:00:44 308500 -- (-1387.999) (-1394.774) [-1387.988] (-1391.561) * (-1391.443) (-1389.293) [-1390.672] (-1387.127) -- 0:00:44 309000 -- (-1387.816) (-1390.855) [-1387.882] (-1390.928) * (-1390.941) [-1391.936] (-1387.056) (-1388.089) -- 0:00:44 309500 -- (-1389.014) [-1388.485] (-1388.484) (-1392.207) * [-1387.256] (-1389.341) (-1388.392) (-1389.377) -- 0:00:44 310000 -- (-1389.359) [-1390.971] (-1388.190) (-1386.913) * (-1387.244) (-1387.384) [-1388.822] (-1389.088) -- 0:00:44 Average standard deviation of split frequencies: 0.011570 310500 -- [-1388.681] (-1389.750) (-1387.129) (-1387.371) * (-1388.647) [-1387.057] (-1394.312) (-1387.707) -- 0:00:44 311000 -- (-1390.574) (-1391.325) [-1387.234] (-1390.071) * (-1392.270) (-1387.257) (-1390.249) [-1387.129] -- 0:00:44 311500 -- (-1389.284) (-1390.035) [-1388.119] (-1394.144) * [-1391.244] (-1389.279) (-1388.687) (-1388.784) -- 0:00:44 312000 -- [-1387.185] (-1388.024) (-1387.835) (-1390.532) * (-1388.561) (-1389.308) (-1387.086) [-1386.817] -- 0:00:44 312500 -- (-1387.414) [-1386.762] (-1389.349) (-1387.941) * (-1389.724) (-1391.515) [-1388.835] (-1386.324) -- 0:00:44 313000 -- [-1388.402] (-1387.328) (-1386.857) (-1387.517) * [-1388.469] (-1388.555) (-1390.743) (-1386.936) -- 0:00:43 313500 -- (-1391.987) [-1388.650] (-1387.714) (-1389.225) * (-1387.297) (-1391.340) (-1390.448) [-1387.767] -- 0:00:43 314000 -- (-1388.641) [-1387.729] (-1388.020) (-1388.151) * (-1390.673) (-1390.349) [-1389.111] (-1392.221) -- 0:00:43 314500 -- [-1391.425] (-1388.917) (-1389.108) (-1388.449) * (-1392.423) (-1386.433) (-1388.206) [-1390.202] -- 0:00:43 315000 -- (-1387.275) (-1387.078) (-1388.028) [-1386.709] * (-1391.541) [-1387.409] (-1388.380) (-1392.098) -- 0:00:43 Average standard deviation of split frequencies: 0.011375 315500 -- (-1387.669) [-1386.528] (-1388.230) (-1389.837) * (-1390.282) [-1386.336] (-1386.524) (-1390.031) -- 0:00:43 316000 -- [-1388.443] (-1386.655) (-1387.200) (-1390.205) * (-1395.214) [-1390.206] (-1388.740) (-1392.441) -- 0:00:43 316500 -- (-1387.554) (-1387.826) (-1386.310) [-1388.375] * (-1392.218) (-1388.929) [-1387.738] (-1391.195) -- 0:00:43 317000 -- (-1388.755) (-1387.891) (-1386.237) [-1392.166] * (-1388.820) (-1389.182) (-1389.245) [-1387.844] -- 0:00:43 317500 -- (-1387.884) (-1391.570) (-1388.335) [-1387.740] * (-1386.389) [-1389.403] (-1388.632) (-1388.365) -- 0:00:42 318000 -- (-1388.616) (-1393.841) (-1387.581) [-1387.498] * (-1387.816) [-1390.782] (-1389.546) (-1388.137) -- 0:00:42 318500 -- (-1386.477) (-1392.686) [-1389.286] (-1388.249) * [-1388.761] (-1387.780) (-1389.808) (-1389.308) -- 0:00:42 319000 -- (-1390.087) (-1387.962) [-1388.627] (-1393.800) * (-1388.869) (-1388.463) [-1388.989] (-1390.297) -- 0:00:42 319500 -- [-1386.972] (-1387.773) (-1389.026) (-1390.990) * (-1388.808) [-1388.386] (-1387.901) (-1389.605) -- 0:00:42 320000 -- (-1387.029) (-1389.948) (-1392.212) [-1388.722] * (-1387.852) (-1388.390) (-1388.738) [-1389.199] -- 0:00:42 Average standard deviation of split frequencies: 0.009858 320500 -- [-1387.001] (-1390.049) (-1390.493) (-1386.882) * (-1392.112) (-1388.551) (-1390.579) [-1388.844] -- 0:00:42 321000 -- [-1387.524] (-1388.799) (-1388.946) (-1388.929) * (-1388.681) (-1387.604) [-1391.824] (-1388.097) -- 0:00:42 321500 -- (-1386.781) (-1391.498) [-1389.703] (-1388.811) * (-1394.230) (-1389.145) (-1390.399) [-1387.516] -- 0:00:42 322000 -- [-1386.792] (-1392.910) (-1388.721) (-1388.835) * (-1393.289) (-1389.210) [-1386.960] (-1388.940) -- 0:00:42 322500 -- [-1389.608] (-1388.188) (-1388.339) (-1387.619) * (-1387.575) (-1391.339) [-1386.935] (-1387.934) -- 0:00:42 323000 -- (-1386.961) [-1386.958] (-1388.830) (-1388.282) * [-1386.981] (-1391.349) (-1389.150) (-1389.496) -- 0:00:41 323500 -- (-1388.472) (-1388.348) (-1388.058) [-1391.128] * [-1387.234] (-1390.966) (-1387.879) (-1389.006) -- 0:00:43 324000 -- [-1388.726] (-1392.326) (-1391.116) (-1388.713) * (-1387.418) (-1386.923) (-1390.039) [-1389.781] -- 0:00:43 324500 -- (-1391.172) (-1391.172) [-1389.218] (-1390.209) * [-1387.156] (-1398.545) (-1387.480) (-1388.092) -- 0:00:43 325000 -- (-1386.771) [-1388.967] (-1387.934) (-1389.573) * (-1390.593) [-1389.273] (-1386.397) (-1392.282) -- 0:00:43 Average standard deviation of split frequencies: 0.009239 325500 -- [-1386.108] (-1388.073) (-1387.632) (-1389.487) * (-1387.608) (-1391.658) (-1387.272) [-1389.457] -- 0:00:43 326000 -- [-1387.512] (-1392.300) (-1389.018) (-1390.543) * (-1387.774) (-1389.114) (-1387.317) [-1388.981] -- 0:00:43 326500 -- (-1390.713) [-1389.809] (-1387.294) (-1388.793) * (-1388.354) (-1392.520) (-1386.601) [-1388.246] -- 0:00:43 327000 -- (-1392.508) (-1390.090) [-1388.271] (-1387.905) * (-1388.829) (-1388.216) [-1389.493] (-1388.345) -- 0:00:43 327500 -- (-1388.483) (-1392.233) (-1386.880) [-1388.620] * (-1388.850) [-1387.212] (-1392.926) (-1386.948) -- 0:00:43 328000 -- (-1387.773) (-1387.923) [-1386.610] (-1386.964) * [-1388.424] (-1387.214) (-1387.257) (-1386.661) -- 0:00:43 328500 -- (-1387.807) (-1393.844) (-1387.084) [-1387.465] * [-1388.781] (-1387.363) (-1386.915) (-1387.671) -- 0:00:42 329000 -- (-1387.292) (-1392.178) [-1388.658] (-1389.265) * (-1387.909) (-1386.698) [-1388.370] (-1387.391) -- 0:00:42 329500 -- (-1389.345) [-1391.309] (-1389.999) (-1387.816) * (-1390.060) (-1387.728) [-1391.165] (-1388.615) -- 0:00:42 330000 -- (-1386.659) [-1388.774] (-1388.627) (-1386.573) * (-1386.550) (-1392.384) (-1388.929) [-1390.007] -- 0:00:42 Average standard deviation of split frequencies: 0.008395 330500 -- [-1386.549] (-1391.818) (-1389.836) (-1386.828) * (-1388.069) (-1391.013) (-1386.538) [-1389.175] -- 0:00:42 331000 -- (-1386.211) (-1389.138) [-1387.887] (-1387.464) * (-1391.990) (-1386.487) [-1387.929] (-1391.905) -- 0:00:42 331500 -- [-1387.399] (-1388.016) (-1388.581) (-1386.571) * (-1389.419) (-1390.728) [-1386.566] (-1395.914) -- 0:00:42 332000 -- (-1389.828) (-1387.346) (-1389.320) [-1387.904] * (-1389.971) (-1387.923) [-1386.257] (-1397.246) -- 0:00:42 332500 -- [-1388.057] (-1387.079) (-1388.343) (-1387.158) * [-1386.999] (-1391.609) (-1388.887) (-1386.914) -- 0:00:42 333000 -- (-1390.464) [-1388.163] (-1387.591) (-1388.281) * [-1389.255] (-1387.992) (-1388.002) (-1388.731) -- 0:00:42 333500 -- (-1390.564) (-1386.469) [-1388.029] (-1386.998) * (-1387.573) [-1386.611] (-1387.634) (-1386.550) -- 0:00:41 334000 -- (-1387.772) [-1386.568] (-1387.888) (-1386.998) * (-1388.058) (-1390.168) [-1387.767] (-1388.898) -- 0:00:41 334500 -- (-1390.069) (-1387.793) [-1387.772] (-1389.384) * [-1388.317] (-1386.641) (-1388.259) (-1387.607) -- 0:00:41 335000 -- (-1391.454) (-1391.930) [-1387.323] (-1391.036) * [-1386.736] (-1386.843) (-1389.184) (-1387.455) -- 0:00:41 Average standard deviation of split frequencies: 0.008184 335500 -- (-1391.016) (-1391.252) [-1387.211] (-1390.017) * [-1390.910] (-1386.899) (-1387.333) (-1386.674) -- 0:00:41 336000 -- (-1388.545) [-1389.739] (-1388.384) (-1387.719) * (-1386.949) (-1389.010) (-1387.442) [-1386.761] -- 0:00:41 336500 -- [-1388.941] (-1387.594) (-1393.382) (-1389.359) * (-1388.641) [-1387.950] (-1386.968) (-1388.535) -- 0:00:41 337000 -- (-1387.409) (-1387.722) [-1391.069] (-1387.565) * (-1387.724) (-1389.039) (-1388.213) [-1388.025] -- 0:00:41 337500 -- (-1393.064) (-1388.093) [-1389.286] (-1387.667) * (-1387.010) (-1390.068) [-1387.914] (-1387.947) -- 0:00:41 338000 -- (-1390.622) (-1389.634) (-1388.054) [-1388.076] * (-1387.550) [-1387.968] (-1390.968) (-1389.146) -- 0:00:41 338500 -- (-1391.959) (-1389.634) (-1388.764) [-1389.297] * (-1386.728) (-1388.251) [-1387.451] (-1392.503) -- 0:00:41 339000 -- [-1388.498] (-1390.001) (-1388.051) (-1388.938) * (-1390.013) (-1387.188) [-1389.466] (-1390.626) -- 0:00:40 339500 -- [-1388.198] (-1388.407) (-1387.222) (-1387.166) * (-1387.458) [-1387.482] (-1389.536) (-1389.195) -- 0:00:42 340000 -- (-1389.825) (-1386.355) [-1390.462] (-1388.078) * [-1388.764] (-1387.354) (-1389.056) (-1386.970) -- 0:00:42 Average standard deviation of split frequencies: 0.007918 340500 -- (-1389.623) (-1388.673) (-1390.235) [-1386.940] * (-1389.865) (-1389.521) [-1390.239] (-1390.182) -- 0:00:42 341000 -- (-1388.844) (-1390.485) (-1390.637) [-1387.492] * [-1388.181] (-1387.159) (-1387.405) (-1390.516) -- 0:00:42 341500 -- [-1390.021] (-1387.285) (-1387.831) (-1391.050) * (-1386.456) (-1386.708) [-1387.837] (-1388.777) -- 0:00:42 342000 -- [-1389.403] (-1387.901) (-1388.563) (-1391.645) * (-1386.427) [-1388.677] (-1388.188) (-1387.141) -- 0:00:42 342500 -- (-1389.453) [-1388.283] (-1387.263) (-1388.922) * [-1389.701] (-1389.956) (-1387.056) (-1387.996) -- 0:00:42 343000 -- [-1390.405] (-1389.956) (-1386.830) (-1389.094) * [-1387.084] (-1388.569) (-1388.402) (-1388.245) -- 0:00:42 343500 -- (-1390.151) (-1388.477) [-1388.873] (-1388.780) * (-1388.265) (-1389.534) [-1387.640] (-1389.447) -- 0:00:42 344000 -- (-1390.515) (-1390.906) [-1388.562] (-1387.709) * (-1389.562) [-1389.423] (-1389.336) (-1390.544) -- 0:00:41 344500 -- (-1390.295) [-1389.667] (-1389.881) (-1387.861) * (-1389.821) [-1392.794] (-1389.163) (-1388.818) -- 0:00:41 345000 -- (-1388.980) [-1387.706] (-1391.625) (-1391.341) * [-1389.116] (-1388.385) (-1388.297) (-1387.412) -- 0:00:41 Average standard deviation of split frequencies: 0.008748 345500 -- (-1389.348) (-1388.291) [-1388.489] (-1392.680) * (-1388.456) [-1389.979] (-1388.252) (-1387.480) -- 0:00:41 346000 -- (-1392.463) (-1388.914) (-1391.010) [-1387.960] * (-1388.943) [-1389.179] (-1391.749) (-1387.438) -- 0:00:41 346500 -- (-1391.880) [-1386.746] (-1389.081) (-1390.923) * (-1387.805) (-1389.464) (-1389.431) [-1387.851] -- 0:00:41 347000 -- (-1388.078) (-1386.563) (-1390.257) [-1392.568] * (-1386.443) (-1387.012) (-1388.755) [-1390.584] -- 0:00:41 347500 -- (-1387.947) (-1387.246) [-1389.908] (-1392.486) * (-1389.059) (-1387.655) (-1388.671) [-1391.422] -- 0:00:41 348000 -- [-1387.060] (-1387.240) (-1387.563) (-1391.676) * (-1387.540) (-1389.990) [-1389.590] (-1391.891) -- 0:00:41 348500 -- (-1390.336) (-1387.170) [-1388.769] (-1388.274) * (-1389.910) [-1390.356] (-1388.980) (-1390.587) -- 0:00:41 349000 -- (-1388.556) (-1389.031) [-1388.491] (-1386.608) * (-1386.738) (-1390.990) [-1387.540] (-1387.816) -- 0:00:41 349500 -- [-1387.373] (-1392.547) (-1389.716) (-1386.897) * [-1387.190] (-1389.391) (-1387.759) (-1388.052) -- 0:00:40 350000 -- (-1387.256) (-1387.876) (-1387.980) [-1388.696] * (-1388.374) (-1387.769) [-1387.939] (-1387.294) -- 0:00:40 Average standard deviation of split frequencies: 0.008420 350500 -- (-1389.990) [-1387.354] (-1389.919) (-1390.760) * (-1387.335) (-1387.084) (-1388.427) [-1386.347] -- 0:00:40 351000 -- (-1388.831) (-1391.173) (-1387.255) [-1387.607] * [-1387.332] (-1389.479) (-1389.296) (-1386.395) -- 0:00:40 351500 -- (-1387.381) (-1390.429) (-1387.879) [-1387.755] * [-1388.938] (-1389.872) (-1392.098) (-1392.958) -- 0:00:40 352000 -- (-1387.348) (-1389.337) [-1387.788] (-1389.283) * (-1388.846) [-1387.050] (-1386.714) (-1387.967) -- 0:00:40 352500 -- (-1387.916) [-1389.950] (-1389.232) (-1387.143) * [-1388.709] (-1389.015) (-1386.504) (-1386.655) -- 0:00:40 353000 -- (-1387.521) [-1386.853] (-1387.136) (-1387.190) * (-1389.503) (-1387.306) (-1387.075) [-1386.719] -- 0:00:40 353500 -- (-1388.239) (-1387.568) (-1391.806) [-1387.463] * (-1392.386) (-1388.748) (-1386.938) [-1386.736] -- 0:00:40 354000 -- (-1388.296) [-1387.866] (-1390.375) (-1391.989) * (-1389.845) (-1389.161) (-1387.820) [-1388.559] -- 0:00:40 354500 -- [-1388.655] (-1386.992) (-1395.490) (-1392.482) * [-1387.709] (-1392.939) (-1386.916) (-1386.308) -- 0:00:40 355000 -- [-1387.616] (-1387.009) (-1389.349) (-1388.603) * (-1387.047) (-1388.927) (-1386.885) [-1386.485] -- 0:00:39 Average standard deviation of split frequencies: 0.007062 355500 -- (-1388.810) (-1386.992) (-1389.576) [-1389.517] * (-1387.016) [-1387.752] (-1388.509) (-1389.012) -- 0:00:41 356000 -- [-1389.196] (-1389.255) (-1389.996) (-1389.430) * (-1387.485) [-1387.911] (-1386.436) (-1388.868) -- 0:00:41 356500 -- (-1390.643) [-1389.390] (-1391.967) (-1390.310) * [-1387.498] (-1388.082) (-1389.487) (-1389.633) -- 0:00:41 357000 -- (-1390.167) (-1390.408) (-1390.682) [-1387.639] * (-1386.682) (-1387.237) [-1387.642] (-1388.309) -- 0:00:41 357500 -- (-1389.411) (-1391.311) [-1388.465] (-1387.839) * (-1386.682) (-1388.995) (-1387.587) [-1389.957] -- 0:00:41 358000 -- (-1387.989) (-1389.806) [-1387.306] (-1392.941) * (-1387.739) (-1387.916) [-1388.147] (-1389.763) -- 0:00:41 358500 -- [-1387.468] (-1392.044) (-1388.391) (-1387.968) * (-1386.873) (-1388.800) (-1388.582) [-1390.079] -- 0:00:41 359000 -- (-1387.068) (-1392.136) [-1387.485] (-1386.927) * (-1387.271) (-1389.389) [-1390.866] (-1388.124) -- 0:00:41 359500 -- (-1386.949) [-1390.480] (-1388.389) (-1386.817) * [-1389.162] (-1387.403) (-1387.262) (-1388.634) -- 0:00:40 360000 -- (-1389.486) (-1390.420) [-1388.195] (-1389.265) * (-1387.432) (-1390.057) (-1386.711) [-1390.169] -- 0:00:40 Average standard deviation of split frequencies: 0.007624 360500 -- (-1386.879) (-1390.284) [-1389.973] (-1387.871) * [-1388.061] (-1387.366) (-1387.303) (-1388.679) -- 0:00:40 361000 -- [-1388.760] (-1386.630) (-1389.326) (-1387.806) * [-1388.913] (-1386.941) (-1387.882) (-1389.824) -- 0:00:40 361500 -- (-1386.833) [-1386.665] (-1394.915) (-1387.205) * [-1387.758] (-1387.760) (-1387.397) (-1390.368) -- 0:00:40 362000 -- [-1386.146] (-1387.695) (-1390.727) (-1387.063) * [-1389.794] (-1390.916) (-1388.712) (-1388.443) -- 0:00:40 362500 -- (-1386.146) (-1387.594) [-1389.846] (-1403.035) * (-1394.351) [-1389.486] (-1387.480) (-1389.251) -- 0:00:40 363000 -- (-1389.070) (-1386.944) (-1390.286) [-1394.158] * [-1390.453] (-1389.701) (-1388.227) (-1387.234) -- 0:00:40 363500 -- (-1387.764) [-1387.697] (-1388.056) (-1391.428) * [-1387.962] (-1386.953) (-1388.489) (-1386.432) -- 0:00:40 364000 -- (-1388.675) [-1387.059] (-1389.885) (-1388.170) * (-1391.547) (-1387.846) (-1386.810) [-1388.162] -- 0:00:40 364500 -- (-1388.363) [-1386.998] (-1387.155) (-1389.673) * (-1389.245) (-1387.039) (-1389.132) [-1387.671] -- 0:00:40 365000 -- (-1388.722) [-1389.095] (-1388.189) (-1387.178) * (-1387.512) [-1389.211] (-1393.180) (-1387.671) -- 0:00:40 Average standard deviation of split frequencies: 0.007943 365500 -- [-1387.546] (-1389.646) (-1389.600) (-1389.366) * (-1388.542) (-1391.857) (-1392.520) [-1387.272] -- 0:00:39 366000 -- (-1386.996) (-1389.522) (-1390.870) [-1392.441] * (-1389.545) (-1392.913) [-1389.290] (-1387.374) -- 0:00:39 366500 -- (-1389.456) [-1388.701] (-1390.319) (-1388.751) * (-1387.850) (-1395.431) [-1388.492] (-1388.341) -- 0:00:39 367000 -- (-1388.032) (-1389.335) (-1389.458) [-1389.311] * (-1392.491) (-1389.540) [-1388.495] (-1388.862) -- 0:00:39 367500 -- (-1386.544) (-1389.517) (-1387.942) [-1386.799] * (-1388.477) [-1386.155] (-1390.729) (-1388.102) -- 0:00:39 368000 -- (-1387.347) (-1388.291) [-1386.557] (-1387.067) * (-1387.436) (-1389.155) [-1387.796] (-1388.176) -- 0:00:39 368500 -- (-1387.755) (-1387.328) (-1386.628) [-1387.725] * (-1387.903) (-1388.839) [-1388.310] (-1391.255) -- 0:00:39 369000 -- [-1386.214] (-1387.800) (-1387.635) (-1389.156) * (-1386.276) (-1390.284) (-1387.682) [-1387.166] -- 0:00:39 369500 -- (-1386.793) (-1386.529) [-1389.301] (-1389.656) * [-1387.190] (-1390.370) (-1387.148) (-1387.803) -- 0:00:39 370000 -- (-1386.637) (-1386.773) (-1386.611) [-1388.673] * (-1389.515) (-1390.779) [-1388.421] (-1388.703) -- 0:00:39 Average standard deviation of split frequencies: 0.008702 370500 -- (-1387.439) (-1388.622) (-1386.919) [-1387.361] * (-1387.373) (-1388.415) [-1387.775] (-1387.998) -- 0:00:39 371000 -- (-1389.088) (-1387.430) [-1389.773] (-1388.876) * (-1387.270) [-1387.851] (-1391.137) (-1387.578) -- 0:00:38 371500 -- (-1387.565) (-1387.683) [-1388.608] (-1390.508) * (-1386.786) [-1389.908] (-1390.006) (-1387.388) -- 0:00:40 372000 -- (-1387.245) (-1388.846) [-1387.216] (-1389.551) * (-1386.890) [-1390.500] (-1388.027) (-1388.440) -- 0:00:40 372500 -- (-1389.738) [-1389.344] (-1389.138) (-1390.676) * (-1386.425) [-1387.987] (-1388.213) (-1388.134) -- 0:00:40 373000 -- [-1389.835] (-1390.573) (-1393.129) (-1392.619) * [-1386.161] (-1387.873) (-1386.610) (-1387.461) -- 0:00:40 373500 -- [-1388.890] (-1387.612) (-1389.279) (-1388.146) * (-1388.565) [-1389.415] (-1388.152) (-1389.031) -- 0:00:40 374000 -- (-1389.488) (-1387.149) [-1388.107] (-1391.868) * (-1386.379) (-1388.562) [-1388.338] (-1389.463) -- 0:00:40 374500 -- [-1387.213] (-1387.602) (-1386.282) (-1393.283) * (-1386.696) (-1387.825) [-1390.450] (-1389.431) -- 0:00:40 375000 -- (-1387.254) [-1390.389] (-1386.272) (-1387.562) * (-1388.439) [-1387.396] (-1391.649) (-1389.132) -- 0:00:40 Average standard deviation of split frequencies: 0.008358 375500 -- (-1387.445) [-1388.059] (-1388.693) (-1386.668) * (-1387.040) [-1387.402] (-1388.080) (-1389.081) -- 0:00:39 376000 -- (-1387.444) [-1387.724] (-1389.501) (-1386.715) * (-1387.151) (-1392.149) (-1386.947) [-1389.309] -- 0:00:39 376500 -- (-1387.133) [-1386.554] (-1392.677) (-1387.031) * (-1388.736) [-1393.331] (-1388.810) (-1389.997) -- 0:00:39 377000 -- [-1386.637] (-1389.967) (-1388.730) (-1393.562) * (-1386.917) (-1387.881) [-1388.217] (-1391.068) -- 0:00:39 377500 -- (-1390.442) [-1387.188] (-1386.496) (-1394.604) * (-1386.467) [-1387.899] (-1386.378) (-1387.907) -- 0:00:39 378000 -- [-1389.023] (-1389.790) (-1389.517) (-1388.820) * (-1390.439) [-1389.710] (-1386.148) (-1387.651) -- 0:00:39 378500 -- (-1386.579) (-1389.503) (-1389.630) [-1387.875] * (-1390.505) (-1389.633) (-1387.388) [-1387.850] -- 0:00:39 379000 -- (-1389.970) (-1390.243) (-1389.499) [-1393.217] * (-1388.602) (-1389.353) (-1388.333) [-1392.992] -- 0:00:39 379500 -- (-1391.853) [-1388.068] (-1387.635) (-1393.319) * (-1388.258) (-1387.952) [-1386.647] (-1391.787) -- 0:00:39 380000 -- (-1389.503) [-1387.852] (-1388.095) (-1390.793) * (-1388.941) (-1387.530) [-1387.930] (-1386.578) -- 0:00:39 Average standard deviation of split frequencies: 0.008187 380500 -- (-1390.011) (-1388.069) (-1391.564) [-1387.203] * (-1389.916) (-1387.746) (-1391.938) [-1387.181] -- 0:00:39 381000 -- (-1389.252) (-1388.354) (-1389.850) [-1386.870] * [-1388.638] (-1387.645) (-1388.948) (-1389.545) -- 0:00:38 381500 -- (-1387.123) (-1387.911) [-1389.755] (-1389.004) * [-1388.088] (-1389.617) (-1389.150) (-1390.408) -- 0:00:38 382000 -- (-1389.806) (-1387.650) [-1386.897] (-1389.497) * [-1388.093] (-1387.925) (-1386.837) (-1389.670) -- 0:00:38 382500 -- [-1389.254] (-1387.222) (-1387.412) (-1388.193) * (-1388.434) (-1387.977) [-1389.289] (-1389.962) -- 0:00:38 383000 -- (-1387.267) [-1387.048] (-1388.506) (-1392.099) * (-1390.207) (-1386.778) [-1389.556] (-1388.533) -- 0:00:38 383500 -- [-1387.869] (-1391.768) (-1387.642) (-1391.737) * [-1387.523] (-1386.949) (-1388.529) (-1388.872) -- 0:00:38 384000 -- (-1388.291) [-1386.908] (-1386.867) (-1390.218) * (-1390.614) [-1387.472] (-1391.322) (-1389.235) -- 0:00:38 384500 -- (-1389.979) (-1388.158) [-1386.497] (-1390.940) * [-1389.107] (-1387.464) (-1388.885) (-1392.875) -- 0:00:38 385000 -- (-1387.179) [-1387.242] (-1390.044) (-1391.721) * [-1388.603] (-1388.277) (-1388.293) (-1390.340) -- 0:00:38 Average standard deviation of split frequencies: 0.008413 385500 -- (-1390.091) (-1388.730) [-1388.961] (-1389.440) * (-1388.707) (-1387.349) (-1390.860) [-1391.479] -- 0:00:38 386000 -- (-1387.144) (-1387.494) (-1390.769) [-1387.823] * (-1393.701) [-1388.184] (-1388.172) (-1392.041) -- 0:00:38 386500 -- (-1386.968) [-1390.376] (-1391.173) (-1388.364) * (-1389.282) (-1388.319) [-1390.425] (-1391.312) -- 0:00:38 387000 -- [-1386.744] (-1388.137) (-1391.894) (-1389.865) * [-1390.184] (-1388.574) (-1391.480) (-1389.756) -- 0:00:38 387500 -- (-1396.913) (-1388.625) [-1387.713] (-1392.937) * (-1390.595) (-1387.864) [-1388.504] (-1387.198) -- 0:00:39 388000 -- (-1389.603) [-1391.394] (-1388.669) (-1387.543) * (-1388.062) (-1389.801) [-1387.612] (-1386.842) -- 0:00:39 388500 -- [-1388.646] (-1386.783) (-1387.295) (-1386.929) * (-1388.555) [-1388.102] (-1390.047) (-1387.474) -- 0:00:39 389000 -- [-1388.936] (-1386.946) (-1388.634) (-1391.217) * (-1388.757) (-1388.114) (-1387.646) [-1386.597] -- 0:00:39 389500 -- (-1390.538) [-1388.231] (-1390.005) (-1391.232) * [-1388.422] (-1387.792) (-1387.541) (-1389.483) -- 0:00:39 390000 -- (-1388.418) (-1389.875) (-1391.227) [-1389.549] * (-1388.251) (-1387.518) (-1388.437) [-1391.933] -- 0:00:39 Average standard deviation of split frequencies: 0.007977 390500 -- (-1391.133) (-1393.917) [-1390.223] (-1386.634) * (-1388.411) (-1388.617) (-1386.852) [-1386.807] -- 0:00:39 391000 -- [-1389.543] (-1386.410) (-1390.673) (-1387.677) * (-1391.717) [-1387.391] (-1388.430) (-1391.663) -- 0:00:38 391500 -- [-1389.789] (-1387.872) (-1388.829) (-1387.088) * [-1394.949] (-1386.634) (-1386.812) (-1389.112) -- 0:00:38 392000 -- [-1387.203] (-1389.392) (-1392.293) (-1386.979) * (-1388.539) [-1386.814] (-1387.441) (-1388.596) -- 0:00:38 392500 -- (-1387.292) [-1391.423] (-1388.423) (-1389.036) * (-1388.367) [-1389.971] (-1386.279) (-1391.412) -- 0:00:38 393000 -- [-1388.714] (-1387.415) (-1389.028) (-1386.814) * (-1392.656) (-1387.903) (-1386.837) [-1389.401] -- 0:00:38 393500 -- (-1388.040) [-1387.222] (-1387.592) (-1386.911) * (-1393.663) [-1389.550] (-1388.006) (-1393.967) -- 0:00:38 394000 -- (-1389.207) (-1389.822) [-1387.458] (-1387.337) * (-1396.281) [-1388.809] (-1386.801) (-1393.810) -- 0:00:38 394500 -- (-1387.759) (-1393.745) [-1389.019] (-1387.856) * (-1388.923) (-1388.275) [-1386.884] (-1386.825) -- 0:00:38 395000 -- (-1388.782) (-1386.684) (-1388.479) [-1391.505] * [-1387.553] (-1388.725) (-1387.344) (-1389.956) -- 0:00:38 Average standard deviation of split frequencies: 0.008959 395500 -- (-1388.207) [-1386.783] (-1387.661) (-1391.585) * (-1386.986) [-1387.565] (-1389.066) (-1388.514) -- 0:00:38 396000 -- (-1387.764) [-1387.131] (-1390.452) (-1386.884) * (-1387.951) (-1387.695) [-1386.523] (-1388.775) -- 0:00:38 396500 -- (-1388.768) (-1391.672) [-1390.523] (-1388.173) * (-1391.475) [-1389.079] (-1387.464) (-1390.576) -- 0:00:38 397000 -- (-1387.166) [-1388.529] (-1386.457) (-1386.783) * [-1388.573] (-1389.252) (-1388.087) (-1391.127) -- 0:00:37 397500 -- (-1386.759) [-1386.634] (-1390.516) (-1386.916) * (-1386.481) (-1389.146) (-1388.433) [-1389.033] -- 0:00:37 398000 -- (-1391.227) (-1387.266) [-1387.894] (-1386.743) * (-1388.603) (-1390.838) (-1388.883) [-1390.872] -- 0:00:37 398500 -- (-1391.670) (-1387.892) (-1390.193) [-1386.742] * (-1387.646) (-1390.071) (-1387.155) [-1390.181] -- 0:00:37 399000 -- (-1397.094) (-1386.821) (-1388.797) [-1386.743] * (-1386.779) [-1388.815] (-1387.295) (-1387.407) -- 0:00:37 399500 -- (-1390.199) (-1389.729) [-1389.406] (-1386.406) * [-1386.561] (-1387.618) (-1387.385) (-1387.760) -- 0:00:37 400000 -- [-1391.169] (-1387.235) (-1390.151) (-1388.873) * (-1388.148) (-1386.673) [-1388.338] (-1390.313) -- 0:00:37 Average standard deviation of split frequencies: 0.008889 400500 -- (-1389.055) (-1389.734) [-1388.747] (-1388.701) * (-1387.577) (-1387.754) [-1386.501] (-1389.668) -- 0:00:37 401000 -- (-1390.305) [-1388.487] (-1387.461) (-1392.173) * (-1388.717) [-1386.955] (-1386.852) (-1390.339) -- 0:00:37 401500 -- (-1390.055) [-1387.198] (-1387.595) (-1388.722) * (-1387.209) [-1387.537] (-1386.852) (-1387.707) -- 0:00:37 402000 -- (-1392.538) [-1387.157] (-1392.624) (-1388.350) * (-1390.146) (-1389.886) (-1387.127) [-1388.001] -- 0:00:37 402500 -- [-1388.677] (-1387.012) (-1389.258) (-1387.821) * (-1389.745) (-1387.842) [-1391.186] (-1390.174) -- 0:00:37 403000 -- [-1386.741] (-1386.913) (-1389.726) (-1388.167) * (-1389.556) (-1392.448) (-1389.337) [-1387.520] -- 0:00:37 403500 -- (-1388.549) [-1390.249] (-1387.175) (-1388.020) * (-1387.211) [-1390.761] (-1388.507) (-1387.506) -- 0:00:38 404000 -- (-1390.160) (-1391.296) (-1390.169) [-1389.106] * (-1390.737) (-1390.634) [-1387.089] (-1386.498) -- 0:00:38 404500 -- [-1388.464] (-1388.500) (-1391.560) (-1389.444) * (-1387.824) [-1386.810] (-1387.609) (-1388.307) -- 0:00:38 405000 -- (-1394.346) [-1388.031] (-1388.003) (-1392.057) * (-1387.637) (-1388.282) (-1390.556) [-1388.478] -- 0:00:38 Average standard deviation of split frequencies: 0.008922 405500 -- (-1387.939) [-1387.768] (-1387.112) (-1389.131) * (-1387.559) (-1388.069) [-1388.644] (-1387.691) -- 0:00:38 406000 -- (-1391.043) (-1388.032) (-1388.989) [-1391.866] * (-1389.136) [-1391.654] (-1391.002) (-1387.440) -- 0:00:38 406500 -- (-1388.208) (-1388.096) (-1388.446) [-1386.959] * (-1387.855) [-1388.354] (-1387.932) (-1386.828) -- 0:00:37 407000 -- (-1388.326) (-1389.160) [-1387.887] (-1390.653) * (-1390.406) (-1389.310) [-1387.645] (-1387.253) -- 0:00:37 407500 -- (-1389.241) [-1387.410] (-1386.061) (-1387.951) * (-1388.009) (-1389.230) [-1386.843] (-1389.542) -- 0:00:37 408000 -- [-1388.477] (-1386.994) (-1387.222) (-1391.841) * [-1390.045] (-1387.099) (-1391.437) (-1388.697) -- 0:00:37 408500 -- (-1387.852) (-1386.354) [-1386.235] (-1390.786) * (-1388.599) (-1387.616) (-1389.125) [-1387.046] -- 0:00:37 409000 -- [-1389.134] (-1390.048) (-1387.969) (-1389.969) * (-1387.811) (-1390.436) (-1388.617) [-1386.971] -- 0:00:37 409500 -- (-1392.030) (-1390.044) (-1387.727) [-1388.479] * (-1388.341) (-1391.379) (-1387.009) [-1386.090] -- 0:00:37 410000 -- (-1392.166) (-1392.958) [-1387.590] (-1387.930) * (-1386.866) (-1391.936) (-1388.535) [-1386.889] -- 0:00:37 Average standard deviation of split frequencies: 0.009502 410500 -- [-1390.181] (-1387.102) (-1388.997) (-1390.140) * (-1386.896) (-1391.094) (-1386.855) [-1387.033] -- 0:00:37 411000 -- (-1389.006) [-1386.528] (-1392.447) (-1388.225) * (-1387.426) (-1390.222) [-1391.825] (-1393.206) -- 0:00:37 411500 -- [-1388.010] (-1387.345) (-1388.817) (-1390.079) * (-1391.628) (-1390.776) [-1388.792] (-1389.703) -- 0:00:37 412000 -- [-1389.635] (-1388.856) (-1387.507) (-1388.409) * (-1388.373) [-1390.648] (-1387.456) (-1386.896) -- 0:00:37 412500 -- (-1387.860) (-1389.200) [-1386.940] (-1388.012) * (-1386.396) (-1391.503) [-1387.762] (-1387.155) -- 0:00:37 413000 -- (-1386.837) (-1388.504) (-1389.980) [-1387.613] * (-1386.148) (-1387.016) [-1387.795] (-1388.563) -- 0:00:36 413500 -- (-1389.093) (-1390.123) (-1386.888) [-1386.932] * (-1386.518) (-1386.683) [-1388.065] (-1388.133) -- 0:00:36 414000 -- (-1388.835) (-1387.244) (-1386.943) [-1387.301] * (-1386.728) [-1387.903] (-1388.981) (-1393.208) -- 0:00:36 414500 -- (-1397.792) (-1388.271) (-1391.278) [-1386.727] * (-1387.675) (-1388.084) (-1387.718) [-1390.019] -- 0:00:36 415000 -- (-1392.954) (-1388.956) [-1387.326] (-1387.723) * (-1387.983) (-1387.152) [-1389.432] (-1386.423) -- 0:00:36 Average standard deviation of split frequencies: 0.009602 415500 -- [-1389.212] (-1387.877) (-1387.537) (-1387.727) * [-1388.825] (-1387.956) (-1388.245) (-1386.870) -- 0:00:36 416000 -- (-1387.387) (-1392.791) (-1387.521) [-1387.569] * (-1389.133) [-1389.532] (-1388.681) (-1390.494) -- 0:00:36 416500 -- (-1387.709) (-1388.800) [-1389.550] (-1390.343) * [-1387.299] (-1389.065) (-1387.961) (-1390.964) -- 0:00:36 417000 -- (-1388.026) (-1389.608) (-1389.265) [-1388.252] * (-1386.768) (-1389.845) [-1387.737] (-1387.170) -- 0:00:36 417500 -- (-1391.544) [-1388.437] (-1389.537) (-1388.123) * (-1389.871) [-1388.845] (-1387.556) (-1389.411) -- 0:00:36 418000 -- (-1391.171) (-1389.170) (-1388.083) [-1388.113] * (-1393.037) (-1388.069) [-1390.185] (-1387.061) -- 0:00:36 418500 -- (-1388.577) [-1386.721] (-1387.540) (-1388.417) * (-1392.256) (-1387.059) (-1390.056) [-1388.773] -- 0:00:36 419000 -- (-1387.269) [-1388.018] (-1387.815) (-1387.420) * (-1388.297) (-1386.801) [-1389.423] (-1388.453) -- 0:00:36 419500 -- (-1388.321) (-1390.244) [-1387.358] (-1387.121) * [-1389.956] (-1388.067) (-1388.141) (-1387.752) -- 0:00:37 420000 -- (-1389.475) (-1386.736) (-1387.609) [-1386.945] * (-1392.158) (-1388.896) [-1388.040] (-1387.520) -- 0:00:37 Average standard deviation of split frequencies: 0.009836 420500 -- (-1390.665) (-1386.639) (-1387.329) [-1387.300] * (-1393.645) [-1387.699] (-1387.519) (-1387.737) -- 0:00:37 421000 -- (-1389.539) (-1386.404) [-1387.579] (-1386.973) * (-1387.890) (-1387.098) [-1387.819] (-1388.052) -- 0:00:37 421500 -- [-1386.622] (-1386.752) (-1388.145) (-1389.082) * (-1388.239) [-1388.255] (-1390.823) (-1392.351) -- 0:00:37 422000 -- [-1389.024] (-1390.934) (-1387.851) (-1388.306) * [-1387.801] (-1387.619) (-1388.228) (-1389.598) -- 0:00:36 422500 -- [-1389.954] (-1389.303) (-1388.049) (-1388.272) * [-1387.873] (-1387.746) (-1388.923) (-1390.483) -- 0:00:36 423000 -- (-1390.084) (-1389.616) [-1391.063] (-1388.333) * [-1388.305] (-1387.433) (-1390.636) (-1390.325) -- 0:00:36 423500 -- (-1390.644) (-1392.196) (-1391.350) [-1387.057] * (-1388.629) [-1386.978] (-1388.238) (-1390.834) -- 0:00:36 424000 -- [-1388.601] (-1389.589) (-1389.846) (-1386.619) * (-1387.209) [-1386.978] (-1386.931) (-1390.987) -- 0:00:36 424500 -- (-1388.080) (-1389.423) [-1391.847] (-1392.197) * (-1389.361) (-1386.099) (-1387.532) [-1394.379] -- 0:00:36 425000 -- [-1386.447] (-1386.424) (-1389.813) (-1390.304) * (-1388.040) [-1386.201] (-1387.981) (-1387.432) -- 0:00:36 Average standard deviation of split frequencies: 0.009099 425500 -- (-1387.173) (-1389.455) (-1386.998) [-1391.165] * (-1388.871) (-1387.963) (-1388.893) [-1388.349] -- 0:00:36 426000 -- [-1388.067] (-1388.723) (-1390.325) (-1392.621) * (-1388.243) [-1388.001] (-1388.506) (-1388.845) -- 0:00:36 426500 -- (-1393.416) [-1389.714] (-1389.701) (-1390.125) * [-1387.668] (-1391.738) (-1388.090) (-1387.636) -- 0:00:36 427000 -- (-1387.805) (-1391.122) [-1390.864] (-1389.032) * (-1387.670) [-1387.146] (-1388.375) (-1391.030) -- 0:00:36 427500 -- [-1388.505] (-1386.896) (-1390.913) (-1388.951) * (-1387.382) (-1391.642) [-1386.237] (-1389.340) -- 0:00:36 428000 -- (-1391.251) [-1386.234] (-1391.985) (-1388.312) * [-1386.469] (-1387.835) (-1386.354) (-1388.658) -- 0:00:36 428500 -- (-1389.299) [-1388.265] (-1389.145) (-1388.004) * [-1386.486] (-1387.989) (-1387.568) (-1389.809) -- 0:00:36 429000 -- (-1390.885) (-1387.762) [-1387.587] (-1390.082) * (-1389.826) [-1387.069] (-1386.749) (-1393.087) -- 0:00:35 429500 -- (-1389.823) (-1392.533) (-1389.657) [-1390.496] * (-1386.483) (-1390.351) [-1388.069] (-1392.574) -- 0:00:35 430000 -- (-1388.017) [-1391.916] (-1387.573) (-1393.067) * [-1386.600] (-1387.935) (-1389.220) (-1390.464) -- 0:00:35 Average standard deviation of split frequencies: 0.009102 430500 -- (-1392.113) (-1387.787) [-1387.134] (-1389.290) * (-1387.415) [-1391.559] (-1387.909) (-1390.463) -- 0:00:35 431000 -- [-1394.065] (-1386.637) (-1386.619) (-1387.391) * (-1388.356) [-1387.344] (-1387.918) (-1386.794) -- 0:00:35 431500 -- (-1391.514) (-1387.619) (-1386.375) [-1389.827] * [-1387.056] (-1389.831) (-1391.916) (-1390.789) -- 0:00:35 432000 -- (-1387.481) (-1387.290) (-1388.865) [-1387.763] * (-1388.959) [-1392.731] (-1388.020) (-1391.563) -- 0:00:35 432500 -- (-1389.321) (-1386.625) [-1386.706] (-1388.697) * (-1388.511) (-1388.120) [-1386.969] (-1388.412) -- 0:00:35 433000 -- (-1387.967) (-1386.687) [-1387.165] (-1391.727) * (-1387.510) [-1387.791] (-1386.629) (-1388.270) -- 0:00:35 433500 -- [-1386.775] (-1387.902) (-1387.769) (-1392.351) * [-1387.340] (-1388.068) (-1386.626) (-1387.694) -- 0:00:35 434000 -- (-1386.793) (-1389.322) [-1389.213] (-1389.004) * (-1387.822) (-1387.420) [-1387.315] (-1390.272) -- 0:00:35 434500 -- (-1387.249) [-1387.532] (-1388.837) (-1389.133) * (-1387.788) (-1389.876) [-1391.464] (-1389.484) -- 0:00:35 435000 -- [-1390.330] (-1389.065) (-1388.409) (-1389.492) * (-1390.322) [-1389.870] (-1392.150) (-1387.038) -- 0:00:36 Average standard deviation of split frequencies: 0.009190 435500 -- (-1388.830) (-1388.286) [-1390.475] (-1387.637) * (-1387.194) (-1390.497) (-1392.406) [-1387.267] -- 0:00:36 436000 -- [-1388.295] (-1388.619) (-1388.170) (-1387.951) * (-1389.695) [-1387.719] (-1390.064) (-1393.414) -- 0:00:36 436500 -- (-1389.230) [-1390.745] (-1387.045) (-1387.569) * (-1388.937) [-1387.055] (-1388.435) (-1391.413) -- 0:00:36 437000 -- (-1389.139) (-1387.378) (-1386.658) [-1387.525] * (-1392.941) (-1388.749) (-1389.561) [-1386.382] -- 0:00:36 437500 -- (-1387.016) (-1389.651) (-1386.483) [-1388.972] * [-1390.817] (-1388.355) (-1390.427) (-1387.562) -- 0:00:36 438000 -- (-1386.216) [-1389.325] (-1386.844) (-1389.241) * (-1389.405) (-1386.660) [-1387.256] (-1388.048) -- 0:00:35 438500 -- (-1386.844) (-1387.783) (-1389.986) [-1387.977] * [-1386.529] (-1390.686) (-1390.825) (-1388.221) -- 0:00:35 439000 -- (-1387.233) [-1390.393] (-1386.618) (-1388.407) * [-1386.436] (-1386.565) (-1390.730) (-1387.108) -- 0:00:35 439500 -- [-1386.950] (-1390.249) (-1387.067) (-1392.354) * [-1387.723] (-1387.932) (-1390.130) (-1390.330) -- 0:00:35 440000 -- (-1389.216) (-1387.672) (-1387.201) [-1388.221] * (-1389.982) (-1387.541) (-1388.808) [-1389.096] -- 0:00:35 Average standard deviation of split frequencies: 0.009687 440500 -- [-1390.528] (-1387.185) (-1390.167) (-1392.529) * (-1390.072) [-1386.831] (-1390.464) (-1387.284) -- 0:00:35 441000 -- [-1389.439] (-1388.249) (-1392.335) (-1390.407) * (-1391.120) [-1388.760] (-1390.778) (-1391.434) -- 0:00:35 441500 -- (-1390.679) (-1394.237) [-1389.614] (-1387.394) * (-1389.976) (-1389.643) [-1389.840] (-1391.365) -- 0:00:35 442000 -- (-1387.779) [-1387.930] (-1387.022) (-1388.238) * (-1388.407) (-1391.736) (-1394.549) [-1389.987] -- 0:00:35 442500 -- (-1388.503) [-1389.528] (-1390.749) (-1387.899) * (-1388.721) (-1387.123) (-1391.105) [-1388.526] -- 0:00:35 443000 -- [-1387.856] (-1386.983) (-1387.968) (-1388.041) * (-1386.559) [-1388.298] (-1390.108) (-1388.350) -- 0:00:35 443500 -- (-1387.580) (-1389.447) [-1387.969] (-1388.433) * [-1386.849] (-1388.057) (-1387.759) (-1391.913) -- 0:00:35 444000 -- (-1387.670) [-1387.114] (-1388.129) (-1388.714) * [-1388.470] (-1391.804) (-1387.369) (-1388.666) -- 0:00:35 444500 -- (-1389.018) (-1387.789) (-1388.097) [-1388.859] * (-1389.226) [-1387.847] (-1390.463) (-1387.616) -- 0:00:34 445000 -- (-1389.485) (-1387.838) (-1386.952) [-1390.078] * (-1389.439) (-1388.091) (-1390.266) [-1388.143] -- 0:00:34 Average standard deviation of split frequencies: 0.009689 445500 -- (-1393.703) (-1386.941) [-1387.284] (-1388.027) * (-1389.159) (-1388.986) [-1389.759] (-1388.897) -- 0:00:34 446000 -- [-1386.924] (-1386.894) (-1387.606) (-1388.790) * [-1389.291] (-1387.974) (-1389.661) (-1389.709) -- 0:00:34 446500 -- (-1386.392) [-1386.801] (-1391.216) (-1387.200) * (-1392.051) (-1392.685) [-1388.049] (-1389.858) -- 0:00:34 447000 -- [-1387.570] (-1387.221) (-1386.843) (-1387.277) * (-1389.817) (-1393.159) (-1387.785) [-1390.881] -- 0:00:34 447500 -- (-1388.956) [-1388.007] (-1386.417) (-1390.032) * (-1388.209) [-1392.853] (-1388.123) (-1389.313) -- 0:00:34 448000 -- (-1390.163) [-1388.432] (-1386.571) (-1390.383) * (-1387.952) (-1389.773) [-1388.869] (-1391.287) -- 0:00:34 448500 -- [-1389.812] (-1388.362) (-1387.484) (-1388.198) * (-1388.082) [-1387.881] (-1388.534) (-1391.209) -- 0:00:34 449000 -- (-1391.130) [-1388.363] (-1387.716) (-1388.285) * (-1387.544) (-1386.456) (-1388.293) [-1388.127] -- 0:00:34 449500 -- [-1392.069] (-1387.687) (-1390.479) (-1389.125) * (-1387.032) (-1389.067) [-1389.806] (-1389.987) -- 0:00:34 450000 -- (-1389.043) (-1386.602) [-1391.073] (-1388.924) * (-1388.727) [-1388.839] (-1390.841) (-1388.297) -- 0:00:34 Average standard deviation of split frequencies: 0.009821 450500 -- (-1388.270) (-1388.238) [-1391.424] (-1389.041) * (-1387.596) [-1387.982] (-1389.245) (-1386.623) -- 0:00:34 451000 -- [-1386.248] (-1389.419) (-1389.559) (-1388.614) * (-1387.923) (-1389.118) (-1391.271) [-1387.784] -- 0:00:35 451500 -- (-1387.049) (-1389.166) (-1390.375) [-1386.381] * (-1387.231) (-1388.597) (-1391.981) [-1386.690] -- 0:00:35 452000 -- [-1387.021] (-1389.251) (-1388.625) (-1387.121) * (-1389.578) (-1387.356) [-1386.981] (-1387.069) -- 0:00:35 452500 -- (-1387.093) (-1388.877) (-1390.009) [-1386.924] * [-1386.834] (-1390.449) (-1387.839) (-1387.598) -- 0:00:35 453000 -- (-1386.893) [-1389.152] (-1388.651) (-1388.059) * (-1386.780) (-1387.840) (-1386.965) [-1389.169] -- 0:00:35 453500 -- [-1386.485] (-1389.304) (-1390.530) (-1390.981) * (-1387.905) (-1388.241) [-1386.215] (-1387.584) -- 0:00:34 454000 -- (-1386.760) (-1389.381) (-1390.660) [-1388.991] * (-1388.230) (-1386.505) (-1388.464) [-1391.766] -- 0:00:34 454500 -- (-1387.794) (-1392.676) [-1392.037] (-1388.432) * (-1388.581) [-1386.667] (-1389.975) (-1386.522) -- 0:00:34 455000 -- (-1388.462) (-1387.700) (-1392.260) [-1387.419] * (-1389.821) [-1389.660] (-1388.445) (-1387.707) -- 0:00:34 Average standard deviation of split frequencies: 0.010166 455500 -- [-1387.721] (-1386.648) (-1389.867) (-1388.450) * [-1388.240] (-1393.424) (-1393.267) (-1389.009) -- 0:00:34 456000 -- [-1387.116] (-1387.595) (-1391.741) (-1389.234) * (-1387.280) (-1388.140) (-1389.704) [-1387.688] -- 0:00:34 456500 -- (-1387.624) (-1386.777) (-1388.097) [-1390.380] * (-1389.474) (-1388.002) (-1389.850) [-1388.036] -- 0:00:34 457000 -- (-1389.518) (-1387.205) [-1391.620] (-1387.688) * (-1391.735) (-1388.475) (-1388.728) [-1390.642] -- 0:00:34 457500 -- [-1388.377] (-1387.022) (-1392.000) (-1389.300) * [-1389.197] (-1391.182) (-1389.274) (-1388.365) -- 0:00:34 458000 -- [-1388.922] (-1387.222) (-1388.911) (-1393.678) * [-1393.949] (-1389.084) (-1390.439) (-1389.694) -- 0:00:34 458500 -- (-1388.250) (-1389.105) (-1386.872) [-1391.020] * (-1392.277) (-1391.234) [-1386.986] (-1388.791) -- 0:00:34 459000 -- [-1390.467] (-1387.870) (-1387.805) (-1392.777) * (-1387.867) (-1389.964) (-1387.270) [-1391.264] -- 0:00:34 459500 -- (-1391.281) (-1389.827) [-1387.790] (-1389.508) * (-1387.507) (-1388.659) (-1387.401) [-1391.041] -- 0:00:34 460000 -- (-1388.938) [-1388.468] (-1388.147) (-1389.619) * (-1391.284) [-1387.823] (-1388.013) (-1393.342) -- 0:00:34 Average standard deviation of split frequencies: 0.010574 460500 -- (-1389.005) (-1388.586) (-1388.189) [-1390.684] * (-1388.389) [-1391.863] (-1387.396) (-1391.282) -- 0:00:33 461000 -- (-1387.827) (-1388.281) (-1386.804) [-1389.866] * (-1390.903) (-1387.052) [-1387.343] (-1393.888) -- 0:00:33 461500 -- (-1387.316) (-1387.426) (-1386.996) [-1386.566] * (-1387.166) [-1387.697] (-1388.715) (-1387.917) -- 0:00:33 462000 -- (-1389.573) (-1388.371) [-1387.555] (-1387.110) * [-1388.286] (-1389.018) (-1388.620) (-1390.583) -- 0:00:33 462500 -- (-1388.811) [-1388.747] (-1388.071) (-1387.432) * (-1390.121) [-1388.593] (-1389.475) (-1387.113) -- 0:00:33 463000 -- (-1390.059) (-1390.792) [-1387.552] (-1388.891) * (-1389.274) (-1391.221) [-1390.424] (-1389.169) -- 0:00:33 463500 -- (-1388.094) [-1389.346] (-1387.267) (-1389.217) * [-1387.003] (-1386.993) (-1389.624) (-1387.226) -- 0:00:33 464000 -- (-1388.675) (-1390.307) [-1386.916] (-1387.486) * (-1388.583) (-1387.020) (-1389.338) [-1386.686] -- 0:00:33 464500 -- [-1387.979] (-1391.411) (-1387.469) (-1390.617) * (-1390.832) [-1386.619] (-1388.124) (-1386.887) -- 0:00:33 465000 -- [-1387.307] (-1388.688) (-1387.910) (-1389.903) * (-1391.536) [-1386.925] (-1389.305) (-1387.370) -- 0:00:33 Average standard deviation of split frequencies: 0.010509 465500 -- [-1388.913] (-1393.971) (-1387.603) (-1387.245) * (-1394.465) [-1386.903] (-1388.875) (-1389.121) -- 0:00:33 466000 -- (-1388.098) (-1388.872) [-1387.524] (-1388.562) * [-1386.334] (-1388.118) (-1387.976) (-1390.859) -- 0:00:33 466500 -- (-1389.552) (-1387.266) [-1389.637] (-1388.763) * [-1388.675] (-1386.172) (-1387.823) (-1388.180) -- 0:00:33 467000 -- (-1389.508) (-1388.577) [-1391.403] (-1390.672) * (-1387.394) (-1386.199) (-1389.701) [-1386.612] -- 0:00:34 467500 -- [-1388.585] (-1388.322) (-1390.184) (-1391.488) * [-1387.377] (-1386.351) (-1386.708) (-1386.628) -- 0:00:34 468000 -- (-1387.882) (-1387.379) [-1388.099] (-1391.120) * (-1387.178) [-1386.815] (-1389.056) (-1386.826) -- 0:00:34 468500 -- (-1388.455) [-1390.331] (-1388.355) (-1388.179) * [-1393.242] (-1388.268) (-1388.581) (-1389.474) -- 0:00:34 469000 -- (-1390.967) [-1387.930] (-1387.515) (-1388.254) * (-1390.256) (-1387.527) [-1386.827] (-1387.887) -- 0:00:33 469500 -- [-1387.508] (-1393.372) (-1386.999) (-1390.147) * (-1391.977) (-1388.199) [-1389.336] (-1390.275) -- 0:00:33 470000 -- (-1387.757) (-1388.882) (-1386.941) [-1388.732] * (-1389.026) (-1387.454) [-1387.302] (-1389.326) -- 0:00:33 Average standard deviation of split frequencies: 0.010906 470500 -- (-1386.705) (-1388.810) (-1387.192) [-1387.270] * [-1389.248] (-1388.166) (-1387.279) (-1392.458) -- 0:00:33 471000 -- (-1386.189) (-1391.173) (-1388.678) [-1386.973] * (-1390.996) [-1386.275] (-1387.725) (-1390.294) -- 0:00:33 471500 -- (-1391.518) (-1392.000) (-1387.317) [-1387.268] * (-1388.590) (-1386.687) [-1387.334] (-1392.179) -- 0:00:33 472000 -- (-1390.490) (-1389.133) [-1387.848] (-1388.645) * (-1388.942) (-1387.945) (-1389.029) [-1388.601] -- 0:00:33 472500 -- (-1389.448) (-1387.734) (-1388.175) [-1391.150] * (-1389.202) [-1387.646] (-1388.856) (-1390.469) -- 0:00:33 473000 -- (-1389.434) (-1386.155) [-1389.887] (-1391.346) * [-1391.853] (-1387.087) (-1388.733) (-1386.893) -- 0:00:33 473500 -- (-1388.400) [-1387.841] (-1392.079) (-1389.594) * [-1392.708] (-1389.354) (-1389.315) (-1387.188) -- 0:00:33 474000 -- (-1388.049) (-1388.245) [-1391.565] (-1388.032) * (-1391.186) (-1392.266) (-1388.757) [-1386.696] -- 0:00:33 474500 -- (-1388.855) [-1387.239] (-1395.853) (-1393.286) * (-1393.544) (-1389.773) (-1387.250) [-1386.751] -- 0:00:33 475000 -- (-1387.066) (-1388.375) (-1391.473) [-1389.474] * (-1392.732) [-1393.574] (-1388.525) (-1388.472) -- 0:00:33 Average standard deviation of split frequencies: 0.010619 475500 -- (-1388.303) (-1387.225) [-1391.134] (-1393.202) * (-1391.485) (-1389.282) (-1388.124) [-1389.123] -- 0:00:33 476000 -- [-1386.927] (-1387.583) (-1388.750) (-1389.894) * (-1387.353) (-1388.858) [-1387.029] (-1390.677) -- 0:00:33 476500 -- (-1387.506) (-1387.857) [-1390.832] (-1388.971) * (-1386.214) [-1390.720] (-1388.727) (-1388.523) -- 0:00:32 477000 -- (-1389.107) (-1387.345) (-1387.815) [-1390.035] * [-1387.253] (-1389.813) (-1393.861) (-1389.548) -- 0:00:32 477500 -- (-1388.542) (-1387.306) [-1388.958] (-1386.537) * (-1388.784) (-1390.490) (-1391.259) [-1389.137] -- 0:00:32 478000 -- (-1387.495) (-1392.384) [-1387.816] (-1388.504) * [-1390.026] (-1389.316) (-1392.823) (-1389.162) -- 0:00:32 478500 -- [-1386.964] (-1387.475) (-1387.577) (-1387.469) * (-1389.400) (-1388.275) [-1395.046] (-1388.111) -- 0:00:32 479000 -- (-1387.338) (-1389.970) (-1389.735) [-1388.473] * [-1390.049] (-1387.458) (-1396.809) (-1387.443) -- 0:00:32 479500 -- (-1390.248) (-1386.371) (-1389.885) [-1388.603] * [-1389.322] (-1390.864) (-1390.901) (-1389.258) -- 0:00:32 480000 -- (-1397.094) (-1387.404) [-1390.929] (-1388.489) * (-1386.658) (-1391.369) [-1388.184] (-1388.767) -- 0:00:32 Average standard deviation of split frequencies: 0.009692 480500 -- (-1390.922) (-1387.486) [-1386.664] (-1388.934) * (-1388.478) (-1391.020) (-1388.010) [-1392.409] -- 0:00:32 481000 -- (-1389.232) [-1388.109] (-1387.371) (-1388.456) * (-1386.623) [-1388.702] (-1388.781) (-1388.801) -- 0:00:32 481500 -- (-1388.825) (-1387.098) [-1387.972] (-1387.860) * (-1388.338) (-1388.453) [-1387.654] (-1388.589) -- 0:00:32 482000 -- (-1387.029) (-1387.979) [-1387.133] (-1389.996) * (-1388.225) [-1388.277] (-1387.625) (-1389.101) -- 0:00:32 482500 -- [-1386.875] (-1390.106) (-1388.637) (-1387.328) * [-1388.784] (-1388.429) (-1390.049) (-1387.809) -- 0:00:32 483000 -- (-1387.344) (-1388.594) [-1388.118] (-1387.911) * (-1387.032) (-1388.246) [-1390.032] (-1392.081) -- 0:00:33 483500 -- (-1387.467) [-1388.594] (-1387.684) (-1387.500) * (-1388.634) (-1390.317) [-1389.809] (-1392.244) -- 0:00:33 484000 -- [-1387.372] (-1388.592) (-1388.151) (-1388.048) * [-1389.497] (-1391.392) (-1389.170) (-1391.020) -- 0:00:33 484500 -- (-1387.747) [-1386.779] (-1389.865) (-1387.196) * (-1391.089) [-1389.168] (-1389.135) (-1386.940) -- 0:00:32 485000 -- (-1389.145) (-1388.288) (-1392.258) [-1389.072] * (-1388.853) [-1386.405] (-1389.285) (-1389.082) -- 0:00:32 Average standard deviation of split frequencies: 0.010441 485500 -- [-1388.013] (-1386.654) (-1387.636) (-1387.284) * [-1386.539] (-1387.176) (-1389.394) (-1389.170) -- 0:00:32 486000 -- (-1388.870) [-1389.596] (-1387.737) (-1387.039) * (-1387.549) (-1387.266) [-1388.508] (-1386.769) -- 0:00:32 486500 -- (-1391.626) (-1389.884) [-1391.467] (-1389.628) * (-1391.354) (-1391.066) (-1388.897) [-1388.399] -- 0:00:32 487000 -- [-1389.287] (-1387.869) (-1389.453) (-1388.597) * (-1388.847) (-1390.328) [-1387.821] (-1390.189) -- 0:00:32 487500 -- [-1391.178] (-1387.645) (-1388.797) (-1388.427) * (-1388.257) (-1388.862) [-1390.458] (-1391.417) -- 0:00:32 488000 -- (-1390.132) (-1387.463) [-1390.597] (-1388.488) * (-1390.881) (-1389.529) (-1392.847) [-1388.879] -- 0:00:32 488500 -- (-1388.874) (-1387.051) [-1389.995] (-1390.940) * [-1387.009] (-1397.795) (-1391.741) (-1394.560) -- 0:00:32 489000 -- [-1390.469] (-1387.075) (-1391.630) (-1390.317) * (-1393.386) (-1394.345) (-1391.745) [-1388.255] -- 0:00:32 489500 -- (-1392.283) (-1387.311) [-1391.056] (-1387.619) * (-1388.474) [-1389.253] (-1390.125) (-1388.527) -- 0:00:32 490000 -- (-1389.504) [-1388.048] (-1387.330) (-1386.169) * (-1388.939) (-1389.245) (-1387.607) [-1387.291] -- 0:00:32 Average standard deviation of split frequencies: 0.010229 490500 -- [-1392.881] (-1387.668) (-1395.006) (-1387.781) * [-1388.975] (-1387.413) (-1389.377) (-1386.561) -- 0:00:32 491000 -- (-1392.541) (-1389.121) (-1391.440) [-1387.771] * (-1389.420) [-1390.673] (-1387.059) (-1387.717) -- 0:00:32 491500 -- (-1388.087) (-1386.917) [-1388.535] (-1389.131) * [-1392.882] (-1387.511) (-1387.596) (-1390.219) -- 0:00:32 492000 -- (-1388.458) [-1388.185] (-1389.474) (-1390.912) * (-1387.343) [-1387.979] (-1387.057) (-1388.912) -- 0:00:32 492500 -- (-1388.160) [-1389.183] (-1390.912) (-1387.497) * (-1386.999) (-1386.354) [-1386.561] (-1389.872) -- 0:00:31 493000 -- (-1392.146) (-1386.609) (-1393.015) [-1387.941] * (-1388.918) (-1386.898) [-1387.110] (-1388.754) -- 0:00:31 493500 -- (-1390.113) (-1387.678) (-1393.709) [-1387.820] * (-1389.071) (-1388.064) (-1388.969) [-1388.116] -- 0:00:31 494000 -- (-1387.858) (-1387.604) (-1389.716) [-1387.564] * (-1386.865) [-1388.331] (-1389.395) (-1388.011) -- 0:00:31 494500 -- (-1389.984) [-1387.574] (-1390.642) (-1387.592) * (-1389.893) [-1389.864] (-1389.381) (-1387.971) -- 0:00:31 495000 -- [-1395.565] (-1391.358) (-1388.467) (-1389.042) * [-1388.153] (-1389.754) (-1386.773) (-1387.571) -- 0:00:31 Average standard deviation of split frequencies: 0.009840 495500 -- (-1393.001) (-1390.531) [-1388.821] (-1388.128) * (-1388.061) (-1388.950) (-1387.494) [-1386.403] -- 0:00:31 496000 -- (-1389.285) (-1389.813) (-1388.796) [-1388.578] * (-1391.606) (-1389.011) (-1387.717) [-1388.486] -- 0:00:31 496500 -- (-1395.420) (-1388.506) [-1388.127] (-1386.961) * [-1388.869] (-1391.732) (-1387.425) (-1395.257) -- 0:00:31 497000 -- (-1392.938) (-1386.396) (-1387.615) [-1387.112] * (-1387.337) [-1388.535] (-1387.191) (-1386.366) -- 0:00:31 497500 -- (-1388.951) [-1386.348] (-1387.277) (-1387.280) * (-1386.923) [-1389.710] (-1389.132) (-1386.568) -- 0:00:31 498000 -- (-1388.910) (-1387.625) [-1386.616] (-1387.441) * [-1386.915] (-1389.002) (-1391.347) (-1386.804) -- 0:00:31 498500 -- (-1386.521) (-1389.048) [-1386.327] (-1387.639) * (-1389.924) [-1390.915] (-1387.623) (-1387.278) -- 0:00:31 499000 -- (-1387.041) (-1387.911) (-1387.161) [-1386.671] * (-1390.782) (-1390.634) (-1387.056) [-1387.062] -- 0:00:32 499500 -- (-1388.927) (-1389.752) (-1387.082) [-1386.132] * (-1386.246) [-1389.587] (-1387.186) (-1387.347) -- 0:00:32 500000 -- [-1390.103] (-1388.990) (-1387.055) (-1386.313) * (-1387.520) [-1388.667] (-1389.513) (-1388.100) -- 0:00:32 Average standard deviation of split frequencies: 0.010856 500500 -- (-1387.352) (-1390.979) [-1387.666] (-1388.174) * (-1394.307) (-1390.187) [-1387.274] (-1388.255) -- 0:00:31 501000 -- (-1388.878) (-1387.598) [-1388.280] (-1392.064) * [-1392.081] (-1391.217) (-1387.523) (-1387.896) -- 0:00:31 501500 -- [-1390.305] (-1387.249) (-1388.316) (-1387.819) * (-1390.313) [-1388.592] (-1388.663) (-1388.582) -- 0:00:31 502000 -- (-1392.423) [-1386.808] (-1387.715) (-1386.483) * (-1387.789) (-1387.275) [-1387.458] (-1386.271) -- 0:00:31 502500 -- (-1386.631) [-1386.508] (-1387.239) (-1388.210) * (-1390.464) [-1388.376] (-1387.423) (-1387.483) -- 0:00:31 503000 -- (-1388.079) (-1386.265) [-1387.661] (-1388.305) * (-1388.739) [-1388.205] (-1387.386) (-1389.750) -- 0:00:31 503500 -- (-1388.077) (-1386.146) (-1392.013) [-1389.756] * (-1388.367) [-1390.847] (-1386.961) (-1389.452) -- 0:00:31 504000 -- (-1388.813) (-1386.546) [-1386.817] (-1392.171) * (-1387.590) (-1389.822) (-1387.724) [-1391.567] -- 0:00:31 504500 -- (-1388.755) [-1387.215] (-1387.327) (-1388.949) * (-1386.746) (-1392.050) (-1389.563) [-1388.686] -- 0:00:31 505000 -- (-1388.147) (-1387.279) (-1387.523) [-1387.915] * (-1390.244) (-1392.052) (-1388.382) [-1387.607] -- 0:00:31 Average standard deviation of split frequencies: 0.010193 505500 -- [-1389.516] (-1388.263) (-1387.252) (-1388.194) * (-1392.217) [-1387.239] (-1388.275) (-1390.901) -- 0:00:31 506000 -- (-1390.953) (-1392.164) [-1387.169] (-1388.152) * (-1391.767) (-1387.321) [-1388.846] (-1389.779) -- 0:00:31 506500 -- (-1389.096) (-1391.483) [-1386.713] (-1387.827) * (-1387.235) [-1388.618] (-1388.947) (-1390.979) -- 0:00:31 507000 -- (-1387.481) [-1387.120] (-1388.360) (-1389.774) * (-1388.644) (-1390.792) (-1392.348) [-1388.658] -- 0:00:31 507500 -- (-1388.040) [-1387.021] (-1388.359) (-1392.030) * (-1388.279) (-1394.931) (-1389.802) [-1389.732] -- 0:00:31 508000 -- [-1387.194] (-1386.945) (-1389.171) (-1387.326) * (-1388.662) (-1389.322) [-1386.259] (-1387.637) -- 0:00:30 508500 -- (-1387.422) (-1386.626) [-1388.496] (-1387.339) * [-1389.176] (-1387.233) (-1386.259) (-1387.782) -- 0:00:30 509000 -- (-1388.494) (-1387.375) (-1387.803) [-1388.464] * [-1387.768] (-1387.201) (-1389.987) (-1389.992) -- 0:00:30 509500 -- [-1388.997] (-1390.415) (-1387.828) (-1392.958) * (-1392.284) [-1388.102] (-1389.303) (-1387.118) -- 0:00:30 510000 -- (-1389.290) [-1388.448] (-1388.612) (-1388.846) * [-1388.168] (-1391.234) (-1388.269) (-1387.156) -- 0:00:30 Average standard deviation of split frequencies: 0.010100 510500 -- (-1389.858) (-1387.115) [-1389.121] (-1392.554) * (-1386.686) [-1388.586] (-1387.028) (-1392.819) -- 0:00:30 511000 -- (-1387.090) (-1386.394) [-1388.583] (-1388.690) * (-1386.397) (-1389.824) (-1388.628) [-1389.153] -- 0:00:30 511500 -- (-1388.501) (-1388.811) [-1387.145] (-1389.667) * (-1388.011) (-1389.629) (-1390.994) [-1388.522] -- 0:00:30 512000 -- (-1390.536) [-1388.538] (-1391.698) (-1390.603) * [-1387.770] (-1389.714) (-1387.963) (-1388.510) -- 0:00:30 512500 -- (-1387.703) (-1387.451) [-1391.535] (-1389.324) * (-1387.307) (-1386.464) (-1387.700) [-1387.024] -- 0:00:30 513000 -- (-1387.578) [-1389.054] (-1388.833) (-1389.239) * [-1386.908] (-1392.024) (-1386.756) (-1393.825) -- 0:00:30 513500 -- (-1387.288) [-1387.296] (-1390.463) (-1386.862) * [-1386.925] (-1393.122) (-1391.785) (-1389.942) -- 0:00:30 514000 -- [-1388.837] (-1390.743) (-1388.513) (-1391.553) * (-1388.811) (-1386.539) (-1392.151) [-1390.152] -- 0:00:30 514500 -- (-1388.789) (-1390.074) (-1389.040) [-1390.744] * (-1389.559) (-1390.762) (-1390.502) [-1389.759] -- 0:00:30 515000 -- (-1387.278) (-1389.463) [-1387.443] (-1389.158) * (-1386.808) [-1387.403] (-1388.599) (-1387.370) -- 0:00:31 Average standard deviation of split frequencies: 0.010157 515500 -- [-1387.365] (-1389.326) (-1388.158) (-1386.936) * (-1387.420) (-1388.299) (-1391.216) [-1387.515] -- 0:00:31 516000 -- (-1389.773) (-1387.583) [-1387.095] (-1386.768) * (-1387.708) [-1388.238] (-1389.667) (-1387.478) -- 0:00:30 516500 -- (-1390.303) [-1391.342] (-1387.029) (-1388.926) * (-1395.700) [-1389.609] (-1388.570) (-1390.027) -- 0:00:30 517000 -- (-1393.276) (-1395.036) [-1387.582] (-1392.290) * (-1387.060) (-1387.119) [-1387.395] (-1386.388) -- 0:00:30 517500 -- (-1389.756) (-1392.801) [-1388.574] (-1389.640) * (-1389.864) [-1387.077] (-1390.817) (-1386.111) -- 0:00:30 518000 -- (-1389.626) (-1390.929) (-1386.756) [-1390.127] * (-1389.476) (-1387.029) [-1390.092] (-1386.300) -- 0:00:30 518500 -- (-1390.662) [-1387.349] (-1387.770) (-1389.970) * (-1387.350) (-1392.045) [-1390.347] (-1387.500) -- 0:00:30 519000 -- (-1391.967) (-1388.161) (-1386.778) [-1390.622] * (-1388.372) (-1387.462) [-1388.187] (-1389.611) -- 0:00:30 519500 -- [-1392.725] (-1388.073) (-1386.725) (-1391.720) * (-1392.387) (-1386.817) (-1387.005) [-1387.280] -- 0:00:30 520000 -- [-1388.612] (-1388.442) (-1386.997) (-1394.881) * (-1387.961) [-1387.068] (-1387.944) (-1387.847) -- 0:00:30 Average standard deviation of split frequencies: 0.010013 520500 -- (-1388.665) (-1388.964) (-1386.919) [-1386.283] * [-1388.417] (-1388.536) (-1392.660) (-1388.930) -- 0:00:30 521000 -- (-1387.021) (-1390.820) [-1388.553] (-1386.780) * [-1388.535] (-1386.696) (-1394.681) (-1386.665) -- 0:00:30 521500 -- (-1386.550) [-1387.140] (-1389.523) (-1388.115) * (-1388.143) [-1387.062] (-1386.963) (-1387.663) -- 0:00:30 522000 -- (-1387.044) (-1390.137) (-1389.024) [-1386.958] * (-1387.279) (-1387.058) [-1388.305] (-1387.528) -- 0:00:30 522500 -- (-1387.115) (-1387.008) (-1389.314) [-1389.325] * (-1389.671) [-1387.466] (-1386.716) (-1387.856) -- 0:00:30 523000 -- (-1387.653) [-1386.103] (-1387.656) (-1387.597) * (-1387.872) [-1388.294] (-1387.389) (-1389.251) -- 0:00:30 523500 -- [-1388.204] (-1388.869) (-1387.316) (-1386.499) * (-1389.336) (-1389.395) [-1390.048] (-1388.938) -- 0:00:30 524000 -- (-1389.192) (-1386.750) (-1389.025) [-1388.262] * (-1387.049) [-1386.890] (-1389.618) (-1389.917) -- 0:00:29 524500 -- [-1388.356] (-1387.785) (-1389.777) (-1387.574) * (-1388.953) (-1387.469) (-1388.875) [-1391.565] -- 0:00:29 525000 -- (-1389.801) (-1397.158) (-1387.670) [-1387.548] * [-1387.490] (-1390.176) (-1391.462) (-1389.676) -- 0:00:29 Average standard deviation of split frequencies: 0.010491 525500 -- (-1388.513) [-1390.436] (-1388.917) (-1388.010) * (-1392.862) [-1391.929] (-1387.654) (-1390.134) -- 0:00:29 526000 -- (-1390.068) (-1393.160) [-1388.552] (-1388.499) * (-1388.400) (-1387.702) [-1386.570] (-1388.695) -- 0:00:29 526500 -- [-1387.826] (-1390.557) (-1391.197) (-1387.947) * (-1389.180) (-1387.639) [-1386.528] (-1387.967) -- 0:00:29 527000 -- (-1387.715) (-1391.917) [-1388.468] (-1387.182) * (-1388.598) (-1387.798) (-1386.530) [-1388.054] -- 0:00:29 527500 -- (-1393.983) [-1386.774] (-1388.052) (-1387.870) * [-1390.926] (-1389.018) (-1387.302) (-1388.338) -- 0:00:29 528000 -- (-1390.719) (-1388.639) [-1388.249] (-1389.626) * (-1390.473) (-1388.405) [-1387.067] (-1387.642) -- 0:00:29 528500 -- (-1392.815) [-1389.261] (-1390.830) (-1390.045) * [-1391.063] (-1387.926) (-1388.151) (-1387.155) -- 0:00:29 529000 -- (-1387.290) [-1387.965] (-1388.830) (-1387.291) * [-1387.591] (-1387.293) (-1386.755) (-1387.795) -- 0:00:29 529500 -- [-1388.644] (-1386.986) (-1388.024) (-1389.921) * [-1388.760] (-1390.172) (-1387.317) (-1387.349) -- 0:00:29 530000 -- [-1387.038] (-1388.787) (-1387.481) (-1390.475) * (-1389.852) [-1387.591] (-1387.672) (-1387.108) -- 0:00:29 Average standard deviation of split frequencies: 0.011078 530500 -- [-1387.044] (-1387.723) (-1387.481) (-1387.643) * (-1390.668) (-1386.522) [-1386.228] (-1387.872) -- 0:00:29 531000 -- (-1387.188) [-1388.802] (-1387.346) (-1387.250) * [-1388.285] (-1388.389) (-1389.033) (-1391.599) -- 0:00:30 531500 -- (-1386.709) (-1387.404) [-1386.983] (-1387.055) * (-1387.810) [-1386.289] (-1387.491) (-1393.318) -- 0:00:29 532000 -- (-1386.732) (-1387.681) (-1388.085) [-1386.421] * [-1387.072] (-1388.003) (-1387.216) (-1392.213) -- 0:00:29 532500 -- (-1387.415) (-1391.704) (-1386.727) [-1387.308] * (-1390.368) (-1388.171) [-1387.035] (-1389.201) -- 0:00:29 533000 -- (-1387.838) (-1392.334) (-1389.370) [-1386.991] * [-1387.619] (-1388.276) (-1387.509) (-1388.531) -- 0:00:29 533500 -- [-1387.987] (-1388.877) (-1387.563) (-1391.337) * (-1386.872) (-1387.320) (-1387.291) [-1390.066] -- 0:00:29 534000 -- (-1386.777) (-1392.391) [-1387.414] (-1390.451) * (-1389.797) [-1388.133] (-1386.591) (-1388.929) -- 0:00:29 534500 -- (-1387.164) [-1393.129] (-1388.282) (-1393.770) * (-1389.094) [-1388.217] (-1387.831) (-1387.058) -- 0:00:29 535000 -- [-1387.048] (-1387.163) (-1389.080) (-1388.570) * (-1386.945) [-1387.130] (-1389.288) (-1391.143) -- 0:00:29 Average standard deviation of split frequencies: 0.011336 535500 -- (-1392.597) (-1387.446) (-1387.383) [-1388.232] * (-1386.669) [-1389.550] (-1389.211) (-1388.113) -- 0:00:29 536000 -- [-1390.984] (-1388.806) (-1387.217) (-1387.997) * (-1389.588) [-1392.545] (-1390.150) (-1390.452) -- 0:00:29 536500 -- [-1396.822] (-1389.212) (-1391.668) (-1388.772) * (-1388.611) (-1387.898) (-1389.893) [-1391.996] -- 0:00:29 537000 -- [-1388.917] (-1388.610) (-1395.031) (-1389.160) * [-1387.299] (-1387.536) (-1390.374) (-1389.838) -- 0:00:29 537500 -- [-1386.998] (-1388.287) (-1391.705) (-1387.432) * (-1386.859) (-1388.315) (-1388.662) [-1389.309] -- 0:00:29 538000 -- (-1387.430) (-1389.951) [-1387.162] (-1387.477) * (-1387.801) (-1388.679) (-1391.645) [-1388.083] -- 0:00:29 538500 -- (-1387.460) [-1387.010] (-1387.236) (-1388.947) * (-1392.526) (-1391.076) [-1389.336] (-1387.457) -- 0:00:29 539000 -- (-1390.347) [-1388.570] (-1388.197) (-1386.236) * (-1387.739) [-1389.535] (-1387.553) (-1386.442) -- 0:00:29 539500 -- (-1388.604) (-1389.114) (-1388.748) [-1386.617] * (-1386.855) (-1387.759) [-1387.508] (-1388.234) -- 0:00:29 540000 -- (-1388.624) [-1389.319] (-1388.088) (-1386.617) * (-1386.993) [-1387.978] (-1391.263) (-1386.923) -- 0:00:28 Average standard deviation of split frequencies: 0.011383 540500 -- (-1392.141) (-1387.801) [-1387.912] (-1386.550) * (-1387.558) (-1389.724) [-1387.346] (-1387.523) -- 0:00:28 541000 -- (-1392.197) (-1387.127) [-1389.857] (-1387.392) * (-1390.569) (-1389.681) (-1388.926) [-1388.542] -- 0:00:28 541500 -- (-1390.674) [-1386.913] (-1388.291) (-1390.151) * (-1387.589) (-1387.947) (-1387.551) [-1387.176] -- 0:00:28 542000 -- (-1387.838) (-1387.721) [-1386.881] (-1386.899) * [-1387.152] (-1391.061) (-1389.393) (-1388.576) -- 0:00:28 542500 -- (-1389.148) (-1388.287) [-1387.989] (-1387.021) * (-1388.444) (-1389.060) [-1390.681] (-1388.831) -- 0:00:28 543000 -- (-1392.749) (-1387.586) [-1386.702] (-1391.029) * (-1389.307) (-1387.849) (-1388.471) [-1391.822] -- 0:00:28 543500 -- (-1387.160) (-1388.870) (-1388.301) [-1386.782] * (-1387.498) [-1387.376] (-1389.659) (-1391.509) -- 0:00:28 544000 -- (-1391.656) (-1387.157) [-1388.535] (-1389.355) * (-1390.640) [-1386.502] (-1388.798) (-1392.123) -- 0:00:28 544500 -- [-1388.874] (-1387.161) (-1387.189) (-1388.352) * [-1389.421] (-1386.533) (-1391.212) (-1388.800) -- 0:00:28 545000 -- (-1388.592) (-1388.091) [-1387.303] (-1390.417) * (-1389.080) [-1387.962] (-1386.940) (-1388.012) -- 0:00:28 Average standard deviation of split frequencies: 0.010868 545500 -- [-1387.854] (-1391.485) (-1391.528) (-1388.614) * (-1388.150) (-1389.735) (-1387.783) [-1388.203] -- 0:00:28 546000 -- (-1389.908) (-1388.841) (-1393.476) [-1390.917] * [-1389.127] (-1388.100) (-1387.697) (-1390.517) -- 0:00:28 546500 -- [-1387.941] (-1389.468) (-1387.197) (-1391.273) * (-1387.604) (-1388.240) (-1391.894) [-1387.257] -- 0:00:28 547000 -- (-1387.823) [-1388.595] (-1388.229) (-1389.519) * (-1390.069) (-1388.978) (-1388.098) [-1388.741] -- 0:00:28 547500 -- (-1390.030) (-1388.109) [-1389.978] (-1387.453) * (-1389.728) (-1391.299) (-1388.094) [-1388.939] -- 0:00:28 548000 -- (-1400.767) (-1389.889) (-1389.647) [-1389.943] * (-1388.708) [-1388.962] (-1388.591) (-1387.886) -- 0:00:28 548500 -- (-1395.321) [-1391.613] (-1389.401) (-1388.078) * (-1388.482) [-1387.568] (-1390.398) (-1387.884) -- 0:00:28 549000 -- [-1389.446] (-1387.355) (-1390.102) (-1389.865) * (-1387.071) (-1386.859) [-1390.189] (-1386.452) -- 0:00:28 549500 -- (-1390.284) [-1387.653] (-1389.031) (-1389.064) * (-1386.670) [-1388.435] (-1389.942) (-1387.392) -- 0:00:28 550000 -- (-1387.551) (-1390.558) (-1388.360) [-1387.332] * (-1387.858) [-1388.378] (-1389.641) (-1386.886) -- 0:00:28 Average standard deviation of split frequencies: 0.011783 550500 -- (-1388.186) (-1390.458) [-1386.423] (-1390.081) * (-1388.875) (-1389.877) [-1387.658] (-1387.277) -- 0:00:28 551000 -- (-1387.467) (-1391.785) [-1387.005] (-1393.856) * (-1387.836) [-1389.017] (-1387.324) (-1387.071) -- 0:00:28 551500 -- (-1386.747) (-1390.491) (-1391.573) [-1389.165] * [-1389.259] (-1386.171) (-1390.222) (-1391.463) -- 0:00:28 552000 -- (-1391.999) (-1389.935) (-1388.656) [-1390.112] * (-1388.914) (-1387.132) (-1387.911) [-1389.058] -- 0:00:28 552500 -- (-1393.991) (-1389.848) [-1386.506] (-1388.982) * (-1387.753) (-1387.897) (-1388.017) [-1388.141] -- 0:00:28 553000 -- (-1392.107) [-1388.837] (-1390.052) (-1389.334) * (-1387.601) (-1388.569) (-1388.961) [-1390.009] -- 0:00:28 553500 -- (-1389.531) [-1386.644] (-1389.954) (-1387.986) * (-1386.915) (-1388.434) (-1392.481) [-1388.625] -- 0:00:28 554000 -- (-1387.136) (-1387.198) (-1389.891) [-1388.074] * (-1386.915) (-1389.353) [-1389.494] (-1388.158) -- 0:00:28 554500 -- (-1389.274) (-1387.197) (-1387.054) [-1390.617] * (-1389.529) (-1387.751) [-1391.548] (-1389.070) -- 0:00:28 555000 -- (-1390.072) (-1388.012) (-1388.895) [-1388.668] * (-1394.348) [-1388.297] (-1391.282) (-1390.276) -- 0:00:28 Average standard deviation of split frequencies: 0.011521 555500 -- (-1386.830) (-1387.515) (-1388.396) [-1387.065] * (-1391.946) (-1388.430) [-1387.017] (-1388.466) -- 0:00:28 556000 -- (-1386.580) [-1388.552] (-1389.040) (-1388.240) * (-1390.958) (-1387.682) (-1387.271) [-1391.511] -- 0:00:27 556500 -- [-1386.425] (-1389.645) (-1389.162) (-1390.060) * [-1391.097] (-1387.879) (-1393.868) (-1396.535) -- 0:00:27 557000 -- (-1387.954) (-1391.365) [-1387.021] (-1389.759) * (-1386.925) [-1388.612] (-1389.484) (-1388.021) -- 0:00:27 557500 -- (-1386.862) (-1387.949) [-1386.296] (-1387.461) * (-1389.942) (-1386.789) [-1391.754] (-1388.006) -- 0:00:27 558000 -- (-1386.958) (-1390.528) [-1389.319] (-1388.694) * (-1389.786) [-1387.872] (-1390.445) (-1388.119) -- 0:00:27 558500 -- (-1386.880) (-1387.210) (-1388.702) [-1388.787] * (-1391.236) (-1386.786) [-1388.552] (-1390.499) -- 0:00:27 559000 -- [-1387.179] (-1387.253) (-1386.878) (-1394.568) * (-1386.686) [-1387.214] (-1388.041) (-1387.158) -- 0:00:27 559500 -- [-1386.256] (-1391.231) (-1387.358) (-1394.668) * (-1388.659) [-1388.662] (-1393.657) (-1386.002) -- 0:00:27 560000 -- (-1388.964) [-1386.974] (-1391.709) (-1394.878) * (-1390.523) [-1387.004] (-1386.622) (-1387.994) -- 0:00:27 Average standard deviation of split frequencies: 0.011958 560500 -- (-1389.100) [-1386.793] (-1389.460) (-1388.437) * (-1388.455) (-1392.359) [-1391.901] (-1389.411) -- 0:00:27 561000 -- (-1388.422) (-1388.504) [-1387.059] (-1389.752) * (-1389.735) (-1388.180) (-1390.341) [-1387.812] -- 0:00:27 561500 -- (-1387.297) [-1388.225] (-1387.941) (-1388.198) * (-1387.354) (-1389.933) (-1391.191) [-1386.415] -- 0:00:27 562000 -- [-1387.379] (-1387.373) (-1387.767) (-1388.354) * (-1391.599) [-1389.324] (-1388.249) (-1387.387) -- 0:00:27 562500 -- [-1390.283] (-1387.289) (-1391.056) (-1389.176) * (-1388.139) (-1391.079) [-1387.845] (-1395.262) -- 0:00:27 563000 -- [-1388.553] (-1392.588) (-1388.236) (-1387.932) * (-1389.310) (-1393.599) [-1387.302] (-1389.160) -- 0:00:27 563500 -- (-1387.112) (-1389.175) [-1387.289] (-1387.188) * (-1387.707) (-1388.776) [-1387.282] (-1387.992) -- 0:00:27 564000 -- (-1389.146) (-1389.996) (-1390.935) [-1392.111] * (-1388.332) (-1387.841) [-1388.102] (-1395.196) -- 0:00:27 564500 -- (-1388.955) (-1390.054) (-1390.037) [-1387.359] * (-1386.640) (-1388.899) [-1388.513] (-1394.287) -- 0:00:27 565000 -- (-1389.367) (-1389.337) [-1388.347] (-1387.061) * [-1386.650] (-1389.466) (-1391.880) (-1390.364) -- 0:00:27 Average standard deviation of split frequencies: 0.011059 565500 -- (-1390.712) [-1388.064] (-1387.637) (-1387.138) * [-1389.041] (-1390.348) (-1387.880) (-1391.223) -- 0:00:27 566000 -- (-1390.003) [-1388.537] (-1390.402) (-1387.267) * [-1389.037] (-1389.102) (-1388.393) (-1390.720) -- 0:00:27 566500 -- (-1390.787) (-1389.747) [-1389.109] (-1386.468) * (-1391.263) (-1389.016) [-1390.264] (-1389.812) -- 0:00:27 567000 -- (-1390.137) (-1390.854) (-1389.800) [-1389.782] * (-1388.205) (-1390.998) (-1390.992) [-1387.358] -- 0:00:27 567500 -- (-1389.441) (-1386.410) [-1389.360] (-1394.686) * (-1388.476) (-1390.157) [-1387.952] (-1389.165) -- 0:00:27 568000 -- (-1390.593) (-1388.473) [-1387.602] (-1390.058) * [-1387.672] (-1388.868) (-1389.279) (-1392.011) -- 0:00:27 568500 -- (-1390.522) [-1386.176] (-1387.256) (-1386.408) * (-1394.049) [-1387.902] (-1387.017) (-1387.275) -- 0:00:27 569000 -- [-1388.278] (-1388.516) (-1390.652) (-1386.710) * (-1392.729) [-1388.912] (-1387.819) (-1387.745) -- 0:00:27 569500 -- (-1393.186) (-1387.477) (-1388.342) [-1386.969] * (-1388.181) [-1389.143] (-1389.308) (-1387.899) -- 0:00:27 570000 -- (-1387.525) (-1391.557) [-1387.875] (-1388.108) * (-1388.959) (-1389.444) [-1387.811] (-1389.494) -- 0:00:27 Average standard deviation of split frequencies: 0.011198 570500 -- [-1389.676] (-1396.855) (-1386.332) (-1386.605) * (-1388.960) (-1387.894) [-1387.465] (-1387.814) -- 0:00:27 571000 -- (-1388.298) [-1390.705] (-1386.333) (-1392.726) * (-1387.879) (-1386.351) (-1387.274) [-1387.702] -- 0:00:27 571500 -- (-1388.792) [-1389.298] (-1388.653) (-1386.455) * [-1386.478] (-1386.946) (-1390.263) (-1387.579) -- 0:00:26 572000 -- (-1390.215) (-1389.102) (-1388.332) [-1388.706] * (-1390.898) (-1387.165) [-1387.525] (-1387.436) -- 0:00:26 572500 -- [-1389.124] (-1387.853) (-1388.604) (-1391.348) * [-1386.093] (-1386.305) (-1387.354) (-1389.330) -- 0:00:26 573000 -- (-1393.540) (-1388.046) (-1391.241) [-1391.162] * (-1390.318) (-1386.943) (-1389.229) [-1394.971] -- 0:00:26 573500 -- [-1390.708] (-1389.913) (-1389.320) (-1387.519) * [-1387.436] (-1390.819) (-1391.345) (-1390.758) -- 0:00:26 574000 -- (-1390.714) (-1388.112) (-1392.015) [-1388.871] * (-1387.789) (-1389.259) (-1391.680) [-1388.380] -- 0:00:26 574500 -- (-1397.062) [-1392.190] (-1387.439) (-1388.977) * (-1387.789) [-1388.426] (-1388.179) (-1388.888) -- 0:00:26 575000 -- (-1388.795) [-1390.358] (-1387.676) (-1387.899) * [-1389.631] (-1387.742) (-1386.680) (-1389.124) -- 0:00:26 Average standard deviation of split frequencies: 0.012035 575500 -- (-1388.330) [-1387.294] (-1389.599) (-1388.696) * (-1387.428) [-1389.833] (-1387.818) (-1388.377) -- 0:00:26 576000 -- (-1388.003) [-1388.770] (-1388.670) (-1390.244) * (-1388.212) (-1389.440) [-1386.743] (-1388.026) -- 0:00:26 576500 -- (-1387.535) (-1386.960) [-1390.643] (-1391.880) * [-1388.423] (-1388.074) (-1386.351) (-1391.058) -- 0:00:26 577000 -- (-1387.210) [-1389.168] (-1387.267) (-1394.017) * [-1389.822] (-1391.538) (-1390.999) (-1389.126) -- 0:00:26 577500 -- (-1386.905) (-1388.278) [-1389.259] (-1389.547) * [-1387.558] (-1395.560) (-1389.510) (-1392.200) -- 0:00:26 578000 -- (-1389.136) (-1388.099) [-1386.454] (-1388.278) * (-1387.542) (-1387.780) (-1389.061) [-1388.624] -- 0:00:26 578500 -- (-1387.296) (-1389.353) [-1386.564] (-1388.770) * (-1388.129) (-1387.177) (-1387.246) [-1389.573] -- 0:00:26 579000 -- (-1387.045) (-1387.505) (-1387.311) [-1387.933] * (-1396.954) (-1389.035) (-1389.067) [-1388.042] -- 0:00:26 579500 -- [-1386.632] (-1388.746) (-1387.862) (-1392.336) * (-1387.443) (-1391.182) [-1389.280] (-1388.213) -- 0:00:26 580000 -- [-1386.697] (-1392.546) (-1392.436) (-1399.204) * (-1386.412) (-1390.523) [-1388.285] (-1388.474) -- 0:00:26 Average standard deviation of split frequencies: 0.011604 580500 -- (-1387.893) [-1388.383] (-1389.446) (-1395.018) * (-1389.662) (-1386.568) [-1389.659] (-1392.741) -- 0:00:26 581000 -- [-1386.976] (-1388.066) (-1388.715) (-1389.326) * (-1390.577) (-1389.470) [-1386.647] (-1389.102) -- 0:00:26 581500 -- (-1387.806) (-1388.893) [-1387.393] (-1388.511) * (-1387.635) [-1388.781] (-1388.691) (-1386.895) -- 0:00:26 582000 -- (-1389.072) (-1391.770) [-1388.129] (-1389.349) * (-1387.037) (-1387.931) (-1388.675) [-1387.072] -- 0:00:26 582500 -- (-1388.627) (-1391.301) (-1386.679) [-1388.821] * [-1386.488] (-1387.679) (-1390.419) (-1387.497) -- 0:00:26 583000 -- (-1389.539) (-1390.534) (-1391.337) [-1387.315] * [-1386.514] (-1387.643) (-1389.885) (-1392.916) -- 0:00:26 583500 -- (-1386.832) (-1388.476) [-1388.540] (-1386.788) * [-1387.317] (-1390.657) (-1386.419) (-1388.441) -- 0:00:26 584000 -- [-1390.287] (-1387.085) (-1389.241) (-1386.228) * (-1389.522) (-1388.646) [-1386.812] (-1387.086) -- 0:00:26 584500 -- [-1386.833] (-1387.964) (-1388.427) (-1387.696) * (-1390.771) [-1387.938] (-1387.984) (-1389.992) -- 0:00:26 585000 -- (-1386.932) [-1387.162] (-1388.388) (-1387.323) * (-1388.886) [-1387.270] (-1393.243) (-1388.389) -- 0:00:26 Average standard deviation of split frequencies: 0.011499 585500 -- (-1388.202) (-1390.476) [-1386.551] (-1386.966) * (-1387.445) (-1386.982) (-1386.967) [-1389.995] -- 0:00:26 586000 -- (-1391.769) (-1389.854) (-1386.753) [-1387.844] * (-1387.854) (-1391.236) [-1387.683] (-1394.001) -- 0:00:26 586500 -- (-1391.535) (-1387.623) [-1387.132] (-1388.268) * (-1388.147) [-1386.535] (-1386.092) (-1388.753) -- 0:00:26 587000 -- (-1387.571) (-1388.212) (-1387.049) [-1388.278] * [-1387.656] (-1387.634) (-1386.764) (-1387.992) -- 0:00:26 587500 -- (-1387.200) [-1390.172] (-1386.688) (-1387.274) * (-1387.824) [-1386.850] (-1390.517) (-1390.304) -- 0:00:25 588000 -- [-1388.659] (-1390.625) (-1387.984) (-1390.582) * (-1395.748) [-1386.159] (-1388.087) (-1389.955) -- 0:00:25 588500 -- (-1389.045) (-1387.857) [-1387.414] (-1387.437) * [-1386.951] (-1387.902) (-1388.771) (-1389.593) -- 0:00:25 589000 -- (-1387.027) (-1389.367) [-1388.359] (-1387.470) * (-1390.358) (-1390.971) [-1388.450] (-1387.442) -- 0:00:25 589500 -- (-1386.859) [-1387.321] (-1386.588) (-1386.709) * (-1387.758) (-1389.806) [-1387.898] (-1387.990) -- 0:00:25 590000 -- (-1386.740) [-1387.466] (-1389.475) (-1388.651) * (-1386.539) (-1389.944) (-1387.282) [-1390.438] -- 0:00:25 Average standard deviation of split frequencies: 0.011784 590500 -- [-1387.048] (-1386.999) (-1389.512) (-1388.664) * [-1388.108] (-1390.793) (-1387.548) (-1389.892) -- 0:00:25 591000 -- (-1388.483) (-1390.744) [-1387.763] (-1387.379) * (-1388.429) (-1389.389) [-1386.636] (-1386.935) -- 0:00:25 591500 -- (-1393.466) [-1386.452] (-1387.406) (-1388.297) * (-1395.963) (-1389.062) [-1386.898] (-1386.507) -- 0:00:25 592000 -- (-1392.363) [-1386.790] (-1389.879) (-1388.468) * (-1388.648) (-1388.939) [-1386.615] (-1387.375) -- 0:00:25 592500 -- (-1391.184) (-1386.622) (-1389.443) [-1387.307] * (-1393.454) (-1388.806) [-1387.902] (-1390.079) -- 0:00:25 593000 -- (-1387.091) (-1388.057) (-1390.660) [-1387.118] * (-1392.541) (-1389.607) (-1387.229) [-1389.294] -- 0:00:25 593500 -- (-1389.661) (-1386.629) [-1388.559] (-1386.644) * (-1389.590) (-1388.621) [-1390.017] (-1388.966) -- 0:00:25 594000 -- (-1391.143) [-1389.481] (-1389.008) (-1386.425) * [-1390.851] (-1388.059) (-1388.121) (-1388.515) -- 0:00:25 594500 -- (-1388.729) (-1388.127) (-1388.257) [-1386.444] * (-1389.827) (-1386.797) (-1387.263) [-1387.147] -- 0:00:25 595000 -- (-1391.247) [-1388.431] (-1386.992) (-1386.409) * [-1386.893] (-1389.817) (-1390.651) (-1387.061) -- 0:00:25 Average standard deviation of split frequencies: 0.012236 595500 -- [-1387.632] (-1389.082) (-1387.077) (-1389.310) * (-1388.359) [-1387.901] (-1392.712) (-1390.806) -- 0:00:25 596000 -- (-1387.086) (-1387.292) (-1386.726) [-1390.977] * (-1387.859) [-1387.297] (-1391.025) (-1392.097) -- 0:00:25 596500 -- [-1387.086] (-1386.949) (-1388.983) (-1387.239) * (-1388.160) [-1386.883] (-1387.814) (-1391.916) -- 0:00:25 597000 -- (-1390.512) (-1387.079) [-1388.725] (-1386.944) * [-1388.258] (-1388.041) (-1388.501) (-1394.696) -- 0:00:25 597500 -- (-1389.358) [-1386.884] (-1388.207) (-1389.351) * (-1388.431) (-1386.650) (-1387.041) [-1390.913] -- 0:00:25 598000 -- (-1389.090) [-1386.691] (-1386.166) (-1392.631) * (-1389.001) (-1386.434) (-1386.930) [-1386.718] -- 0:00:25 598500 -- (-1388.892) (-1386.434) [-1387.714] (-1387.540) * (-1387.560) (-1388.897) [-1390.115] (-1388.475) -- 0:00:25 599000 -- (-1388.156) [-1388.323] (-1386.949) (-1391.720) * (-1388.913) (-1386.866) (-1389.815) [-1388.237] -- 0:00:25 599500 -- (-1392.921) (-1389.776) (-1386.886) [-1387.453] * (-1387.511) (-1386.223) (-1388.687) [-1387.945] -- 0:00:25 600000 -- (-1388.550) (-1392.691) [-1386.750] (-1392.224) * (-1390.718) (-1388.564) (-1386.620) [-1388.953] -- 0:00:25 Average standard deviation of split frequencies: 0.011527 600500 -- (-1389.510) (-1388.940) (-1386.802) [-1387.895] * (-1393.755) (-1392.356) [-1388.074] (-1389.194) -- 0:00:25 601000 -- (-1386.243) (-1391.425) [-1388.532] (-1388.649) * (-1388.145) (-1391.788) (-1388.368) [-1388.618] -- 0:00:25 601500 -- [-1386.649] (-1386.340) (-1388.323) (-1389.477) * (-1387.533) [-1391.660] (-1388.604) (-1390.393) -- 0:00:25 602000 -- [-1387.329] (-1387.168) (-1387.867) (-1390.946) * (-1388.717) (-1390.128) (-1389.527) [-1388.727] -- 0:00:25 602500 -- (-1395.286) [-1388.050] (-1389.531) (-1394.303) * (-1391.910) (-1389.115) (-1388.188) [-1387.425] -- 0:00:25 603000 -- (-1389.212) (-1388.106) (-1389.196) [-1389.428] * [-1387.302] (-1388.275) (-1387.569) (-1387.693) -- 0:00:25 603500 -- (-1388.998) [-1388.369] (-1389.590) (-1389.413) * (-1386.698) [-1388.962] (-1388.727) (-1388.448) -- 0:00:24 604000 -- (-1389.125) [-1388.250] (-1387.740) (-1393.014) * (-1390.388) (-1389.277) (-1390.114) [-1389.060] -- 0:00:24 604500 -- (-1387.987) (-1391.664) (-1387.039) [-1387.271] * (-1389.171) [-1388.573] (-1388.577) (-1389.226) -- 0:00:24 605000 -- [-1389.691] (-1386.929) (-1387.164) (-1389.300) * (-1390.838) (-1388.601) (-1389.245) [-1387.768] -- 0:00:24 Average standard deviation of split frequencies: 0.011134 605500 -- [-1387.084] (-1387.101) (-1387.999) (-1388.502) * (-1388.043) [-1394.159] (-1388.943) (-1388.831) -- 0:00:24 606000 -- (-1386.842) (-1389.152) [-1387.635] (-1395.910) * (-1386.957) (-1386.959) (-1387.533) [-1386.839] -- 0:00:24 606500 -- (-1390.314) (-1387.079) [-1386.246] (-1397.588) * (-1387.134) (-1389.903) [-1394.067] (-1388.468) -- 0:00:24 607000 -- (-1389.761) [-1387.663] (-1387.511) (-1386.752) * (-1388.065) (-1391.531) (-1390.456) [-1388.832] -- 0:00:24 607500 -- (-1390.561) (-1389.507) (-1388.948) [-1387.270] * (-1388.812) (-1392.860) [-1386.833] (-1389.798) -- 0:00:24 608000 -- [-1389.436] (-1387.319) (-1387.786) (-1387.616) * [-1386.333] (-1389.622) (-1390.843) (-1387.581) -- 0:00:24 608500 -- (-1388.473) (-1387.718) (-1387.714) [-1386.780] * (-1386.362) (-1386.486) (-1388.917) [-1388.391] -- 0:00:24 609000 -- (-1390.029) (-1388.238) (-1387.833) [-1387.913] * [-1390.446] (-1387.267) (-1388.146) (-1387.075) -- 0:00:24 609500 -- (-1389.987) [-1387.028] (-1392.493) (-1387.662) * (-1388.087) (-1387.299) [-1389.633] (-1389.695) -- 0:00:24 610000 -- (-1391.663) [-1386.803] (-1386.751) (-1388.294) * [-1387.864] (-1386.395) (-1387.364) (-1390.771) -- 0:00:24 Average standard deviation of split frequencies: 0.011443 610500 -- (-1386.632) (-1386.456) (-1390.585) [-1392.654] * [-1390.447] (-1386.679) (-1387.642) (-1388.797) -- 0:00:24 611000 -- (-1389.359) (-1386.541) (-1388.996) [-1390.575] * [-1391.048] (-1390.889) (-1392.331) (-1388.209) -- 0:00:24 611500 -- (-1388.159) (-1387.317) [-1390.280] (-1387.414) * (-1389.352) (-1387.039) (-1393.863) [-1387.544] -- 0:00:24 612000 -- [-1387.261] (-1386.719) (-1387.277) (-1386.492) * (-1387.991) (-1387.593) [-1390.245] (-1387.669) -- 0:00:24 612500 -- [-1389.364] (-1390.916) (-1387.640) (-1386.477) * [-1386.811] (-1387.343) (-1387.960) (-1393.799) -- 0:00:24 613000 -- (-1387.206) (-1386.608) [-1387.089] (-1387.682) * [-1386.926] (-1390.526) (-1388.898) (-1390.451) -- 0:00:24 613500 -- (-1388.533) [-1388.071] (-1391.390) (-1387.238) * (-1388.321) [-1388.275] (-1388.010) (-1389.715) -- 0:00:24 614000 -- (-1388.146) (-1386.673) (-1390.185) [-1387.765] * (-1388.188) (-1390.695) [-1390.138] (-1387.858) -- 0:00:24 614500 -- (-1386.064) [-1387.456] (-1387.829) (-1386.250) * (-1389.484) (-1388.783) [-1388.400] (-1390.053) -- 0:00:24 615000 -- (-1386.143) (-1386.520) (-1391.438) [-1389.511] * (-1387.241) (-1386.954) (-1387.907) [-1388.625] -- 0:00:24 Average standard deviation of split frequencies: 0.010953 615500 -- [-1387.258] (-1387.077) (-1388.210) (-1390.325) * (-1387.167) (-1388.573) [-1386.218] (-1387.944) -- 0:00:24 616000 -- (-1387.103) (-1388.630) [-1386.286] (-1393.824) * (-1387.114) (-1391.946) (-1388.100) [-1387.802] -- 0:00:24 616500 -- (-1386.463) (-1389.155) [-1387.085] (-1394.957) * (-1387.847) (-1389.128) (-1389.515) [-1390.489] -- 0:00:24 617000 -- (-1387.351) (-1387.288) (-1386.639) [-1392.406] * [-1389.077] (-1391.637) (-1388.252) (-1391.984) -- 0:00:24 617500 -- (-1387.596) (-1389.905) (-1389.087) [-1390.280] * (-1390.369) (-1391.662) (-1390.121) [-1392.111] -- 0:00:24 618000 -- [-1386.676] (-1392.983) (-1390.218) (-1389.951) * (-1388.998) (-1391.489) (-1389.258) [-1388.759] -- 0:00:24 618500 -- (-1388.370) (-1391.255) (-1387.782) [-1389.848] * (-1389.632) (-1393.557) [-1390.510] (-1387.505) -- 0:00:24 619000 -- (-1388.096) [-1388.227] (-1389.469) (-1386.321) * (-1390.068) (-1387.328) (-1388.868) [-1387.667] -- 0:00:24 619500 -- (-1389.885) [-1386.440] (-1389.681) (-1386.087) * (-1388.633) [-1387.988] (-1388.575) (-1386.095) -- 0:00:23 620000 -- [-1389.878] (-1389.424) (-1387.079) (-1387.949) * (-1390.569) [-1387.272] (-1387.602) (-1386.328) -- 0:00:23 Average standard deviation of split frequencies: 0.011108 620500 -- (-1389.829) (-1389.664) (-1387.619) [-1389.218] * (-1390.801) (-1386.992) [-1390.370] (-1390.756) -- 0:00:23 621000 -- (-1389.744) (-1387.535) [-1386.968] (-1387.751) * (-1389.090) (-1388.071) (-1389.986) [-1390.299] -- 0:00:23 621500 -- (-1390.225) (-1389.588) [-1387.073] (-1387.831) * (-1388.027) (-1387.487) (-1389.647) [-1386.910] -- 0:00:23 622000 -- [-1387.603] (-1392.454) (-1386.307) (-1390.508) * (-1393.036) (-1387.852) [-1389.447] (-1388.415) -- 0:00:23 622500 -- (-1389.316) [-1387.529] (-1388.011) (-1388.018) * (-1389.864) (-1390.321) (-1391.031) [-1386.812] -- 0:00:23 623000 -- (-1389.843) [-1386.616] (-1389.376) (-1393.594) * (-1390.848) (-1388.689) [-1388.073] (-1388.392) -- 0:00:23 623500 -- (-1394.322) [-1387.895] (-1388.823) (-1386.940) * (-1391.601) (-1386.895) (-1387.919) [-1389.049] -- 0:00:23 624000 -- (-1388.802) [-1388.387] (-1390.980) (-1388.232) * (-1392.418) (-1386.979) [-1390.546] (-1387.902) -- 0:00:23 624500 -- (-1391.079) (-1393.259) (-1390.796) [-1387.576] * (-1388.528) [-1392.829] (-1387.769) (-1391.774) -- 0:00:23 625000 -- [-1389.908] (-1394.144) (-1390.747) (-1388.231) * (-1388.308) (-1387.684) (-1388.748) [-1389.732] -- 0:00:23 Average standard deviation of split frequencies: 0.010354 625500 -- (-1389.365) (-1391.668) (-1388.254) [-1390.347] * (-1387.524) [-1390.604] (-1389.214) (-1388.378) -- 0:00:23 626000 -- (-1387.133) (-1390.937) [-1392.094] (-1386.743) * (-1388.925) (-1391.771) [-1389.332] (-1386.506) -- 0:00:23 626500 -- [-1389.935] (-1387.681) (-1388.474) (-1386.775) * (-1387.811) [-1389.154] (-1388.265) (-1386.572) -- 0:00:23 627000 -- [-1389.369] (-1388.916) (-1386.689) (-1388.042) * (-1388.489) [-1386.985] (-1386.798) (-1386.531) -- 0:00:23 627500 -- (-1396.297) (-1386.384) [-1390.704] (-1389.653) * (-1387.715) [-1388.182] (-1388.099) (-1387.998) -- 0:00:23 628000 -- (-1391.193) (-1388.280) [-1389.716] (-1391.693) * (-1387.586) (-1390.118) (-1388.191) [-1387.343] -- 0:00:23 628500 -- (-1387.438) [-1387.880] (-1387.689) (-1394.370) * (-1387.635) (-1390.030) [-1386.412] (-1387.625) -- 0:00:23 629000 -- (-1389.448) (-1389.595) [-1386.977] (-1387.597) * [-1386.922] (-1389.851) (-1386.396) (-1391.046) -- 0:00:23 629500 -- (-1386.885) [-1389.314] (-1390.074) (-1386.745) * (-1386.471) (-1389.224) (-1388.845) [-1393.879] -- 0:00:23 630000 -- (-1390.421) (-1395.654) [-1386.800] (-1389.148) * [-1388.272] (-1388.282) (-1387.302) (-1392.145) -- 0:00:23 Average standard deviation of split frequencies: 0.010278 630500 -- (-1390.180) [-1387.093] (-1388.720) (-1390.800) * [-1386.657] (-1389.250) (-1390.465) (-1390.110) -- 0:00:23 631000 -- (-1391.030) (-1388.877) (-1386.235) [-1386.832] * (-1387.561) (-1386.709) (-1391.597) [-1387.027] -- 0:00:23 631500 -- (-1388.814) [-1386.925] (-1390.592) (-1387.341) * [-1387.209] (-1388.942) (-1389.512) (-1387.871) -- 0:00:23 632000 -- (-1388.304) (-1388.819) (-1387.511) [-1390.522] * (-1392.276) (-1388.514) (-1387.857) [-1386.284] -- 0:00:23 632500 -- (-1389.320) [-1387.674] (-1387.537) (-1388.519) * (-1391.829) (-1389.413) (-1386.101) [-1388.022] -- 0:00:23 633000 -- (-1387.331) [-1389.039] (-1387.102) (-1388.074) * [-1389.946] (-1390.831) (-1388.785) (-1387.506) -- 0:00:23 633500 -- [-1386.692] (-1389.100) (-1392.582) (-1387.964) * (-1387.796) [-1389.170] (-1387.693) (-1391.002) -- 0:00:23 634000 -- (-1387.827) [-1388.191] (-1388.322) (-1388.776) * (-1386.820) (-1387.395) [-1388.719] (-1388.700) -- 0:00:23 634500 -- [-1387.823] (-1387.437) (-1389.635) (-1390.634) * (-1389.340) (-1389.136) [-1389.779] (-1389.173) -- 0:00:23 635000 -- (-1391.056) (-1387.857) (-1387.088) [-1390.703] * (-1390.039) (-1389.255) [-1387.533] (-1390.263) -- 0:00:22 Average standard deviation of split frequencies: 0.009914 635500 -- (-1386.588) (-1391.002) (-1387.110) [-1391.064] * (-1395.664) [-1387.053] (-1387.128) (-1392.695) -- 0:00:22 636000 -- (-1391.634) [-1390.314] (-1388.104) (-1390.433) * [-1387.366] (-1389.426) (-1386.523) (-1389.073) -- 0:00:22 636500 -- (-1392.631) [-1391.129] (-1389.460) (-1389.043) * [-1389.752] (-1388.553) (-1386.538) (-1389.680) -- 0:00:22 637000 -- [-1391.883] (-1387.547) (-1388.310) (-1391.006) * (-1388.350) [-1390.527] (-1387.930) (-1390.009) -- 0:00:22 637500 -- (-1388.560) (-1387.622) [-1387.402] (-1388.262) * (-1389.607) [-1388.046] (-1388.648) (-1391.260) -- 0:00:22 638000 -- [-1390.314] (-1387.256) (-1387.616) (-1389.141) * (-1392.125) (-1387.874) (-1386.764) [-1387.737] -- 0:00:22 638500 -- (-1389.665) (-1389.552) (-1388.314) [-1389.007] * (-1391.172) (-1390.498) (-1387.503) [-1390.768] -- 0:00:22 639000 -- (-1391.766) [-1389.307] (-1389.006) (-1390.206) * (-1389.270) [-1391.146] (-1389.632) (-1390.962) -- 0:00:22 639500 -- (-1387.627) [-1389.753] (-1390.410) (-1392.225) * [-1388.601] (-1388.403) (-1391.880) (-1387.430) -- 0:00:22 640000 -- [-1390.067] (-1388.981) (-1387.672) (-1390.302) * (-1387.770) (-1391.150) (-1387.165) [-1391.059] -- 0:00:22 Average standard deviation of split frequencies: 0.010388 640500 -- (-1389.451) (-1386.828) (-1387.145) [-1389.412] * (-1386.674) [-1386.814] (-1386.596) (-1389.777) -- 0:00:22 641000 -- [-1389.576] (-1390.749) (-1387.420) (-1388.510) * (-1387.580) [-1390.034] (-1386.646) (-1393.957) -- 0:00:22 641500 -- (-1388.825) (-1390.400) [-1386.906] (-1387.956) * (-1390.193) (-1387.625) [-1388.992] (-1388.042) -- 0:00:22 642000 -- (-1387.554) (-1389.146) [-1386.927] (-1387.150) * (-1387.890) (-1387.634) (-1388.835) [-1390.776] -- 0:00:22 642500 -- (-1387.832) (-1388.347) [-1387.778] (-1387.276) * (-1388.930) (-1390.406) (-1391.614) [-1389.106] -- 0:00:22 643000 -- (-1388.280) (-1388.039) (-1388.335) [-1386.538] * (-1388.941) (-1387.914) (-1390.269) [-1389.249] -- 0:00:22 643500 -- (-1389.446) (-1388.555) [-1389.281] (-1389.190) * (-1388.246) (-1391.941) (-1387.437) [-1389.284] -- 0:00:22 644000 -- (-1390.037) (-1387.282) [-1388.109] (-1386.538) * (-1388.344) (-1388.692) (-1387.589) [-1388.837] -- 0:00:22 644500 -- [-1386.831] (-1388.094) (-1389.830) (-1386.893) * [-1387.264] (-1388.169) (-1388.383) (-1392.783) -- 0:00:22 645000 -- [-1387.107] (-1387.594) (-1387.754) (-1390.302) * [-1387.546] (-1388.092) (-1388.497) (-1393.224) -- 0:00:22 Average standard deviation of split frequencies: 0.010173 645500 -- (-1387.454) (-1389.937) [-1387.231] (-1388.865) * (-1390.707) (-1388.376) [-1389.948] (-1390.469) -- 0:00:22 646000 -- (-1386.795) (-1386.759) (-1388.887) [-1387.839] * (-1392.903) [-1387.858] (-1389.065) (-1386.764) -- 0:00:22 646500 -- (-1387.580) [-1388.423] (-1388.430) (-1386.729) * (-1390.541) (-1387.239) (-1386.974) [-1388.810] -- 0:00:22 647000 -- (-1386.844) [-1389.764] (-1388.561) (-1389.253) * [-1388.812] (-1386.951) (-1386.619) (-1390.795) -- 0:00:22 647500 -- (-1393.408) (-1388.593) (-1387.863) [-1387.057] * (-1389.239) (-1386.359) (-1390.108) [-1390.398] -- 0:00:22 648000 -- (-1390.762) (-1388.611) (-1394.066) [-1386.469] * [-1389.698] (-1387.221) (-1387.355) (-1392.437) -- 0:00:22 648500 -- [-1389.739] (-1391.404) (-1392.825) (-1389.444) * (-1388.964) (-1392.414) [-1387.055] (-1388.707) -- 0:00:22 649000 -- [-1390.282] (-1388.261) (-1389.097) (-1390.805) * (-1387.431) [-1387.379] (-1388.911) (-1389.922) -- 0:00:22 649500 -- (-1387.819) [-1387.558] (-1386.975) (-1387.216) * (-1388.989) (-1386.709) (-1388.226) [-1388.837] -- 0:00:22 650000 -- (-1389.348) [-1387.977] (-1386.644) (-1386.626) * [-1389.999] (-1387.057) (-1389.752) (-1387.527) -- 0:00:22 Average standard deviation of split frequencies: 0.009011 650500 -- (-1388.724) (-1388.324) (-1386.735) [-1386.745] * (-1388.442) [-1386.755] (-1388.850) (-1387.581) -- 0:00:22 651000 -- (-1392.138) [-1389.016] (-1386.487) (-1388.684) * (-1387.681) [-1390.529] (-1387.719) (-1386.409) -- 0:00:21 651500 -- (-1391.421) [-1388.503] (-1386.920) (-1386.359) * (-1388.117) (-1389.036) (-1387.519) [-1388.426] -- 0:00:21 652000 -- (-1387.038) (-1390.392) [-1387.174] (-1386.069) * [-1387.409] (-1389.778) (-1389.813) (-1389.133) -- 0:00:21 652500 -- (-1387.593) (-1390.267) [-1388.452] (-1387.006) * (-1386.365) [-1390.980] (-1388.951) (-1388.236) -- 0:00:21 653000 -- [-1390.433] (-1390.266) (-1388.452) (-1396.259) * [-1387.843] (-1390.227) (-1387.354) (-1387.920) -- 0:00:21 653500 -- [-1387.289] (-1387.214) (-1387.573) (-1388.989) * (-1394.729) [-1391.023] (-1388.269) (-1386.079) -- 0:00:21 654000 -- (-1387.170) (-1388.653) [-1387.252] (-1387.047) * (-1391.927) (-1389.007) [-1386.946] (-1386.350) -- 0:00:21 654500 -- (-1386.963) (-1389.395) [-1387.220] (-1388.596) * (-1388.772) (-1389.754) [-1388.440] (-1387.124) -- 0:00:21 655000 -- [-1388.478] (-1388.654) (-1388.558) (-1387.566) * (-1388.275) (-1387.651) [-1392.253] (-1390.825) -- 0:00:21 Average standard deviation of split frequencies: 0.008713 655500 -- (-1388.527) (-1388.655) [-1388.221] (-1389.715) * [-1387.341] (-1389.075) (-1388.984) (-1390.513) -- 0:00:21 656000 -- (-1389.650) (-1388.281) (-1389.974) [-1387.525] * (-1388.405) [-1390.469] (-1391.898) (-1389.174) -- 0:00:21 656500 -- (-1386.893) [-1388.293] (-1388.871) (-1389.711) * [-1390.696] (-1389.144) (-1389.705) (-1389.408) -- 0:00:21 657000 -- (-1388.730) (-1389.858) [-1390.130] (-1391.720) * (-1389.252) (-1388.996) (-1386.754) [-1387.176] -- 0:00:21 657500 -- (-1387.121) [-1386.574] (-1388.732) (-1389.564) * (-1388.958) (-1387.651) (-1388.796) [-1389.336] -- 0:00:21 658000 -- (-1390.326) [-1388.219] (-1389.645) (-1387.592) * (-1390.707) [-1387.454] (-1388.168) (-1388.143) -- 0:00:21 658500 -- [-1387.414] (-1387.614) (-1389.254) (-1387.920) * (-1388.048) (-1398.527) (-1389.162) [-1387.890] -- 0:00:21 659000 -- (-1389.009) (-1391.245) (-1387.641) [-1386.426] * (-1387.351) (-1386.903) (-1388.265) [-1387.511] -- 0:00:21 659500 -- (-1390.009) [-1391.365] (-1386.315) (-1388.214) * (-1387.798) [-1389.892] (-1389.866) (-1387.402) -- 0:00:21 660000 -- (-1388.753) (-1388.699) [-1387.385] (-1390.990) * (-1390.027) (-1391.349) (-1390.423) [-1388.051] -- 0:00:21 Average standard deviation of split frequencies: 0.008384 660500 -- [-1388.568] (-1390.981) (-1387.936) (-1390.551) * (-1388.679) (-1389.656) (-1390.909) [-1389.510] -- 0:00:21 661000 -- (-1389.246) (-1392.475) [-1389.755] (-1389.509) * [-1388.847] (-1389.994) (-1389.780) (-1386.644) -- 0:00:21 661500 -- (-1389.869) (-1395.500) [-1388.515] (-1387.723) * (-1388.924) [-1390.169] (-1393.924) (-1387.361) -- 0:00:21 662000 -- (-1391.034) (-1389.756) (-1388.436) [-1388.273] * (-1388.730) (-1388.987) (-1391.515) [-1389.199] -- 0:00:21 662500 -- (-1393.516) [-1387.392] (-1391.366) (-1389.671) * (-1387.250) (-1390.453) (-1390.278) [-1389.920] -- 0:00:21 663000 -- (-1395.326) (-1387.790) (-1392.606) [-1389.511] * (-1387.205) (-1387.690) (-1387.993) [-1394.226] -- 0:00:21 663500 -- (-1393.094) (-1391.614) (-1389.383) [-1387.016] * [-1387.799] (-1388.173) (-1386.617) (-1391.809) -- 0:00:21 664000 -- (-1386.768) (-1393.094) [-1392.227] (-1389.753) * (-1388.003) [-1393.228] (-1387.085) (-1389.806) -- 0:00:21 664500 -- [-1390.696] (-1387.958) (-1387.433) (-1388.583) * (-1388.016) [-1393.491] (-1397.313) (-1388.972) -- 0:00:21 665000 -- [-1387.759] (-1390.252) (-1388.013) (-1387.919) * [-1387.486] (-1387.848) (-1387.765) (-1389.654) -- 0:00:21 Average standard deviation of split frequencies: 0.007361 665500 -- (-1388.200) [-1391.625] (-1387.988) (-1387.118) * (-1388.369) (-1386.858) [-1387.998] (-1387.355) -- 0:00:21 666000 -- (-1388.984) (-1389.521) (-1391.689) [-1387.328] * (-1387.637) [-1388.809] (-1388.554) (-1390.774) -- 0:00:21 666500 -- (-1393.428) [-1386.544] (-1390.338) (-1387.469) * [-1389.660] (-1389.211) (-1386.541) (-1392.595) -- 0:00:21 667000 -- (-1388.507) [-1391.989] (-1389.958) (-1388.936) * (-1387.794) (-1386.878) (-1387.586) [-1390.372] -- 0:00:20 667500 -- (-1389.130) (-1388.771) (-1387.679) [-1387.319] * (-1388.142) [-1387.675] (-1389.393) (-1389.580) -- 0:00:20 668000 -- (-1389.577) (-1392.223) (-1387.413) [-1388.246] * (-1388.318) (-1388.646) (-1389.381) [-1387.736] -- 0:00:20 668500 -- (-1388.851) (-1390.118) (-1388.633) [-1388.108] * (-1387.774) (-1388.112) (-1387.233) [-1387.350] -- 0:00:20 669000 -- [-1387.567] (-1387.731) (-1387.174) (-1386.311) * [-1387.768] (-1389.877) (-1388.104) (-1386.511) -- 0:00:20 669500 -- (-1389.248) (-1387.076) (-1390.478) [-1386.163] * (-1389.158) [-1386.410] (-1390.108) (-1390.115) -- 0:00:20 670000 -- [-1387.662] (-1386.879) (-1386.476) (-1386.163) * (-1388.977) (-1387.167) (-1392.003) [-1390.538] -- 0:00:20 Average standard deviation of split frequencies: 0.007872 670500 -- [-1387.184] (-1389.269) (-1386.585) (-1387.445) * (-1388.953) (-1390.050) (-1388.276) [-1388.027] -- 0:00:20 671000 -- (-1387.998) (-1388.566) [-1387.132] (-1388.356) * (-1389.461) [-1390.490] (-1386.657) (-1387.142) -- 0:00:20 671500 -- (-1388.746) [-1389.270] (-1387.050) (-1389.585) * (-1390.121) (-1391.631) (-1386.843) [-1387.352] -- 0:00:20 672000 -- (-1388.639) (-1386.401) (-1388.773) [-1394.035] * (-1392.289) [-1386.406] (-1387.522) (-1387.217) -- 0:00:20 672500 -- (-1387.580) [-1390.596] (-1390.635) (-1389.237) * (-1387.132) [-1386.747] (-1386.937) (-1388.443) -- 0:00:20 673000 -- [-1388.154] (-1388.278) (-1390.105) (-1387.375) * [-1386.415] (-1387.196) (-1388.258) (-1388.899) -- 0:00:20 673500 -- (-1388.651) [-1389.190] (-1388.927) (-1391.477) * (-1389.587) [-1389.435] (-1390.386) (-1389.749) -- 0:00:20 674000 -- [-1388.643] (-1388.943) (-1388.128) (-1389.850) * (-1391.871) (-1387.080) (-1388.292) [-1388.136] -- 0:00:20 674500 -- [-1387.385] (-1388.301) (-1389.561) (-1396.138) * (-1390.116) [-1387.709] (-1388.583) (-1387.473) -- 0:00:20 675000 -- (-1387.526) [-1391.569] (-1386.753) (-1388.349) * (-1395.264) (-1391.481) (-1386.207) [-1389.253] -- 0:00:20 Average standard deviation of split frequencies: 0.007485 675500 -- (-1387.201) [-1387.562] (-1386.709) (-1389.469) * (-1388.945) [-1391.211] (-1388.166) (-1386.706) -- 0:00:20 676000 -- [-1387.237] (-1387.845) (-1386.744) (-1387.527) * [-1387.831] (-1395.545) (-1388.958) (-1387.635) -- 0:00:20 676500 -- (-1388.286) [-1387.359] (-1387.122) (-1388.938) * (-1388.233) (-1390.350) [-1389.697] (-1387.643) -- 0:00:20 677000 -- (-1390.283) [-1388.651] (-1388.206) (-1390.739) * (-1389.061) (-1393.709) (-1389.865) [-1387.272] -- 0:00:20 677500 -- (-1387.992) [-1388.841] (-1386.869) (-1394.734) * (-1386.901) (-1386.926) (-1388.366) [-1387.766] -- 0:00:20 678000 -- (-1387.673) (-1387.813) (-1389.934) [-1386.384] * (-1388.958) [-1390.566] (-1388.232) (-1388.202) -- 0:00:20 678500 -- (-1386.548) (-1388.167) (-1390.935) [-1386.924] * (-1393.049) (-1389.410) [-1387.164] (-1387.737) -- 0:00:20 679000 -- (-1386.632) [-1387.300] (-1387.589) (-1389.398) * [-1392.340] (-1386.952) (-1390.254) (-1388.765) -- 0:00:20 679500 -- [-1386.632] (-1389.053) (-1387.627) (-1390.197) * (-1388.922) (-1389.915) (-1388.972) [-1387.579] -- 0:00:20 680000 -- (-1386.296) [-1386.846] (-1387.662) (-1387.742) * (-1390.774) (-1388.684) [-1387.803] (-1389.756) -- 0:00:20 Average standard deviation of split frequencies: 0.007387 680500 -- [-1389.143] (-1386.431) (-1386.308) (-1392.152) * (-1388.848) [-1387.234] (-1388.454) (-1388.914) -- 0:00:20 681000 -- [-1387.088] (-1386.307) (-1392.258) (-1388.635) * (-1391.781) (-1389.667) (-1387.333) [-1388.584] -- 0:00:20 681500 -- [-1389.299] (-1388.677) (-1391.055) (-1392.717) * [-1389.187] (-1387.709) (-1389.036) (-1390.032) -- 0:00:20 682000 -- (-1388.247) (-1387.979) [-1389.889] (-1389.466) * (-1389.415) (-1388.140) [-1389.614] (-1388.760) -- 0:00:20 682500 -- [-1389.200] (-1391.304) (-1388.875) (-1388.230) * (-1388.644) (-1389.212) [-1387.295] (-1387.290) -- 0:00:20 683000 -- (-1393.660) [-1389.858] (-1387.756) (-1388.821) * (-1389.435) (-1389.128) [-1389.902] (-1386.806) -- 0:00:19 683500 -- (-1393.592) (-1388.836) (-1389.121) [-1387.152] * (-1390.291) (-1391.283) [-1391.631] (-1386.952) -- 0:00:19 684000 -- [-1387.140] (-1387.134) (-1387.830) (-1386.203) * (-1392.745) (-1387.891) (-1394.310) [-1389.008] -- 0:00:19 684500 -- [-1388.203] (-1389.509) (-1388.347) (-1387.535) * (-1388.944) (-1387.295) [-1389.727] (-1394.960) -- 0:00:19 685000 -- (-1388.088) (-1387.262) (-1388.551) [-1389.306] * [-1387.210] (-1388.056) (-1388.011) (-1392.254) -- 0:00:19 Average standard deviation of split frequencies: 0.007055 685500 -- (-1387.414) (-1387.124) (-1387.747) [-1391.002] * [-1388.023] (-1388.544) (-1388.086) (-1389.911) -- 0:00:19 686000 -- (-1386.687) [-1389.693] (-1389.812) (-1386.615) * (-1389.837) [-1388.180] (-1390.210) (-1387.342) -- 0:00:19 686500 -- [-1386.982] (-1392.936) (-1388.155) (-1386.985) * (-1390.638) [-1388.764] (-1388.693) (-1389.232) -- 0:00:19 687000 -- [-1388.279] (-1387.301) (-1387.776) (-1386.681) * [-1388.051] (-1387.769) (-1388.074) (-1388.226) -- 0:00:19 687500 -- (-1387.303) (-1389.959) [-1387.043] (-1386.263) * (-1389.720) (-1387.247) (-1388.692) [-1387.267] -- 0:00:19 688000 -- (-1386.728) (-1392.112) [-1388.057] (-1386.784) * (-1387.049) (-1388.852) (-1386.826) [-1386.927] -- 0:00:19 688500 -- [-1388.495] (-1387.668) (-1390.250) (-1386.640) * (-1388.343) (-1388.321) [-1390.226] (-1388.644) -- 0:00:19 689000 -- [-1387.115] (-1388.686) (-1387.839) (-1390.141) * (-1387.608) [-1390.617] (-1388.417) (-1389.038) -- 0:00:19 689500 -- [-1389.945] (-1390.085) (-1388.634) (-1390.725) * (-1387.331) (-1388.613) (-1390.790) [-1389.569] -- 0:00:19 690000 -- (-1391.104) (-1388.353) [-1387.303] (-1387.327) * [-1386.864] (-1389.558) (-1389.683) (-1390.641) -- 0:00:19 Average standard deviation of split frequencies: 0.007144 690500 -- [-1389.248] (-1388.300) (-1388.071) (-1386.689) * (-1388.493) [-1387.296] (-1388.805) (-1386.786) -- 0:00:19 691000 -- [-1390.566] (-1388.819) (-1389.604) (-1386.916) * (-1387.874) (-1390.070) (-1389.408) [-1388.103] -- 0:00:19 691500 -- (-1389.769) (-1388.909) (-1387.972) [-1386.630] * (-1388.062) (-1389.354) (-1387.049) [-1388.480] -- 0:00:19 692000 -- [-1389.929] (-1388.075) (-1388.592) (-1389.159) * (-1388.282) (-1387.664) [-1386.383] (-1387.072) -- 0:00:19 692500 -- (-1396.894) [-1387.140] (-1389.818) (-1388.952) * [-1388.364] (-1392.084) (-1388.632) (-1386.504) -- 0:00:19 693000 -- [-1389.237] (-1390.965) (-1387.574) (-1386.984) * (-1388.928) [-1387.102] (-1386.631) (-1388.846) -- 0:00:19 693500 -- [-1387.417] (-1391.743) (-1389.141) (-1386.556) * [-1387.539] (-1388.989) (-1387.752) (-1387.431) -- 0:00:19 694000 -- (-1387.553) (-1390.769) (-1389.190) [-1388.568] * [-1387.524] (-1388.861) (-1387.703) (-1387.557) -- 0:00:19 694500 -- (-1387.712) (-1387.097) (-1389.072) [-1387.802] * (-1387.488) [-1388.571] (-1386.967) (-1389.108) -- 0:00:19 695000 -- [-1387.238] (-1386.927) (-1387.480) (-1387.550) * [-1390.904] (-1387.779) (-1389.917) (-1387.897) -- 0:00:19 Average standard deviation of split frequencies: 0.007044 695500 -- (-1390.130) [-1389.951] (-1395.535) (-1388.737) * (-1388.048) (-1388.810) [-1388.266] (-1388.432) -- 0:00:19 696000 -- (-1386.658) [-1387.951] (-1389.753) (-1387.628) * [-1388.985] (-1386.627) (-1388.235) (-1387.954) -- 0:00:19 696500 -- [-1386.675] (-1388.357) (-1392.726) (-1388.350) * (-1388.586) (-1387.586) (-1388.164) [-1386.808] -- 0:00:19 697000 -- [-1386.688] (-1389.489) (-1386.119) (-1388.313) * (-1388.557) [-1390.936] (-1387.932) (-1387.349) -- 0:00:19 697500 -- (-1388.755) (-1389.359) [-1391.074] (-1388.982) * (-1389.024) [-1389.433] (-1386.427) (-1386.666) -- 0:00:19 698000 -- (-1388.786) (-1387.970) (-1390.657) [-1390.806] * [-1388.183] (-1387.595) (-1390.901) (-1386.760) -- 0:00:19 698500 -- [-1386.468] (-1387.389) (-1389.489) (-1388.611) * (-1386.690) (-1386.666) [-1388.799] (-1389.078) -- 0:00:18 699000 -- (-1387.681) (-1388.792) (-1390.417) [-1388.452] * (-1386.746) [-1388.454] (-1388.985) (-1387.688) -- 0:00:18 699500 -- (-1388.657) (-1389.325) (-1387.475) [-1386.659] * (-1388.493) (-1387.141) [-1388.224] (-1388.464) -- 0:00:18 700000 -- (-1391.239) [-1388.452] (-1387.435) (-1388.660) * (-1388.856) (-1391.264) (-1391.925) [-1390.333] -- 0:00:18 Average standard deviation of split frequencies: 0.006593 700500 -- (-1389.204) [-1387.633] (-1387.784) (-1389.780) * [-1388.374] (-1394.004) (-1388.302) (-1389.873) -- 0:00:18 701000 -- (-1393.756) (-1390.058) [-1390.679] (-1387.453) * (-1389.449) (-1388.961) (-1391.650) [-1388.112] -- 0:00:18 701500 -- (-1390.118) [-1388.603] (-1386.679) (-1387.637) * [-1389.557] (-1389.507) (-1387.542) (-1388.375) -- 0:00:18 702000 -- (-1389.009) (-1388.267) (-1386.776) [-1387.581] * [-1389.082] (-1389.544) (-1387.628) (-1393.256) -- 0:00:18 702500 -- [-1386.974] (-1388.258) (-1387.509) (-1388.628) * [-1387.335] (-1389.934) (-1389.521) (-1387.107) -- 0:00:18 703000 -- [-1387.517] (-1388.976) (-1387.094) (-1386.542) * (-1386.332) (-1387.263) (-1387.965) [-1387.201] -- 0:00:18 703500 -- (-1388.374) (-1390.916) [-1390.184] (-1386.157) * (-1387.205) (-1387.292) [-1388.255] (-1388.180) -- 0:00:18 704000 -- (-1390.349) [-1391.645] (-1388.325) (-1387.724) * (-1389.721) [-1386.478] (-1387.042) (-1390.447) -- 0:00:18 704500 -- (-1388.949) [-1388.857] (-1387.286) (-1389.399) * [-1386.972] (-1387.162) (-1386.983) (-1390.572) -- 0:00:18 705000 -- [-1388.812] (-1387.389) (-1388.766) (-1391.093) * [-1386.438] (-1390.081) (-1387.983) (-1388.240) -- 0:00:18 Average standard deviation of split frequencies: 0.006588 705500 -- (-1386.753) (-1386.852) [-1387.554] (-1390.245) * (-1386.782) [-1387.374] (-1389.655) (-1387.075) -- 0:00:18 706000 -- (-1386.278) [-1386.565] (-1388.028) (-1389.089) * (-1388.569) [-1390.939] (-1393.285) (-1386.949) -- 0:00:18 706500 -- (-1390.012) (-1388.087) (-1392.681) [-1388.801] * (-1389.239) (-1390.341) (-1388.746) [-1386.624] -- 0:00:18 707000 -- [-1388.397] (-1387.025) (-1387.755) (-1386.959) * (-1390.251) [-1388.941] (-1386.414) (-1389.754) -- 0:00:18 707500 -- (-1387.562) [-1388.031] (-1387.894) (-1387.194) * [-1393.376] (-1393.609) (-1387.359) (-1387.792) -- 0:00:18 708000 -- (-1389.715) (-1395.770) [-1387.336] (-1387.389) * (-1390.488) (-1388.746) [-1386.413] (-1386.504) -- 0:00:18 708500 -- [-1389.960] (-1391.469) (-1392.890) (-1386.704) * (-1393.080) (-1389.188) [-1387.445] (-1395.181) -- 0:00:18 709000 -- (-1388.816) (-1390.463) [-1387.700] (-1389.353) * (-1388.029) [-1389.249] (-1388.844) (-1389.747) -- 0:00:18 709500 -- (-1388.816) (-1397.022) (-1387.642) [-1388.627] * (-1389.354) (-1387.078) (-1388.274) [-1389.692] -- 0:00:18 710000 -- (-1388.896) (-1391.140) [-1386.995] (-1388.028) * (-1386.995) (-1386.987) (-1390.632) [-1392.755] -- 0:00:18 Average standard deviation of split frequencies: 0.006722 710500 -- (-1389.801) [-1389.771] (-1387.150) (-1389.022) * (-1388.475) [-1388.765] (-1387.489) (-1387.627) -- 0:00:18 711000 -- (-1387.334) [-1387.008] (-1388.284) (-1388.752) * (-1386.314) (-1387.780) [-1388.833] (-1390.946) -- 0:00:18 711500 -- (-1388.885) (-1389.248) [-1389.952] (-1389.042) * [-1390.252] (-1387.812) (-1391.216) (-1387.651) -- 0:00:18 712000 -- (-1386.426) (-1387.129) (-1387.895) [-1389.511] * (-1390.636) (-1390.123) [-1389.040] (-1388.147) -- 0:00:18 712500 -- (-1388.172) [-1387.300] (-1388.034) (-1387.091) * [-1388.930] (-1388.679) (-1388.703) (-1391.304) -- 0:00:18 713000 -- (-1391.037) (-1387.570) [-1389.280] (-1387.119) * (-1386.854) [-1388.463] (-1389.560) (-1388.913) -- 0:00:18 713500 -- (-1388.667) [-1387.474] (-1388.003) (-1387.261) * (-1388.077) (-1388.272) (-1387.087) [-1392.066] -- 0:00:18 714000 -- (-1391.708) (-1388.742) (-1391.182) [-1388.107] * [-1388.819] (-1387.042) (-1387.570) (-1386.907) -- 0:00:18 714500 -- [-1387.346] (-1390.967) (-1391.018) (-1388.396) * (-1390.836) (-1386.726) [-1390.318] (-1389.080) -- 0:00:17 715000 -- (-1387.836) (-1394.333) [-1388.160] (-1389.533) * (-1388.111) [-1386.176] (-1386.553) (-1389.620) -- 0:00:17 Average standard deviation of split frequencies: 0.006716 715500 -- (-1387.725) [-1389.308] (-1390.513) (-1391.598) * [-1388.594] (-1386.548) (-1386.614) (-1388.337) -- 0:00:17 716000 -- (-1387.481) (-1387.690) [-1386.486] (-1390.658) * (-1389.719) [-1387.054] (-1388.967) (-1386.372) -- 0:00:17 716500 -- (-1390.369) (-1388.264) (-1387.069) [-1388.349] * [-1389.981] (-1389.147) (-1389.506) (-1388.777) -- 0:00:17 717000 -- [-1387.125] (-1387.383) (-1387.633) (-1394.917) * (-1391.077) [-1387.798] (-1390.533) (-1389.458) -- 0:00:17 717500 -- (-1387.235) [-1386.835] (-1388.494) (-1386.919) * [-1387.837] (-1387.764) (-1388.797) (-1388.701) -- 0:00:17 718000 -- (-1389.636) [-1388.582] (-1388.036) (-1397.366) * (-1390.391) (-1392.004) (-1386.910) [-1387.693] -- 0:00:17 718500 -- [-1386.630] (-1386.213) (-1386.556) (-1392.846) * (-1389.633) (-1388.166) (-1387.099) [-1388.224] -- 0:00:17 719000 -- (-1388.366) (-1387.396) [-1394.437] (-1388.642) * (-1390.077) (-1387.480) [-1388.311] (-1395.280) -- 0:00:17 719500 -- (-1389.015) (-1386.434) [-1392.450] (-1388.874) * (-1390.577) (-1391.409) [-1389.898] (-1393.818) -- 0:00:17 720000 -- (-1390.752) (-1387.269) (-1391.115) [-1388.671] * (-1388.885) (-1388.278) (-1389.297) [-1387.579] -- 0:00:17 Average standard deviation of split frequencies: 0.006716 720500 -- [-1389.922] (-1386.283) (-1388.281) (-1389.342) * [-1387.773] (-1388.119) (-1390.127) (-1386.765) -- 0:00:17 721000 -- (-1388.172) [-1386.765] (-1388.879) (-1390.858) * (-1387.620) (-1387.700) (-1388.133) [-1390.203] -- 0:00:17 721500 -- [-1386.495] (-1386.785) (-1387.992) (-1387.580) * [-1387.785] (-1388.013) (-1388.497) (-1389.329) -- 0:00:17 722000 -- (-1388.753) (-1389.089) (-1388.922) [-1387.003] * [-1392.062] (-1387.282) (-1388.683) (-1393.097) -- 0:00:17 722500 -- (-1387.343) (-1391.543) (-1387.695) [-1387.155] * (-1388.063) (-1387.528) (-1388.501) [-1391.175] -- 0:00:17 723000 -- [-1390.555] (-1390.678) (-1389.728) (-1388.129) * [-1387.430] (-1386.832) (-1389.604) (-1390.181) -- 0:00:17 723500 -- (-1387.753) [-1387.857] (-1392.427) (-1386.661) * (-1387.435) (-1388.841) [-1388.481] (-1390.044) -- 0:00:17 724000 -- (-1391.241) [-1389.388] (-1393.506) (-1386.272) * (-1389.022) [-1387.763] (-1389.917) (-1388.835) -- 0:00:17 724500 -- (-1389.801) [-1388.068] (-1396.037) (-1389.034) * (-1388.795) [-1387.810] (-1387.852) (-1387.193) -- 0:00:17 725000 -- [-1387.906] (-1387.627) (-1392.320) (-1387.641) * (-1387.073) (-1387.776) (-1386.946) [-1389.347] -- 0:00:17 Average standard deviation of split frequencies: 0.006710 725500 -- (-1390.497) (-1388.105) (-1386.863) [-1394.027] * [-1390.618] (-1389.513) (-1391.283) (-1388.130) -- 0:00:17 726000 -- (-1391.042) (-1387.206) (-1387.858) [-1390.753] * [-1389.570] (-1388.674) (-1390.677) (-1387.920) -- 0:00:17 726500 -- [-1389.063] (-1389.090) (-1388.302) (-1391.240) * (-1388.868) (-1388.869) (-1388.413) [-1387.634] -- 0:00:17 727000 -- (-1390.959) (-1390.688) [-1387.899] (-1388.383) * (-1387.692) (-1387.948) [-1388.406] (-1388.225) -- 0:00:17 727500 -- [-1386.512] (-1388.329) (-1387.596) (-1389.654) * [-1386.859] (-1388.474) (-1389.422) (-1389.126) -- 0:00:17 728000 -- (-1389.031) (-1387.466) [-1388.552] (-1390.016) * [-1388.341] (-1388.995) (-1391.510) (-1390.708) -- 0:00:17 728500 -- [-1389.514] (-1388.411) (-1389.882) (-1390.226) * (-1387.690) (-1389.178) (-1389.684) [-1389.846] -- 0:00:17 729000 -- [-1387.014] (-1387.751) (-1391.797) (-1388.373) * (-1391.000) (-1388.149) [-1387.617] (-1389.977) -- 0:00:17 729500 -- (-1387.937) (-1389.087) (-1391.207) [-1388.848] * (-1388.575) (-1387.484) [-1388.553] (-1391.472) -- 0:00:17 730000 -- (-1387.406) (-1387.611) [-1388.157] (-1388.431) * (-1387.557) (-1388.964) (-1386.276) [-1388.702] -- 0:00:17 Average standard deviation of split frequencies: 0.006452 730500 -- (-1388.208) [-1387.779] (-1390.331) (-1388.569) * (-1388.288) (-1388.161) (-1386.306) [-1389.011] -- 0:00:16 731000 -- (-1388.540) (-1388.804) (-1391.394) [-1389.030] * (-1391.003) (-1393.355) (-1386.742) [-1386.531] -- 0:00:16 731500 -- [-1392.140] (-1387.214) (-1387.152) (-1388.177) * [-1388.698] (-1387.899) (-1389.422) (-1392.083) -- 0:00:16 732000 -- (-1388.862) (-1391.690) [-1390.996] (-1388.096) * (-1387.507) (-1388.647) (-1389.673) [-1388.208] -- 0:00:16 732500 -- (-1386.691) (-1388.547) [-1387.160] (-1387.777) * (-1390.810) (-1388.632) [-1391.801] (-1387.752) -- 0:00:16 733000 -- (-1388.009) (-1389.127) (-1391.293) [-1388.543] * (-1389.448) (-1387.368) (-1389.705) [-1386.934] -- 0:00:16 733500 -- [-1386.728] (-1389.544) (-1388.939) (-1388.954) * (-1386.950) (-1386.350) (-1387.004) [-1387.599] -- 0:00:16 734000 -- (-1388.791) (-1388.009) [-1387.970] (-1387.180) * (-1386.681) [-1387.477] (-1388.040) (-1392.851) -- 0:00:16 734500 -- (-1387.987) (-1387.222) (-1386.892) [-1387.354] * (-1388.939) (-1387.248) (-1386.974) [-1389.614] -- 0:00:16 735000 -- [-1387.289] (-1386.993) (-1389.742) (-1389.009) * [-1387.572] (-1389.125) (-1388.422) (-1389.147) -- 0:00:16 Average standard deviation of split frequencies: 0.006960 735500 -- (-1387.458) (-1388.736) (-1389.350) [-1389.081] * (-1387.694) (-1392.178) (-1388.767) [-1390.793] -- 0:00:16 736000 -- (-1387.980) (-1387.883) [-1389.539] (-1388.115) * [-1388.202] (-1394.036) (-1392.309) (-1390.785) -- 0:00:16 736500 -- (-1388.514) [-1388.678] (-1389.915) (-1389.238) * (-1386.926) (-1388.312) (-1388.235) [-1386.591] -- 0:00:16 737000 -- (-1388.777) (-1387.630) (-1387.660) [-1388.576] * (-1389.674) [-1388.556] (-1386.551) (-1387.502) -- 0:00:16 737500 -- (-1388.845) (-1386.468) (-1387.571) [-1388.046] * [-1388.522] (-1388.333) (-1390.825) (-1387.847) -- 0:00:16 738000 -- (-1387.912) [-1388.618] (-1386.322) (-1387.500) * (-1388.255) (-1389.504) [-1386.323] (-1389.191) -- 0:00:16 738500 -- (-1387.529) (-1388.625) [-1387.681] (-1388.211) * (-1389.166) (-1389.602) (-1389.886) [-1388.452] -- 0:00:16 739000 -- (-1388.768) (-1387.875) [-1386.513] (-1388.443) * [-1388.066] (-1392.154) (-1388.770) (-1391.835) -- 0:00:16 739500 -- (-1387.299) (-1388.477) (-1386.303) [-1386.631] * (-1388.768) [-1389.307] (-1388.427) (-1393.144) -- 0:00:16 740000 -- [-1387.299] (-1387.685) (-1387.636) (-1389.298) * (-1388.697) (-1388.863) (-1392.506) [-1389.325] -- 0:00:16 Average standard deviation of split frequencies: 0.006916 740500 -- (-1388.779) [-1389.301] (-1390.805) (-1389.686) * [-1386.969] (-1387.844) (-1386.833) (-1389.155) -- 0:00:16 741000 -- (-1389.494) (-1395.619) (-1390.651) [-1388.409] * [-1389.081] (-1389.280) (-1388.913) (-1387.611) -- 0:00:16 741500 -- [-1389.969] (-1388.878) (-1387.679) (-1390.583) * [-1392.947] (-1386.865) (-1386.638) (-1387.940) -- 0:00:16 742000 -- (-1388.864) (-1388.940) [-1388.043] (-1388.521) * (-1389.549) [-1387.065] (-1388.579) (-1389.163) -- 0:00:16 742500 -- (-1388.480) [-1389.484] (-1388.231) (-1387.761) * (-1390.953) (-1387.770) (-1388.216) [-1386.670] -- 0:00:16 743000 -- (-1390.333) [-1387.851] (-1387.160) (-1386.751) * (-1387.367) [-1387.654] (-1390.011) (-1387.472) -- 0:00:16 743500 -- (-1389.144) [-1386.915] (-1390.563) (-1387.633) * (-1386.860) (-1388.601) (-1387.871) [-1386.555] -- 0:00:16 744000 -- [-1389.526] (-1389.338) (-1388.987) (-1395.920) * (-1387.959) [-1388.753] (-1389.014) (-1387.578) -- 0:00:16 744500 -- (-1396.279) (-1393.979) [-1388.948] (-1386.556) * [-1387.962] (-1386.590) (-1391.516) (-1389.144) -- 0:00:16 745000 -- (-1394.226) (-1392.247) [-1387.918] (-1390.417) * (-1390.521) (-1393.629) [-1388.122] (-1389.263) -- 0:00:16 Average standard deviation of split frequencies: 0.006825 745500 -- [-1392.765] (-1387.630) (-1389.994) (-1389.081) * (-1389.060) [-1387.232] (-1388.623) (-1393.044) -- 0:00:16 746000 -- (-1390.006) (-1387.691) [-1387.864] (-1388.169) * (-1391.023) (-1387.872) (-1386.921) [-1392.315] -- 0:00:16 746500 -- (-1388.140) (-1386.697) (-1387.907) [-1392.955] * (-1387.404) (-1388.249) [-1388.506] (-1386.477) -- 0:00:15 747000 -- (-1387.053) (-1390.558) [-1388.307] (-1388.401) * (-1390.507) [-1387.467] (-1389.946) (-1387.507) -- 0:00:15 747500 -- (-1386.953) (-1386.278) (-1387.918) [-1392.005] * (-1393.669) [-1388.006] (-1387.362) (-1391.758) -- 0:00:15 748000 -- (-1387.036) (-1386.853) (-1395.380) [-1388.218] * (-1388.321) [-1386.563] (-1390.403) (-1389.540) -- 0:00:15 748500 -- (-1389.067) (-1388.071) [-1386.434] (-1386.775) * (-1391.287) [-1386.832] (-1386.800) (-1389.034) -- 0:00:15 749000 -- [-1390.829] (-1388.300) (-1386.436) (-1388.214) * (-1388.185) [-1386.912] (-1388.955) (-1387.778) -- 0:00:15 749500 -- (-1388.519) [-1386.604] (-1387.939) (-1388.289) * (-1388.652) (-1387.093) [-1390.146] (-1387.542) -- 0:00:15 750000 -- [-1389.887] (-1386.460) (-1388.371) (-1387.205) * (-1389.495) (-1387.031) (-1388.316) [-1387.281] -- 0:00:15 Average standard deviation of split frequencies: 0.006447 750500 -- (-1387.693) (-1387.855) [-1386.708] (-1389.295) * (-1391.409) (-1389.686) (-1388.214) [-1387.556] -- 0:00:15 751000 -- (-1387.186) (-1388.549) (-1386.834) [-1389.295] * [-1391.038] (-1387.430) (-1389.346) (-1387.388) -- 0:00:15 751500 -- (-1390.531) (-1389.352) (-1386.840) [-1388.603] * [-1387.647] (-1388.230) (-1388.273) (-1388.315) -- 0:00:15 752000 -- (-1390.131) (-1391.983) [-1388.072] (-1387.419) * (-1388.813) (-1391.982) (-1390.082) [-1389.712] -- 0:00:15 752500 -- (-1387.178) (-1389.711) (-1387.398) [-1387.032] * [-1390.416] (-1388.143) (-1387.303) (-1388.252) -- 0:00:15 753000 -- (-1389.917) [-1386.952] (-1389.993) (-1388.990) * (-1391.229) [-1387.265] (-1392.602) (-1388.142) -- 0:00:15 753500 -- (-1388.394) (-1386.898) (-1398.851) [-1391.148] * [-1387.368] (-1386.945) (-1390.009) (-1387.819) -- 0:00:15 754000 -- (-1387.454) (-1392.140) (-1388.019) [-1388.524] * [-1388.793] (-1387.293) (-1389.652) (-1389.852) -- 0:00:15 754500 -- (-1388.144) [-1388.713] (-1389.975) (-1388.062) * [-1387.027] (-1386.716) (-1388.236) (-1389.443) -- 0:00:15 755000 -- (-1388.099) (-1388.825) [-1388.455] (-1388.437) * (-1389.010) [-1387.717] (-1388.515) (-1387.669) -- 0:00:15 Average standard deviation of split frequencies: 0.006360 755500 -- (-1387.629) (-1389.437) (-1388.107) [-1387.785] * (-1388.984) (-1387.170) (-1386.846) [-1390.489] -- 0:00:15 756000 -- [-1388.171] (-1388.017) (-1388.995) (-1387.851) * (-1390.297) (-1392.213) [-1387.421] (-1388.583) -- 0:00:15 756500 -- (-1387.930) (-1390.224) [-1390.990] (-1387.480) * [-1391.580] (-1393.143) (-1389.963) (-1390.070) -- 0:00:15 757000 -- (-1391.423) (-1389.416) (-1390.950) [-1389.342] * (-1389.995) (-1387.269) [-1389.995] (-1389.020) -- 0:00:15 757500 -- (-1386.806) [-1389.050] (-1389.032) (-1388.773) * (-1388.914) [-1387.928] (-1387.662) (-1387.121) -- 0:00:15 758000 -- (-1387.274) (-1389.253) [-1387.695] (-1388.432) * [-1386.818] (-1390.835) (-1389.501) (-1388.943) -- 0:00:15 758500 -- [-1388.256] (-1387.893) (-1388.012) (-1386.296) * (-1389.871) [-1389.358] (-1387.810) (-1389.468) -- 0:00:15 759000 -- [-1387.456] (-1388.854) (-1386.371) (-1390.657) * [-1389.795] (-1390.259) (-1386.199) (-1386.208) -- 0:00:15 759500 -- (-1387.456) (-1392.598) [-1386.379] (-1389.337) * (-1386.773) (-1394.252) (-1388.323) [-1391.155] -- 0:00:15 760000 -- (-1388.352) [-1391.606] (-1386.978) (-1389.338) * (-1393.742) (-1391.590) [-1388.725] (-1386.464) -- 0:00:15 Average standard deviation of split frequencies: 0.006445 760500 -- (-1388.918) [-1387.420] (-1388.340) (-1387.956) * (-1390.260) (-1392.193) (-1387.372) [-1387.181] -- 0:00:15 761000 -- (-1388.314) [-1386.057] (-1389.299) (-1388.431) * (-1390.674) (-1391.306) (-1386.791) [-1390.786] -- 0:00:15 761500 -- (-1388.210) [-1387.843] (-1389.605) (-1389.643) * (-1391.797) [-1391.123] (-1386.561) (-1389.393) -- 0:00:15 762000 -- (-1390.341) (-1392.196) (-1388.353) [-1388.153] * (-1391.545) (-1392.756) (-1392.649) [-1388.351] -- 0:00:14 762500 -- (-1386.762) (-1387.634) (-1388.843) [-1388.363] * (-1388.988) [-1387.105] (-1391.470) (-1389.118) -- 0:00:14 763000 -- [-1387.098] (-1387.871) (-1389.832) (-1387.181) * [-1390.189] (-1386.159) (-1390.878) (-1392.790) -- 0:00:14 763500 -- (-1386.875) (-1391.933) (-1389.923) [-1386.634] * [-1389.643] (-1386.845) (-1388.847) (-1390.435) -- 0:00:14 764000 -- [-1386.995] (-1399.549) (-1389.770) (-1393.005) * (-1396.116) (-1389.402) [-1387.213] (-1389.131) -- 0:00:14 764500 -- (-1388.725) [-1389.905] (-1389.354) (-1389.852) * [-1388.271] (-1389.209) (-1386.542) (-1389.272) -- 0:00:14 765000 -- (-1388.058) (-1386.696) (-1391.415) [-1390.870] * (-1391.420) [-1387.180] (-1386.590) (-1387.041) -- 0:00:14 Average standard deviation of split frequencies: 0.006441 765500 -- (-1391.029) (-1391.244) [-1388.431] (-1397.608) * (-1388.263) (-1390.820) [-1390.399] (-1388.292) -- 0:00:14 766000 -- (-1388.997) (-1386.982) (-1388.781) [-1392.727] * (-1387.170) (-1393.279) [-1387.120] (-1392.617) -- 0:00:14 766500 -- (-1388.813) (-1390.024) (-1389.113) [-1388.858] * [-1389.169] (-1393.265) (-1389.100) (-1394.816) -- 0:00:14 767000 -- (-1391.412) (-1386.534) [-1389.803] (-1390.209) * (-1387.718) [-1388.749] (-1388.816) (-1388.047) -- 0:00:14 767500 -- (-1389.129) [-1388.782] (-1388.106) (-1389.597) * [-1387.490] (-1387.973) (-1389.483) (-1389.196) -- 0:00:14 768000 -- (-1387.654) (-1389.284) (-1389.138) [-1387.893] * (-1390.594) (-1387.350) [-1387.135] (-1391.765) -- 0:00:14 768500 -- (-1387.068) (-1388.333) (-1388.492) [-1388.290] * (-1390.753) [-1391.059] (-1387.013) (-1389.093) -- 0:00:14 769000 -- (-1388.986) [-1386.442] (-1387.279) (-1387.208) * [-1387.575] (-1388.074) (-1388.319) (-1389.058) -- 0:00:14 769500 -- (-1388.950) (-1390.428) [-1386.945] (-1387.224) * [-1387.458] (-1387.011) (-1388.069) (-1392.495) -- 0:00:14 770000 -- (-1386.714) (-1388.751) [-1387.818] (-1392.574) * (-1387.342) (-1387.234) [-1386.649] (-1389.304) -- 0:00:14 Average standard deviation of split frequencies: 0.006851 770500 -- (-1386.840) (-1386.789) [-1388.745] (-1394.956) * (-1388.957) (-1389.650) [-1387.023] (-1388.076) -- 0:00:14 771000 -- (-1389.992) (-1387.297) [-1388.249] (-1389.507) * (-1388.710) [-1387.311] (-1387.710) (-1387.178) -- 0:00:14 771500 -- (-1389.854) (-1386.909) [-1388.334] (-1391.232) * [-1390.009] (-1387.463) (-1386.955) (-1386.862) -- 0:00:14 772000 -- (-1388.856) [-1387.327] (-1386.890) (-1388.142) * (-1391.947) (-1387.910) [-1386.531] (-1386.879) -- 0:00:14 772500 -- (-1389.718) [-1386.700] (-1387.160) (-1389.108) * (-1389.639) (-1387.948) [-1390.756] (-1386.980) -- 0:00:14 773000 -- (-1388.402) (-1388.786) [-1387.352] (-1387.423) * (-1389.633) (-1391.827) [-1386.599] (-1387.507) -- 0:00:14 773500 -- (-1393.735) [-1387.835] (-1390.792) (-1386.209) * [-1393.284] (-1391.040) (-1387.474) (-1388.853) -- 0:00:14 774000 -- [-1389.039] (-1387.970) (-1389.728) (-1388.610) * (-1388.442) [-1388.426] (-1390.615) (-1387.296) -- 0:00:14 774500 -- (-1387.560) (-1391.229) [-1388.384] (-1390.889) * (-1387.694) (-1390.158) (-1388.069) [-1387.263] -- 0:00:14 775000 -- (-1387.655) (-1389.893) (-1387.903) [-1387.602] * (-1387.662) (-1390.009) (-1387.278) [-1387.258] -- 0:00:14 Average standard deviation of split frequencies: 0.006804 775500 -- (-1389.218) (-1389.720) (-1387.894) [-1386.466] * (-1389.136) (-1391.137) (-1389.757) [-1388.999] -- 0:00:14 776000 -- (-1391.027) (-1390.913) [-1388.642] (-1390.412) * (-1389.193) [-1388.129] (-1392.769) (-1390.814) -- 0:00:14 776500 -- (-1386.873) (-1394.159) [-1387.427] (-1390.339) * [-1392.661] (-1389.361) (-1389.129) (-1390.548) -- 0:00:14 777000 -- (-1387.455) (-1389.564) (-1386.574) [-1386.748] * (-1386.906) [-1387.792] (-1388.742) (-1390.018) -- 0:00:14 777500 -- [-1387.294] (-1387.378) (-1386.261) (-1386.196) * [-1387.092] (-1389.009) (-1388.701) (-1389.806) -- 0:00:14 778000 -- [-1388.746] (-1392.458) (-1386.585) (-1391.037) * (-1388.871) (-1389.981) (-1388.076) [-1387.532] -- 0:00:13 778500 -- (-1389.904) [-1389.269] (-1388.647) (-1391.060) * (-1387.434) [-1388.169] (-1389.835) (-1389.959) -- 0:00:13 779000 -- (-1387.199) [-1392.883] (-1391.327) (-1390.209) * (-1387.387) (-1389.306) [-1387.597] (-1390.454) -- 0:00:13 779500 -- (-1388.258) (-1387.843) [-1393.605] (-1390.616) * (-1389.999) [-1389.040] (-1389.239) (-1389.879) -- 0:00:13 780000 -- (-1387.654) (-1389.456) [-1394.074] (-1389.476) * (-1389.930) (-1395.435) [-1389.808] (-1388.876) -- 0:00:13 Average standard deviation of split frequencies: 0.006924 780500 -- [-1387.739] (-1388.787) (-1387.341) (-1388.730) * (-1389.285) [-1390.003] (-1390.432) (-1390.285) -- 0:00:13 781000 -- (-1389.785) (-1388.935) (-1388.072) [-1388.003] * (-1388.620) (-1387.241) (-1389.703) [-1387.180] -- 0:00:13 781500 -- (-1388.768) (-1389.123) [-1389.743] (-1388.005) * (-1386.564) [-1387.364] (-1389.365) (-1387.470) -- 0:00:13 782000 -- (-1390.319) (-1389.042) [-1392.766] (-1389.391) * (-1389.859) (-1388.564) [-1390.112] (-1391.884) -- 0:00:13 782500 -- (-1387.320) [-1387.700] (-1390.324) (-1388.805) * (-1388.092) (-1390.852) (-1388.682) [-1390.465] -- 0:00:13 783000 -- [-1389.544] (-1388.147) (-1388.343) (-1389.753) * (-1386.441) (-1391.268) (-1388.140) [-1387.365] -- 0:00:13 783500 -- (-1387.967) [-1388.479] (-1387.749) (-1391.131) * (-1388.861) [-1389.810] (-1388.724) (-1386.205) -- 0:00:13 784000 -- (-1387.922) (-1387.216) (-1386.691) [-1388.275] * (-1388.501) (-1387.037) [-1386.941] (-1387.042) -- 0:00:13 784500 -- (-1387.388) [-1389.942] (-1386.908) (-1387.752) * (-1389.234) (-1388.515) [-1387.953] (-1387.472) -- 0:00:13 785000 -- (-1388.499) [-1388.372] (-1387.497) (-1388.227) * (-1387.435) (-1388.530) (-1387.644) [-1387.007] -- 0:00:13 Average standard deviation of split frequencies: 0.007197 785500 -- (-1390.262) (-1387.760) [-1388.519] (-1388.884) * (-1387.812) [-1388.499] (-1387.841) (-1387.152) -- 0:00:13 786000 -- (-1386.695) (-1390.428) [-1391.011] (-1387.203) * [-1388.711] (-1388.208) (-1389.243) (-1387.638) -- 0:00:13 786500 -- (-1386.412) (-1389.625) [-1391.219] (-1386.580) * [-1388.781] (-1386.579) (-1387.117) (-1387.944) -- 0:00:13 787000 -- [-1388.057] (-1389.733) (-1392.661) (-1388.166) * [-1392.442] (-1386.800) (-1386.335) (-1391.035) -- 0:00:13 787500 -- (-1387.079) [-1389.926] (-1390.559) (-1390.791) * (-1390.715) [-1386.807] (-1387.183) (-1393.051) -- 0:00:13 788000 -- (-1390.235) (-1389.273) (-1387.470) [-1389.978] * [-1386.617] (-1388.531) (-1387.373) (-1389.749) -- 0:00:13 788500 -- (-1387.714) (-1390.956) [-1391.744] (-1390.495) * (-1388.006) [-1387.127] (-1388.656) (-1393.425) -- 0:00:13 789000 -- (-1388.321) (-1389.125) [-1388.426] (-1389.367) * (-1387.286) (-1388.857) [-1387.016] (-1388.787) -- 0:00:13 789500 -- (-1389.129) (-1388.856) (-1389.367) [-1387.544] * (-1387.642) (-1389.224) [-1388.856] (-1388.897) -- 0:00:13 790000 -- (-1388.463) (-1387.093) (-1388.214) [-1387.945] * (-1387.519) [-1388.346] (-1387.706) (-1390.195) -- 0:00:13 Average standard deviation of split frequencies: 0.006638 790500 -- [-1389.624] (-1387.080) (-1386.980) (-1388.205) * (-1386.228) [-1387.635] (-1387.790) (-1386.776) -- 0:00:13 791000 -- [-1388.199] (-1388.743) (-1389.196) (-1391.029) * (-1386.785) [-1388.447] (-1388.422) (-1390.090) -- 0:00:13 791500 -- [-1389.869] (-1387.442) (-1387.476) (-1386.940) * (-1392.878) [-1390.293] (-1387.468) (-1388.145) -- 0:00:13 792000 -- (-1394.316) (-1386.695) (-1387.997) [-1388.074] * [-1387.959] (-1390.882) (-1387.196) (-1389.180) -- 0:00:13 792500 -- [-1390.716] (-1386.909) (-1388.926) (-1390.784) * (-1388.601) (-1390.823) [-1387.938] (-1391.906) -- 0:00:13 793000 -- (-1388.284) (-1386.730) (-1388.735) [-1389.289] * (-1394.775) (-1389.113) (-1388.694) [-1391.826] -- 0:00:13 793500 -- (-1389.756) [-1388.332] (-1391.925) (-1387.446) * (-1386.825) (-1388.530) (-1387.602) [-1387.793] -- 0:00:13 794000 -- [-1390.159] (-1386.477) (-1389.179) (-1391.325) * (-1388.416) [-1388.460] (-1388.081) (-1388.283) -- 0:00:12 794500 -- (-1388.417) (-1387.614) (-1386.426) [-1391.614] * (-1390.184) [-1388.802] (-1389.559) (-1388.283) -- 0:00:12 795000 -- (-1391.001) (-1389.592) [-1386.963] (-1396.789) * (-1389.198) [-1388.979] (-1388.371) (-1390.272) -- 0:00:12 Average standard deviation of split frequencies: 0.006317 795500 -- [-1386.822] (-1390.225) (-1387.347) (-1389.682) * [-1390.379] (-1388.148) (-1388.468) (-1393.790) -- 0:00:12 796000 -- (-1387.118) [-1391.949] (-1388.685) (-1389.387) * [-1389.117] (-1389.228) (-1386.381) (-1389.731) -- 0:00:12 796500 -- [-1391.658] (-1389.309) (-1388.398) (-1389.969) * (-1388.449) [-1390.790] (-1387.338) (-1387.152) -- 0:00:12 797000 -- (-1392.286) (-1386.580) [-1387.313] (-1386.764) * (-1388.902) (-1388.100) [-1387.154] (-1387.742) -- 0:00:12 797500 -- (-1392.257) (-1389.281) [-1386.479] (-1389.483) * (-1391.856) [-1388.678] (-1387.357) (-1388.567) -- 0:00:12 798000 -- [-1388.443] (-1387.085) (-1392.675) (-1386.916) * (-1389.379) (-1387.869) [-1389.328] (-1387.993) -- 0:00:12 798500 -- (-1388.458) [-1388.264] (-1391.506) (-1392.428) * (-1390.647) [-1388.561] (-1390.510) (-1388.253) -- 0:00:12 799000 -- (-1388.996) (-1388.976) (-1391.569) [-1388.607] * (-1386.551) (-1389.174) [-1389.674] (-1387.800) -- 0:00:12 799500 -- [-1387.363] (-1388.976) (-1388.124) (-1387.758) * (-1387.868) [-1387.567] (-1391.371) (-1388.975) -- 0:00:12 800000 -- [-1388.481] (-1387.303) (-1388.960) (-1392.230) * (-1387.146) (-1388.348) [-1388.418] (-1388.252) -- 0:00:12 Average standard deviation of split frequencies: 0.006045 800500 -- (-1388.526) (-1388.268) [-1387.200] (-1390.389) * [-1388.381] (-1387.423) (-1388.315) (-1387.826) -- 0:00:12 801000 -- (-1391.629) (-1390.224) [-1389.097] (-1388.452) * (-1388.161) (-1387.436) (-1388.515) [-1388.479] -- 0:00:12 801500 -- (-1388.226) (-1390.147) (-1388.269) [-1387.090] * (-1387.564) (-1390.900) [-1387.391] (-1389.556) -- 0:00:12 802000 -- (-1386.704) (-1390.507) [-1387.825] (-1386.973) * [-1388.769] (-1387.447) (-1393.621) (-1388.452) -- 0:00:12 802500 -- (-1388.184) (-1391.133) (-1387.178) [-1387.468] * (-1392.939) [-1390.001] (-1388.181) (-1388.662) -- 0:00:12 803000 -- [-1388.975] (-1392.025) (-1386.950) (-1388.066) * (-1391.807) (-1388.222) (-1390.081) [-1389.017] -- 0:00:12 803500 -- (-1391.931) (-1388.423) [-1387.284] (-1387.711) * [-1388.648] (-1392.988) (-1388.129) (-1387.504) -- 0:00:12 804000 -- (-1389.120) [-1393.514] (-1391.373) (-1391.596) * (-1392.367) [-1390.363] (-1390.280) (-1387.549) -- 0:00:12 804500 -- (-1388.200) (-1392.918) [-1390.004] (-1390.267) * (-1388.173) (-1387.325) (-1390.107) [-1388.445] -- 0:00:12 805000 -- [-1387.444] (-1388.849) (-1388.559) (-1389.377) * (-1387.755) (-1393.373) [-1388.098] (-1392.016) -- 0:00:12 Average standard deviation of split frequencies: 0.006083 805500 -- (-1387.026) (-1391.386) (-1395.213) [-1387.478] * (-1391.458) (-1386.814) (-1388.439) [-1389.208] -- 0:00:12 806000 -- [-1387.191] (-1390.626) (-1389.469) (-1386.675) * (-1394.835) (-1400.760) [-1388.095] (-1387.285) -- 0:00:12 806500 -- (-1388.360) (-1392.316) (-1388.320) [-1388.709] * (-1394.387) (-1390.079) [-1388.074] (-1386.167) -- 0:00:12 807000 -- (-1389.257) [-1389.452] (-1387.966) (-1389.619) * (-1387.023) (-1387.220) [-1389.408] (-1391.594) -- 0:00:12 807500 -- [-1387.827] (-1391.261) (-1390.631) (-1389.280) * [-1387.436] (-1386.941) (-1392.300) (-1389.398) -- 0:00:12 808000 -- (-1388.267) (-1391.105) (-1387.832) [-1388.233] * [-1387.422] (-1388.761) (-1390.102) (-1391.484) -- 0:00:12 808500 -- [-1388.194] (-1389.917) (-1394.963) (-1386.677) * (-1390.639) [-1390.101] (-1390.301) (-1388.529) -- 0:00:12 809000 -- (-1387.767) [-1387.506] (-1390.892) (-1387.530) * (-1389.332) [-1389.499] (-1391.109) (-1388.634) -- 0:00:12 809500 -- [-1388.427] (-1387.487) (-1391.736) (-1387.499) * [-1389.392] (-1391.224) (-1389.833) (-1386.862) -- 0:00:12 810000 -- [-1390.577] (-1389.396) (-1390.511) (-1388.730) * (-1389.289) (-1387.144) (-1389.274) [-1387.159] -- 0:00:11 Average standard deviation of split frequencies: 0.006009 810500 -- (-1391.226) (-1389.651) (-1387.859) [-1388.247] * [-1386.935] (-1388.621) (-1392.667) (-1386.163) -- 0:00:11 811000 -- (-1393.667) [-1388.456] (-1387.523) (-1388.950) * (-1389.227) (-1390.548) [-1390.080] (-1388.060) -- 0:00:11 811500 -- (-1393.131) (-1386.866) [-1387.874] (-1388.516) * (-1390.199) (-1393.840) [-1388.127] (-1388.229) -- 0:00:11 812000 -- (-1388.091) (-1386.838) [-1387.148] (-1387.608) * (-1387.365) (-1388.723) [-1388.012] (-1389.252) -- 0:00:11 812500 -- [-1389.296] (-1390.340) (-1390.396) (-1388.405) * (-1396.251) (-1388.506) (-1390.509) [-1387.332] -- 0:00:11 813000 -- (-1389.898) (-1390.958) [-1390.539] (-1389.992) * (-1388.107) (-1390.460) [-1388.741] (-1387.368) -- 0:00:11 813500 -- (-1390.665) [-1390.461] (-1388.632) (-1389.724) * (-1390.980) (-1387.460) [-1387.100] (-1388.738) -- 0:00:11 814000 -- (-1387.041) [-1388.428] (-1386.966) (-1391.573) * (-1390.581) [-1387.528] (-1389.243) (-1389.730) -- 0:00:11 814500 -- (-1386.613) (-1388.131) (-1391.262) [-1387.896] * [-1389.241] (-1387.994) (-1387.663) (-1387.992) -- 0:00:11 815000 -- (-1387.096) [-1389.639] (-1391.525) (-1387.838) * (-1390.979) [-1387.438] (-1388.713) (-1388.439) -- 0:00:11 Average standard deviation of split frequencies: 0.006239 815500 -- (-1389.278) [-1386.915] (-1389.286) (-1387.482) * (-1388.328) (-1387.182) (-1392.028) [-1388.799] -- 0:00:11 816000 -- (-1387.674) [-1386.791] (-1388.523) (-1386.228) * (-1389.608) [-1389.045] (-1388.089) (-1386.536) -- 0:00:11 816500 -- (-1394.551) (-1386.564) [-1386.549] (-1386.749) * (-1388.566) (-1391.559) (-1390.500) [-1386.688] -- 0:00:11 817000 -- (-1386.216) (-1392.883) [-1387.411] (-1389.498) * (-1388.988) [-1390.035] (-1389.884) (-1390.991) -- 0:00:11 817500 -- (-1387.479) [-1388.406] (-1387.532) (-1387.970) * (-1391.104) (-1389.655) [-1386.093] (-1389.429) -- 0:00:11 818000 -- [-1390.386] (-1388.494) (-1390.239) (-1388.241) * [-1387.832] (-1392.625) (-1389.289) (-1389.699) -- 0:00:11 818500 -- [-1390.960] (-1387.432) (-1388.927) (-1388.756) * (-1390.078) (-1389.040) (-1388.995) [-1389.684] -- 0:00:11 819000 -- (-1388.646) [-1386.358] (-1390.403) (-1389.744) * (-1387.159) [-1388.914] (-1388.237) (-1387.596) -- 0:00:11 819500 -- (-1392.071) (-1390.516) [-1388.205] (-1388.937) * (-1387.101) (-1386.838) (-1387.730) [-1388.184] -- 0:00:11 820000 -- (-1390.271) (-1387.565) [-1387.416] (-1387.316) * [-1388.589] (-1390.053) (-1386.998) (-1392.891) -- 0:00:11 Average standard deviation of split frequencies: 0.006242 820500 -- [-1388.326] (-1388.523) (-1388.948) (-1386.984) * [-1387.233] (-1388.966) (-1389.180) (-1390.054) -- 0:00:11 821000 -- [-1388.206] (-1389.498) (-1387.613) (-1386.998) * [-1389.410] (-1388.265) (-1387.913) (-1386.651) -- 0:00:11 821500 -- (-1394.274) (-1388.693) (-1388.080) [-1391.209] * (-1387.417) (-1386.931) [-1387.459] (-1387.955) -- 0:00:11 822000 -- (-1387.376) (-1386.444) [-1389.008] (-1391.090) * (-1387.171) [-1387.096] (-1387.484) (-1394.236) -- 0:00:11 822500 -- (-1387.920) (-1387.703) (-1387.784) [-1387.029] * [-1387.269] (-1388.218) (-1388.804) (-1393.123) -- 0:00:11 823000 -- (-1388.713) [-1389.121] (-1387.910) (-1395.885) * (-1387.659) [-1388.397] (-1387.589) (-1388.365) -- 0:00:11 823500 -- (-1388.958) (-1387.236) (-1388.411) [-1388.724] * (-1386.507) [-1392.011] (-1387.699) (-1388.053) -- 0:00:11 824000 -- (-1391.116) [-1387.326] (-1389.330) (-1388.846) * [-1386.523] (-1387.350) (-1392.449) (-1390.032) -- 0:00:11 824500 -- (-1390.260) [-1387.665] (-1390.299) (-1387.679) * (-1387.271) (-1386.678) (-1389.501) [-1387.600] -- 0:00:11 825000 -- (-1386.164) (-1387.572) [-1392.842] (-1387.990) * [-1387.749] (-1387.366) (-1394.688) (-1390.125) -- 0:00:11 Average standard deviation of split frequencies: 0.006620 825500 -- (-1387.692) [-1390.763] (-1392.046) (-1387.877) * (-1387.333) (-1387.877) [-1392.994] (-1387.355) -- 0:00:10 826000 -- (-1389.029) (-1388.936) [-1388.959] (-1388.242) * [-1388.650] (-1387.638) (-1388.582) (-1388.873) -- 0:00:10 826500 -- (-1387.144) [-1388.390] (-1389.766) (-1386.631) * (-1390.374) (-1389.274) (-1390.887) [-1388.721] -- 0:00:10 827000 -- (-1386.715) [-1388.820] (-1387.884) (-1388.153) * (-1387.659) (-1389.252) [-1388.456] (-1386.982) -- 0:00:10 827500 -- (-1388.695) (-1392.516) (-1389.748) [-1387.416] * (-1388.028) (-1386.952) (-1393.981) [-1386.443] -- 0:00:10 828000 -- [-1386.352] (-1391.754) (-1386.905) (-1387.397) * (-1388.169) (-1388.725) (-1389.564) [-1386.864] -- 0:00:10 828500 -- (-1386.757) [-1389.150] (-1391.468) (-1387.622) * (-1387.259) (-1388.466) (-1389.367) [-1388.646] -- 0:00:10 829000 -- (-1390.148) (-1388.129) (-1390.413) [-1387.648] * (-1386.654) (-1388.883) (-1389.073) [-1388.756] -- 0:00:10 829500 -- (-1387.442) (-1390.808) (-1386.985) [-1388.051] * (-1386.176) (-1389.161) [-1390.809] (-1390.047) -- 0:00:10 830000 -- (-1387.660) (-1386.917) [-1386.985] (-1387.450) * (-1388.183) (-1390.857) [-1390.049] (-1387.870) -- 0:00:10 Average standard deviation of split frequencies: 0.006924 830500 -- (-1388.543) [-1387.621] (-1388.825) (-1390.057) * (-1388.184) [-1389.949] (-1391.251) (-1386.266) -- 0:00:10 831000 -- (-1388.273) (-1387.484) [-1389.088] (-1390.607) * (-1390.774) (-1387.970) (-1389.649) [-1388.801] -- 0:00:10 831500 -- (-1388.176) (-1390.431) [-1386.810] (-1387.281) * (-1387.511) (-1388.661) (-1387.530) [-1387.733] -- 0:00:10 832000 -- (-1389.742) (-1387.391) [-1386.311] (-1386.911) * (-1387.694) (-1391.216) (-1389.931) [-1390.162] -- 0:00:10 832500 -- (-1389.100) [-1388.211] (-1387.327) (-1386.667) * (-1387.974) (-1388.925) [-1387.190] (-1388.327) -- 0:00:10 833000 -- (-1389.044) (-1387.703) [-1391.715] (-1388.793) * [-1386.630] (-1391.737) (-1387.480) (-1387.976) -- 0:00:10 833500 -- (-1390.408) [-1387.003] (-1386.675) (-1388.096) * (-1393.133) (-1387.787) [-1387.840] (-1390.359) -- 0:00:10 834000 -- [-1392.450] (-1390.265) (-1386.609) (-1390.963) * (-1389.953) (-1388.797) [-1388.639] (-1388.613) -- 0:00:10 834500 -- (-1391.784) (-1395.844) [-1387.089] (-1388.141) * (-1386.692) [-1386.357] (-1391.127) (-1388.010) -- 0:00:10 835000 -- (-1392.555) (-1397.178) (-1387.198) [-1388.349] * (-1388.956) (-1390.960) [-1389.503] (-1388.522) -- 0:00:10 Average standard deviation of split frequencies: 0.006767 835500 -- (-1387.767) (-1388.448) (-1386.678) [-1386.880] * (-1387.496) (-1388.537) [-1387.402] (-1390.364) -- 0:00:10 836000 -- [-1388.246] (-1392.847) (-1387.479) (-1391.787) * (-1390.836) (-1387.144) [-1388.027] (-1389.089) -- 0:00:10 836500 -- (-1386.747) (-1388.049) [-1387.702] (-1388.077) * (-1390.273) [-1387.099] (-1388.525) (-1387.622) -- 0:00:10 837000 -- (-1389.516) [-1386.660] (-1386.751) (-1395.934) * (-1387.820) (-1386.363) (-1386.801) [-1387.987] -- 0:00:10 837500 -- (-1389.209) (-1387.971) (-1387.704) [-1390.564] * (-1386.654) (-1386.363) [-1388.510] (-1388.979) -- 0:00:10 838000 -- [-1388.037] (-1387.097) (-1387.281) (-1388.388) * [-1393.589] (-1387.726) (-1390.500) (-1386.535) -- 0:00:10 838500 -- (-1389.353) [-1387.093] (-1387.563) (-1386.301) * (-1390.264) (-1387.373) [-1386.972] (-1387.246) -- 0:00:10 839000 -- [-1388.177] (-1386.902) (-1388.033) (-1388.023) * (-1388.654) [-1389.390] (-1388.221) (-1388.629) -- 0:00:10 839500 -- (-1387.695) (-1388.843) [-1388.831] (-1391.078) * (-1386.143) (-1389.724) [-1389.516] (-1387.444) -- 0:00:10 840000 -- (-1389.489) (-1387.436) (-1388.987) [-1387.735] * (-1389.604) [-1390.730] (-1386.392) (-1387.869) -- 0:00:10 Average standard deviation of split frequencies: 0.006841 840500 -- (-1390.881) (-1386.454) (-1387.205) [-1386.550] * [-1387.950] (-1387.989) (-1386.923) (-1387.666) -- 0:00:10 841000 -- (-1388.457) [-1386.763] (-1390.061) (-1389.309) * [-1389.069] (-1387.052) (-1388.071) (-1387.637) -- 0:00:10 841500 -- (-1387.900) [-1387.199] (-1388.580) (-1393.428) * (-1388.128) (-1388.781) [-1388.082] (-1386.863) -- 0:00:09 842000 -- (-1388.730) (-1394.809) [-1386.621] (-1387.789) * [-1388.443] (-1388.683) (-1386.543) (-1387.793) -- 0:00:09 842500 -- (-1389.948) (-1389.755) (-1388.144) [-1390.860] * (-1394.148) [-1388.646] (-1389.191) (-1387.085) -- 0:00:09 843000 -- [-1388.546] (-1388.871) (-1387.077) (-1390.464) * (-1387.575) (-1387.062) [-1389.626] (-1388.265) -- 0:00:09 843500 -- (-1388.043) (-1388.180) (-1387.851) [-1389.369] * (-1387.925) [-1386.986] (-1388.966) (-1387.999) -- 0:00:09 844000 -- (-1391.411) [-1387.069] (-1390.027) (-1388.215) * (-1387.457) [-1387.710] (-1387.631) (-1387.554) -- 0:00:09 844500 -- (-1389.513) (-1388.837) (-1388.032) [-1390.270] * (-1390.859) [-1387.893] (-1390.793) (-1387.277) -- 0:00:09 845000 -- [-1392.650] (-1387.720) (-1387.909) (-1388.863) * (-1387.060) (-1387.557) (-1392.989) [-1389.715] -- 0:00:09 Average standard deviation of split frequencies: 0.006649 845500 -- [-1388.023] (-1390.279) (-1386.379) (-1389.204) * (-1391.745) [-1388.851] (-1391.615) (-1393.037) -- 0:00:09 846000 -- (-1390.056) [-1394.266] (-1387.429) (-1387.062) * (-1388.115) [-1386.394] (-1393.981) (-1387.381) -- 0:00:09 846500 -- (-1388.668) (-1392.294) [-1388.611] (-1387.173) * (-1391.992) [-1388.343] (-1391.627) (-1389.596) -- 0:00:09 847000 -- (-1387.008) (-1387.315) [-1391.349] (-1391.846) * (-1387.742) [-1386.955] (-1388.791) (-1389.191) -- 0:00:09 847500 -- (-1387.837) [-1387.181] (-1387.633) (-1388.699) * [-1390.219] (-1386.560) (-1389.333) (-1387.069) -- 0:00:09 848000 -- (-1391.393) [-1387.599] (-1389.047) (-1388.449) * (-1389.126) (-1388.623) [-1387.528] (-1386.633) -- 0:00:09 848500 -- (-1388.386) (-1389.080) (-1386.698) [-1388.692] * (-1387.987) (-1389.370) (-1387.929) [-1388.554] -- 0:00:09 849000 -- (-1387.045) (-1388.838) [-1387.281] (-1388.185) * (-1390.763) [-1389.126] (-1387.793) (-1389.259) -- 0:00:09 849500 -- [-1387.909] (-1389.508) (-1386.740) (-1388.135) * (-1390.955) (-1387.519) (-1387.626) [-1391.745] -- 0:00:09 850000 -- (-1389.768) [-1391.235] (-1387.411) (-1388.005) * (-1388.344) (-1389.265) [-1387.106] (-1386.139) -- 0:00:09 Average standard deviation of split frequencies: 0.007204 850500 -- (-1390.223) [-1388.186] (-1387.316) (-1388.973) * (-1388.366) [-1387.264] (-1389.298) (-1386.357) -- 0:00:09 851000 -- (-1397.011) [-1386.659] (-1387.318) (-1387.636) * [-1389.033] (-1388.996) (-1389.131) (-1386.432) -- 0:00:09 851500 -- (-1388.472) [-1391.095] (-1386.961) (-1387.805) * (-1387.380) (-1388.763) [-1388.202] (-1386.778) -- 0:00:09 852000 -- (-1389.987) (-1387.238) [-1387.712] (-1388.912) * (-1387.057) (-1389.326) [-1387.965] (-1392.966) -- 0:00:09 852500 -- (-1390.587) [-1387.282] (-1387.164) (-1388.938) * (-1388.559) [-1390.870] (-1389.656) (-1392.893) -- 0:00:09 853000 -- (-1393.988) [-1389.351] (-1386.575) (-1386.729) * (-1386.683) [-1390.545] (-1389.954) (-1388.540) -- 0:00:09 853500 -- (-1392.187) (-1390.545) (-1387.237) [-1388.803] * [-1387.520] (-1391.976) (-1390.436) (-1388.743) -- 0:00:09 854000 -- (-1387.025) (-1389.503) (-1389.404) [-1387.361] * [-1386.883] (-1388.590) (-1389.117) (-1390.341) -- 0:00:09 854500 -- (-1386.688) (-1387.365) (-1388.508) [-1387.071] * (-1390.755) [-1390.194] (-1389.089) (-1390.188) -- 0:00:09 855000 -- (-1386.749) [-1387.025] (-1390.350) (-1390.782) * (-1389.864) [-1387.324] (-1388.588) (-1389.365) -- 0:00:09 Average standard deviation of split frequencies: 0.007673 855500 -- [-1387.194] (-1391.676) (-1389.355) (-1392.704) * [-1388.307] (-1389.155) (-1387.314) (-1390.516) -- 0:00:09 856000 -- (-1387.068) (-1389.288) [-1389.983] (-1389.414) * (-1388.497) [-1389.528] (-1386.600) (-1388.275) -- 0:00:09 856500 -- (-1389.367) (-1393.790) [-1387.536] (-1390.460) * (-1388.466) (-1389.912) (-1386.433) [-1387.879] -- 0:00:09 857000 -- [-1386.599] (-1389.354) (-1388.716) (-1387.429) * (-1388.214) [-1388.158] (-1386.631) (-1388.420) -- 0:00:09 857500 -- (-1389.581) (-1386.569) (-1389.636) [-1387.754] * (-1392.326) (-1387.634) [-1389.186] (-1387.273) -- 0:00:08 858000 -- (-1388.088) [-1387.087] (-1388.487) (-1387.934) * (-1388.759) [-1389.997] (-1392.209) (-1388.327) -- 0:00:08 858500 -- (-1387.465) (-1392.372) (-1389.710) [-1388.578] * (-1386.346) (-1387.364) (-1389.517) [-1391.574] -- 0:00:08 859000 -- [-1387.593] (-1391.237) (-1387.920) (-1386.764) * (-1388.075) (-1390.192) [-1390.588] (-1388.180) -- 0:00:08 859500 -- [-1388.512] (-1390.594) (-1387.757) (-1388.440) * (-1390.241) (-1389.991) (-1386.851) [-1388.478] -- 0:00:08 860000 -- [-1388.576] (-1389.012) (-1388.952) (-1390.097) * (-1394.916) (-1390.834) [-1387.563] (-1387.290) -- 0:00:08 Average standard deviation of split frequencies: 0.007632 860500 -- (-1389.103) [-1388.891] (-1389.481) (-1389.003) * (-1389.255) (-1390.881) (-1386.478) [-1388.549] -- 0:00:08 861000 -- (-1386.214) [-1387.715] (-1394.458) (-1387.049) * (-1392.242) [-1389.466] (-1386.629) (-1389.435) -- 0:00:08 861500 -- (-1387.727) (-1392.513) (-1387.954) [-1386.827] * (-1387.583) [-1387.767] (-1394.368) (-1388.136) -- 0:00:08 862000 -- (-1390.631) (-1389.934) [-1390.492] (-1387.093) * (-1389.673) (-1388.340) (-1388.807) [-1387.696] -- 0:00:08 862500 -- (-1387.146) [-1387.167] (-1387.608) (-1388.310) * (-1387.257) (-1390.387) [-1389.929] (-1387.326) -- 0:00:08 863000 -- (-1387.217) (-1387.715) (-1389.430) [-1389.849] * (-1387.048) (-1391.141) (-1391.886) [-1388.159] -- 0:00:08 863500 -- (-1389.612) [-1389.009] (-1388.692) (-1392.127) * (-1388.482) (-1391.816) [-1389.407] (-1388.934) -- 0:00:08 864000 -- [-1387.814] (-1388.667) (-1388.639) (-1392.604) * [-1388.026] (-1390.560) (-1387.368) (-1390.994) -- 0:00:08 864500 -- (-1389.023) [-1387.083] (-1389.433) (-1387.814) * (-1388.267) [-1390.150] (-1386.854) (-1387.787) -- 0:00:08 865000 -- (-1389.971) (-1391.498) (-1388.898) [-1390.460] * (-1387.270) (-1388.502) (-1387.339) [-1389.816] -- 0:00:08 Average standard deviation of split frequencies: 0.007875 865500 -- (-1390.563) (-1391.139) (-1386.627) [-1387.544] * (-1388.495) (-1392.416) (-1387.963) [-1394.193] -- 0:00:08 866000 -- (-1389.203) [-1389.910] (-1385.973) (-1387.637) * (-1389.758) (-1389.342) [-1389.431] (-1387.413) -- 0:00:08 866500 -- (-1391.286) (-1389.080) (-1387.802) [-1387.120] * (-1390.272) (-1390.572) (-1388.642) [-1386.502] -- 0:00:08 867000 -- (-1391.172) [-1387.016] (-1387.333) (-1389.701) * (-1388.119) [-1388.114] (-1389.490) (-1388.163) -- 0:00:08 867500 -- (-1391.554) [-1387.188] (-1390.763) (-1387.776) * (-1388.473) (-1387.528) [-1390.671] (-1388.942) -- 0:00:08 868000 -- (-1387.734) (-1389.322) [-1391.087] (-1388.801) * (-1389.486) (-1388.739) [-1389.946] (-1388.483) -- 0:00:08 868500 -- (-1389.680) [-1387.719] (-1389.800) (-1389.450) * (-1387.396) (-1386.224) (-1387.789) [-1387.407] -- 0:00:08 869000 -- (-1386.916) (-1388.004) (-1387.364) [-1388.679] * (-1387.144) (-1386.923) (-1388.982) [-1387.104] -- 0:00:08 869500 -- (-1387.319) [-1387.544] (-1389.331) (-1386.773) * [-1391.956] (-1388.118) (-1387.631) (-1390.316) -- 0:00:08 870000 -- (-1386.361) [-1388.500] (-1388.800) (-1387.139) * (-1394.241) (-1388.516) [-1387.220] (-1390.748) -- 0:00:08 Average standard deviation of split frequencies: 0.007833 870500 -- (-1387.884) (-1389.098) [-1391.343] (-1390.527) * (-1391.896) (-1388.215) [-1390.014] (-1392.211) -- 0:00:08 871000 -- (-1388.151) (-1389.789) (-1388.010) [-1387.226] * (-1393.261) (-1389.513) [-1387.192] (-1387.389) -- 0:00:08 871500 -- (-1387.357) (-1387.613) (-1388.775) [-1389.389] * (-1389.696) [-1386.886] (-1389.155) (-1388.458) -- 0:00:08 872000 -- (-1389.313) (-1386.992) (-1390.291) [-1389.307] * (-1386.462) (-1389.132) [-1389.025] (-1390.263) -- 0:00:08 872500 -- (-1391.060) (-1386.309) (-1387.744) [-1389.964] * (-1392.793) (-1387.831) [-1388.759] (-1388.130) -- 0:00:08 873000 -- (-1387.040) (-1386.867) [-1387.839] (-1390.833) * (-1390.003) (-1389.466) [-1387.536] (-1387.885) -- 0:00:08 873500 -- [-1387.328] (-1387.641) (-1389.229) (-1389.932) * [-1388.576] (-1386.238) (-1387.741) (-1386.570) -- 0:00:07 874000 -- (-1387.578) (-1389.616) [-1386.232] (-1388.035) * (-1388.655) [-1386.146] (-1390.825) (-1389.075) -- 0:00:07 874500 -- (-1387.334) (-1389.155) [-1387.603] (-1387.342) * (-1388.518) (-1387.886) [-1393.996] (-1390.129) -- 0:00:07 875000 -- (-1387.350) (-1388.471) (-1388.823) [-1386.912] * (-1388.236) [-1388.179] (-1388.834) (-1387.895) -- 0:00:07 Average standard deviation of split frequencies: 0.007821 875500 -- (-1389.002) (-1389.794) [-1388.492] (-1387.505) * (-1390.185) (-1388.644) (-1387.493) [-1388.796] -- 0:00:07 876000 -- [-1388.607] (-1388.017) (-1391.032) (-1388.964) * (-1387.628) (-1389.650) [-1387.521] (-1388.764) -- 0:00:07 876500 -- (-1391.417) (-1388.047) [-1387.332] (-1388.215) * (-1388.061) (-1390.319) (-1387.919) [-1388.709] -- 0:00:07 877000 -- (-1389.661) [-1388.427] (-1387.521) (-1390.315) * (-1392.814) (-1388.435) (-1388.791) [-1388.619] -- 0:00:07 877500 -- (-1387.383) (-1387.631) (-1388.679) [-1388.446] * [-1387.669] (-1387.716) (-1387.552) (-1387.093) -- 0:00:07 878000 -- [-1387.755] (-1391.264) (-1388.178) (-1388.492) * (-1387.068) (-1390.383) [-1386.971] (-1390.683) -- 0:00:07 878500 -- (-1391.234) [-1389.421] (-1386.787) (-1388.096) * (-1391.817) (-1391.785) [-1386.904] (-1388.048) -- 0:00:07 879000 -- (-1388.321) (-1391.516) (-1387.956) [-1387.256] * [-1388.654] (-1394.272) (-1387.101) (-1387.331) -- 0:00:07 879500 -- (-1388.744) (-1391.201) [-1388.156] (-1396.470) * (-1388.485) (-1391.764) (-1387.220) [-1387.602] -- 0:00:07 880000 -- (-1390.008) (-1389.161) (-1389.225) [-1389.174] * (-1388.947) (-1389.464) [-1387.393] (-1387.077) -- 0:00:07 Average standard deviation of split frequencies: 0.008029 880500 -- (-1389.041) (-1388.636) [-1386.315] (-1387.559) * (-1388.820) [-1389.643] (-1388.242) (-1386.447) -- 0:00:07 881000 -- (-1390.530) (-1389.319) [-1387.913] (-1387.985) * (-1387.850) (-1387.179) (-1387.420) [-1387.318] -- 0:00:07 881500 -- (-1386.366) [-1389.932] (-1391.942) (-1388.930) * (-1390.276) (-1389.869) (-1397.597) [-1388.473] -- 0:00:07 882000 -- (-1387.910) (-1388.037) [-1386.895] (-1392.936) * [-1388.909] (-1390.816) (-1387.636) (-1387.054) -- 0:00:07 882500 -- (-1389.386) (-1386.594) [-1389.592] (-1388.597) * [-1386.306] (-1388.410) (-1388.443) (-1387.085) -- 0:00:07 883000 -- (-1388.141) (-1386.640) (-1391.979) [-1391.206] * (-1387.239) (-1387.654) [-1389.587] (-1387.716) -- 0:00:07 883500 -- (-1387.807) (-1386.373) (-1394.280) [-1387.559] * (-1387.664) (-1388.973) (-1390.539) [-1389.270] -- 0:00:07 884000 -- (-1389.702) (-1388.137) [-1387.068] (-1389.467) * (-1387.001) [-1388.597] (-1387.959) (-1388.226) -- 0:00:07 884500 -- (-1389.734) (-1386.902) [-1387.257] (-1387.131) * (-1386.898) (-1387.581) [-1388.010] (-1386.800) -- 0:00:07 885000 -- (-1390.081) (-1388.310) (-1387.344) [-1387.059] * (-1389.819) (-1387.582) [-1389.002] (-1388.730) -- 0:00:07 Average standard deviation of split frequencies: 0.008194 885500 -- (-1387.780) (-1387.109) (-1386.184) [-1387.890] * (-1394.008) (-1386.909) [-1386.271] (-1388.835) -- 0:00:07 886000 -- (-1387.806) (-1388.818) [-1387.994] (-1387.854) * (-1391.200) [-1386.334] (-1387.349) (-1390.953) -- 0:00:07 886500 -- (-1389.408) (-1388.296) [-1387.706] (-1386.842) * (-1387.969) [-1387.245] (-1390.950) (-1388.803) -- 0:00:07 887000 -- (-1387.619) (-1389.736) (-1394.105) [-1387.183] * (-1388.333) (-1389.631) [-1386.955] (-1388.874) -- 0:00:07 887500 -- (-1389.709) (-1390.854) [-1391.874] (-1389.642) * (-1391.679) [-1387.716] (-1387.139) (-1388.929) -- 0:00:07 888000 -- (-1391.123) (-1390.148) (-1389.256) [-1387.296] * (-1389.140) (-1387.367) [-1386.369] (-1391.389) -- 0:00:07 888500 -- (-1389.798) (-1388.188) [-1389.128] (-1387.800) * (-1388.418) (-1386.564) [-1387.924] (-1392.164) -- 0:00:07 889000 -- (-1387.985) (-1391.028) [-1388.661] (-1386.231) * [-1387.828] (-1388.761) (-1387.976) (-1394.859) -- 0:00:06 889500 -- (-1389.699) [-1389.603] (-1389.751) (-1390.715) * (-1387.657) (-1389.116) [-1389.439] (-1388.148) -- 0:00:06 890000 -- [-1388.554] (-1391.238) (-1388.398) (-1388.079) * (-1387.761) (-1392.029) [-1387.221] (-1390.070) -- 0:00:06 Average standard deviation of split frequencies: 0.008539 890500 -- (-1388.236) (-1387.446) (-1389.230) [-1387.554] * (-1388.857) [-1387.626] (-1388.932) (-1387.325) -- 0:00:06 891000 -- [-1388.070] (-1386.202) (-1389.642) (-1388.364) * (-1389.114) (-1389.352) [-1388.981] (-1386.901) -- 0:00:06 891500 -- [-1389.995] (-1387.741) (-1388.737) (-1391.301) * (-1391.918) [-1390.702] (-1387.875) (-1390.946) -- 0:00:06 892000 -- (-1389.893) (-1387.495) (-1388.203) [-1388.914] * [-1389.548] (-1388.011) (-1388.810) (-1392.751) -- 0:00:06 892500 -- (-1387.548) [-1388.351] (-1388.029) (-1390.337) * [-1387.934] (-1387.989) (-1386.772) (-1394.245) -- 0:00:06 893000 -- (-1390.535) [-1387.271] (-1390.768) (-1387.535) * (-1387.313) (-1390.298) (-1387.751) [-1389.104] -- 0:00:06 893500 -- (-1391.077) [-1387.988] (-1389.311) (-1388.354) * (-1387.229) (-1389.435) (-1386.949) [-1390.148] -- 0:00:06 894000 -- (-1388.102) (-1386.795) (-1388.936) [-1386.738] * (-1389.063) [-1386.901] (-1389.246) (-1388.648) -- 0:00:06 894500 -- (-1387.114) [-1389.022] (-1388.490) (-1387.852) * (-1389.415) [-1387.745] (-1389.762) (-1388.696) -- 0:00:06 895000 -- (-1387.794) [-1389.333] (-1386.743) (-1386.560) * (-1388.988) (-1387.040) [-1388.611] (-1387.628) -- 0:00:06 Average standard deviation of split frequencies: 0.008558 895500 -- [-1388.070] (-1388.440) (-1387.678) (-1387.172) * [-1387.841] (-1390.235) (-1388.693) (-1387.316) -- 0:00:06 896000 -- (-1388.840) (-1387.460) (-1390.661) [-1389.533] * (-1387.254) [-1390.031] (-1387.006) (-1388.571) -- 0:00:06 896500 -- [-1389.221] (-1386.351) (-1387.661) (-1388.174) * (-1393.625) [-1389.079] (-1386.795) (-1387.153) -- 0:00:06 897000 -- [-1391.729] (-1389.069) (-1388.455) (-1389.346) * [-1389.212] (-1387.588) (-1389.468) (-1387.763) -- 0:00:06 897500 -- (-1390.379) [-1390.971] (-1389.881) (-1387.122) * (-1389.614) (-1389.836) [-1390.636] (-1388.898) -- 0:00:06 898000 -- (-1387.994) (-1392.920) [-1386.228] (-1387.461) * (-1386.593) (-1392.028) (-1386.842) [-1388.450] -- 0:00:06 898500 -- (-1387.822) [-1388.631] (-1386.405) (-1388.766) * (-1387.760) (-1388.518) (-1389.341) [-1390.891] -- 0:00:06 899000 -- [-1388.312] (-1386.588) (-1387.267) (-1388.460) * (-1388.164) [-1388.528] (-1395.414) (-1388.887) -- 0:00:06 899500 -- [-1389.081] (-1388.083) (-1386.966) (-1386.672) * [-1388.563] (-1387.939) (-1391.599) (-1392.045) -- 0:00:06 900000 -- (-1389.002) (-1386.463) (-1386.892) [-1388.873] * [-1386.948] (-1387.393) (-1388.411) (-1391.317) -- 0:00:06 Average standard deviation of split frequencies: 0.009037 900500 -- (-1390.840) [-1387.208] (-1387.026) (-1387.431) * (-1387.172) (-1387.731) [-1389.651] (-1388.329) -- 0:00:06 901000 -- (-1390.784) [-1387.655] (-1393.639) (-1390.299) * (-1387.928) [-1387.301] (-1391.387) (-1391.130) -- 0:00:06 901500 -- [-1389.026] (-1389.715) (-1388.162) (-1389.191) * (-1387.917) [-1389.821] (-1389.430) (-1391.152) -- 0:00:06 902000 -- (-1390.233) (-1387.704) [-1387.826] (-1392.197) * (-1386.498) (-1387.821) (-1386.937) [-1392.734] -- 0:00:06 902500 -- (-1389.801) (-1388.304) (-1394.372) [-1391.866] * (-1386.408) [-1386.914] (-1388.599) (-1387.131) -- 0:00:06 903000 -- (-1388.923) (-1386.863) (-1389.965) [-1388.352] * [-1387.040] (-1390.017) (-1387.398) (-1388.162) -- 0:00:06 903500 -- (-1387.125) (-1390.594) [-1389.759] (-1389.575) * [-1388.296] (-1388.818) (-1394.311) (-1388.871) -- 0:00:06 904000 -- [-1387.542] (-1391.957) (-1390.086) (-1389.221) * (-1387.015) (-1390.321) [-1387.575] (-1396.199) -- 0:00:06 904500 -- (-1389.947) [-1391.311] (-1386.849) (-1386.288) * [-1388.200] (-1389.402) (-1389.453) (-1388.741) -- 0:00:06 905000 -- (-1387.295) (-1388.447) [-1387.259] (-1386.565) * (-1389.761) [-1387.651] (-1389.565) (-1392.257) -- 0:00:05 Average standard deviation of split frequencies: 0.009008 905500 -- (-1388.298) (-1388.654) [-1388.863] (-1387.831) * (-1387.631) [-1386.215] (-1387.336) (-1389.128) -- 0:00:05 906000 -- (-1395.323) (-1392.093) (-1389.200) [-1386.712] * [-1388.508] (-1386.258) (-1391.600) (-1389.520) -- 0:00:05 906500 -- (-1390.056) (-1394.333) (-1391.571) [-1388.565] * (-1388.189) (-1386.942) (-1402.502) [-1386.132] -- 0:00:05 907000 -- (-1388.317) [-1389.834] (-1391.615) (-1386.474) * (-1388.017) (-1388.642) [-1394.859] (-1387.192) -- 0:00:05 907500 -- (-1394.087) [-1387.003] (-1393.318) (-1386.481) * [-1386.685] (-1389.141) (-1389.796) (-1386.294) -- 0:00:05 908000 -- (-1393.551) (-1389.006) (-1387.811) [-1386.663] * (-1387.386) (-1387.771) [-1387.582] (-1388.652) -- 0:00:05 908500 -- (-1388.254) [-1389.198] (-1387.234) (-1388.832) * (-1387.447) (-1393.318) [-1387.427] (-1387.697) -- 0:00:05 909000 -- (-1389.809) [-1386.881] (-1387.057) (-1388.627) * [-1390.543] (-1389.366) (-1386.976) (-1388.915) -- 0:00:05 909500 -- [-1388.073] (-1387.434) (-1390.302) (-1388.212) * (-1389.153) (-1387.176) [-1388.170] (-1388.784) -- 0:00:05 910000 -- [-1389.737] (-1392.314) (-1394.288) (-1386.744) * (-1388.926) [-1389.663] (-1387.982) (-1388.359) -- 0:00:05 Average standard deviation of split frequencies: 0.008962 910500 -- [-1387.191] (-1390.332) (-1387.807) (-1386.951) * (-1388.007) (-1388.624) (-1389.318) [-1389.239] -- 0:00:05 911000 -- (-1387.559) (-1388.434) [-1392.639] (-1387.640) * [-1388.104] (-1389.454) (-1389.192) (-1390.525) -- 0:00:05 911500 -- (-1388.694) (-1389.396) [-1387.473] (-1387.907) * (-1388.638) (-1389.595) [-1387.973] (-1388.800) -- 0:00:05 912000 -- (-1387.825) (-1386.971) [-1386.565] (-1388.036) * (-1389.026) [-1389.790] (-1387.147) (-1388.419) -- 0:00:05 912500 -- (-1388.608) (-1386.971) (-1387.154) [-1389.129] * [-1387.883] (-1388.223) (-1391.519) (-1389.573) -- 0:00:05 913000 -- [-1387.750] (-1386.978) (-1387.693) (-1387.633) * [-1387.559] (-1389.512) (-1390.370) (-1389.962) -- 0:00:05 913500 -- [-1389.937] (-1387.589) (-1388.098) (-1387.630) * (-1389.809) (-1387.994) (-1396.559) [-1389.200] -- 0:00:05 914000 -- (-1387.622) (-1387.463) (-1387.766) [-1387.511] * (-1386.884) (-1391.171) [-1389.697] (-1391.055) -- 0:00:05 914500 -- [-1386.822] (-1389.407) (-1390.721) (-1389.344) * (-1393.047) (-1391.126) (-1386.789) [-1387.551] -- 0:00:05 915000 -- (-1394.656) (-1386.764) (-1387.286) [-1387.263] * (-1387.688) [-1386.994] (-1388.700) (-1389.797) -- 0:00:05 Average standard deviation of split frequencies: 0.008877 915500 -- (-1394.365) [-1387.911] (-1387.558) (-1387.336) * (-1391.883) [-1387.719] (-1388.034) (-1388.754) -- 0:00:05 916000 -- (-1389.001) [-1386.765] (-1388.348) (-1387.259) * (-1387.419) (-1388.914) (-1386.269) [-1387.092] -- 0:00:05 916500 -- (-1387.483) (-1387.146) [-1387.764] (-1388.189) * (-1387.451) (-1389.444) [-1388.642] (-1386.085) -- 0:00:05 917000 -- [-1387.057] (-1388.761) (-1388.137) (-1390.033) * [-1387.067] (-1389.605) (-1387.568) (-1387.014) -- 0:00:05 917500 -- (-1389.693) (-1388.102) (-1388.344) [-1392.640] * (-1387.952) (-1386.786) [-1387.221] (-1390.132) -- 0:00:05 918000 -- [-1389.054] (-1391.160) (-1390.306) (-1387.475) * [-1390.272] (-1386.465) (-1390.440) (-1389.500) -- 0:00:05 918500 -- [-1388.960] (-1390.284) (-1386.601) (-1388.180) * (-1388.888) (-1386.460) (-1389.360) [-1387.443] -- 0:00:05 919000 -- [-1387.149] (-1386.851) (-1391.170) (-1388.293) * (-1387.493) [-1387.109] (-1391.908) (-1386.783) -- 0:00:05 919500 -- (-1386.923) [-1389.005] (-1390.187) (-1388.460) * (-1391.036) (-1388.950) (-1390.870) [-1388.311] -- 0:00:05 920000 -- (-1388.700) (-1386.200) (-1388.809) [-1393.302] * (-1388.124) [-1390.092] (-1389.334) (-1392.690) -- 0:00:05 Average standard deviation of split frequencies: 0.008704 920500 -- (-1387.411) (-1386.538) (-1389.000) [-1388.950] * (-1391.527) [-1388.014] (-1389.510) (-1392.742) -- 0:00:05 921000 -- [-1388.940] (-1386.777) (-1387.488) (-1387.800) * (-1391.345) [-1387.184] (-1390.541) (-1387.985) -- 0:00:04 921500 -- (-1392.497) (-1391.382) [-1386.965] (-1388.775) * [-1389.993] (-1387.177) (-1388.482) (-1387.856) -- 0:00:04 922000 -- (-1388.647) (-1387.475) (-1391.256) [-1390.725] * [-1387.715] (-1386.622) (-1390.122) (-1389.502) -- 0:00:04 922500 -- [-1389.441] (-1387.533) (-1390.716) (-1387.452) * (-1388.714) [-1387.118] (-1387.891) (-1386.879) -- 0:00:04 923000 -- (-1388.511) (-1387.813) [-1391.171] (-1388.872) * (-1388.139) [-1387.163] (-1387.666) (-1387.202) -- 0:00:04 923500 -- [-1386.592] (-1388.959) (-1390.267) (-1389.367) * (-1390.534) (-1387.414) [-1387.772] (-1387.269) -- 0:00:04 924000 -- [-1386.740] (-1386.539) (-1388.001) (-1386.405) * (-1392.140) [-1390.084] (-1388.758) (-1388.984) -- 0:00:04 924500 -- (-1388.316) [-1386.539] (-1386.148) (-1389.948) * [-1387.285] (-1390.740) (-1388.755) (-1386.885) -- 0:00:04 925000 -- [-1392.191] (-1387.823) (-1387.236) (-1389.733) * (-1386.939) (-1387.885) [-1388.652] (-1387.849) -- 0:00:04 Average standard deviation of split frequencies: 0.008463 925500 -- (-1390.258) [-1390.054] (-1388.084) (-1387.902) * (-1386.418) [-1387.637] (-1390.173) (-1389.058) -- 0:00:04 926000 -- (-1387.144) (-1393.491) (-1387.349) [-1386.601] * (-1386.485) (-1387.891) (-1388.943) [-1388.560] -- 0:00:04 926500 -- (-1391.305) (-1388.045) (-1391.068) [-1389.599] * (-1390.318) [-1387.521] (-1388.064) (-1387.422) -- 0:00:04 927000 -- (-1392.743) (-1391.727) [-1388.404] (-1389.046) * (-1388.657) (-1387.163) [-1387.481] (-1387.904) -- 0:00:04 927500 -- [-1389.683] (-1387.171) (-1386.926) (-1393.196) * [-1387.190] (-1387.231) (-1388.461) (-1390.707) -- 0:00:04 928000 -- (-1389.956) (-1388.511) [-1388.710] (-1388.614) * (-1388.993) (-1389.967) (-1389.880) [-1389.134] -- 0:00:04 928500 -- (-1387.601) [-1386.473] (-1389.544) (-1388.691) * (-1387.740) (-1387.443) (-1388.102) [-1388.516] -- 0:00:04 929000 -- [-1387.780] (-1389.116) (-1389.810) (-1389.729) * (-1386.514) [-1392.673] (-1387.565) (-1388.628) -- 0:00:04 929500 -- (-1387.882) (-1387.464) [-1388.375] (-1387.069) * [-1387.187] (-1392.477) (-1390.028) (-1386.345) -- 0:00:04 930000 -- (-1389.394) (-1387.056) [-1388.365] (-1386.931) * [-1388.752] (-1387.569) (-1392.241) (-1391.699) -- 0:00:04 Average standard deviation of split frequencies: 0.008453 930500 -- (-1388.060) (-1387.934) (-1387.900) [-1390.173] * (-1387.914) [-1388.651] (-1386.642) (-1389.369) -- 0:00:04 931000 -- (-1393.302) [-1389.607] (-1386.865) (-1388.852) * (-1393.685) (-1388.844) (-1388.527) [-1388.286] -- 0:00:04 931500 -- [-1386.938] (-1388.139) (-1386.770) (-1392.600) * (-1390.673) (-1388.160) (-1389.384) [-1389.540] -- 0:00:04 932000 -- (-1388.585) [-1388.211] (-1386.452) (-1388.589) * (-1388.472) [-1388.519] (-1388.785) (-1390.148) -- 0:00:04 932500 -- [-1387.532] (-1389.514) (-1387.530) (-1392.802) * (-1389.069) (-1387.842) [-1388.884] (-1386.798) -- 0:00:04 933000 -- [-1386.240] (-1387.036) (-1387.553) (-1386.986) * [-1386.363] (-1388.820) (-1386.910) (-1388.074) -- 0:00:04 933500 -- [-1389.491] (-1386.582) (-1389.146) (-1390.268) * [-1387.016] (-1388.208) (-1386.733) (-1387.879) -- 0:00:04 934000 -- (-1391.750) (-1388.358) (-1387.702) [-1388.067] * (-1387.312) [-1387.895] (-1387.068) (-1388.815) -- 0:00:04 934500 -- (-1386.533) (-1389.247) [-1387.803] (-1387.188) * (-1387.992) (-1390.607) [-1391.050] (-1391.544) -- 0:00:04 935000 -- [-1387.610] (-1387.567) (-1391.645) (-1390.578) * (-1388.750) [-1387.583] (-1388.073) (-1392.253) -- 0:00:04 Average standard deviation of split frequencies: 0.008310 935500 -- (-1387.786) (-1389.426) (-1390.975) [-1387.574] * (-1388.538) (-1388.571) [-1387.798] (-1388.165) -- 0:00:04 936000 -- [-1386.378] (-1387.393) (-1388.130) (-1387.561) * (-1390.413) [-1389.543] (-1390.453) (-1387.421) -- 0:00:04 936500 -- (-1386.984) [-1387.312] (-1388.093) (-1390.507) * (-1391.779) (-1389.443) (-1388.632) [-1386.498] -- 0:00:04 937000 -- (-1387.212) (-1387.766) (-1390.351) [-1387.872] * [-1387.966] (-1386.269) (-1394.050) (-1386.894) -- 0:00:03 937500 -- (-1386.801) (-1386.958) [-1390.480] (-1387.784) * [-1387.716] (-1387.024) (-1388.794) (-1388.065) -- 0:00:03 938000 -- (-1388.350) (-1388.236) (-1391.556) [-1388.170] * (-1390.617) (-1387.601) (-1386.897) [-1389.461] -- 0:00:03 938500 -- [-1388.340] (-1387.514) (-1387.235) (-1387.942) * (-1388.358) [-1387.391] (-1386.236) (-1388.069) -- 0:00:03 939000 -- (-1386.605) (-1388.764) (-1389.366) [-1387.165] * (-1388.151) (-1386.639) (-1389.976) [-1389.155] -- 0:00:03 939500 -- [-1387.920] (-1388.217) (-1388.839) (-1386.256) * (-1388.157) (-1388.988) (-1387.518) [-1392.369] -- 0:00:03 940000 -- (-1392.606) [-1387.422] (-1387.006) (-1388.257) * (-1388.097) (-1388.055) (-1388.735) [-1390.618] -- 0:00:03 Average standard deviation of split frequencies: 0.008269 940500 -- [-1388.006] (-1390.383) (-1387.757) (-1386.551) * (-1388.132) [-1386.957] (-1390.869) (-1390.336) -- 0:00:03 941000 -- [-1388.003] (-1389.772) (-1386.751) (-1387.113) * (-1389.656) (-1389.361) [-1393.717] (-1390.944) -- 0:00:03 941500 -- (-1394.776) [-1390.621] (-1388.781) (-1389.753) * [-1388.434] (-1387.169) (-1388.365) (-1386.920) -- 0:00:03 942000 -- (-1394.175) (-1388.026) [-1390.142] (-1387.763) * (-1387.957) [-1388.470] (-1391.270) (-1387.159) -- 0:00:03 942500 -- (-1390.115) [-1387.750] (-1391.891) (-1388.732) * (-1389.982) [-1389.062] (-1391.217) (-1391.078) -- 0:00:03 943000 -- (-1386.884) [-1386.951] (-1388.498) (-1388.551) * (-1388.833) (-1390.455) [-1389.232] (-1387.490) -- 0:00:03 943500 -- (-1387.478) (-1388.937) [-1389.108] (-1393.172) * (-1387.271) [-1388.158] (-1391.481) (-1386.748) -- 0:00:03 944000 -- (-1392.537) [-1387.950] (-1388.307) (-1387.763) * (-1386.962) (-1388.937) (-1389.280) [-1386.969] -- 0:00:03 944500 -- (-1390.538) (-1387.337) (-1388.167) [-1387.406] * (-1389.859) [-1388.483] (-1387.464) (-1392.126) -- 0:00:03 945000 -- [-1389.136] (-1387.056) (-1388.454) (-1387.464) * (-1387.370) (-1392.850) (-1387.090) [-1386.946] -- 0:00:03 Average standard deviation of split frequencies: 0.008440 945500 -- (-1389.993) (-1388.250) [-1389.027] (-1388.535) * (-1388.291) (-1386.810) [-1389.216] (-1387.375) -- 0:00:03 946000 -- (-1390.046) (-1389.190) [-1388.531] (-1387.653) * [-1388.536] (-1386.954) (-1389.400) (-1392.334) -- 0:00:03 946500 -- (-1391.263) (-1398.376) [-1387.247] (-1387.759) * (-1389.474) [-1388.645] (-1388.046) (-1390.486) -- 0:00:03 947000 -- [-1388.283] (-1396.367) (-1386.577) (-1387.525) * [-1387.052] (-1387.888) (-1388.512) (-1386.687) -- 0:00:03 947500 -- (-1387.046) (-1392.758) [-1387.605] (-1387.212) * [-1388.116] (-1388.771) (-1389.795) (-1387.945) -- 0:00:03 948000 -- [-1387.764] (-1389.781) (-1387.645) (-1387.084) * (-1390.599) [-1388.006] (-1390.714) (-1386.820) -- 0:00:03 948500 -- (-1392.513) [-1387.865] (-1390.183) (-1389.608) * (-1387.200) (-1387.182) [-1387.801] (-1389.590) -- 0:00:03 949000 -- (-1389.006) (-1387.117) [-1386.861] (-1388.922) * (-1389.837) [-1388.008] (-1388.015) (-1388.580) -- 0:00:03 949500 -- (-1389.470) [-1386.269] (-1392.464) (-1387.252) * (-1391.099) (-1387.676) [-1388.129] (-1390.048) -- 0:00:03 950000 -- [-1394.696] (-1386.595) (-1390.881) (-1400.671) * (-1391.451) (-1388.508) [-1390.380] (-1387.739) -- 0:00:03 Average standard deviation of split frequencies: 0.008529 950500 -- (-1389.875) (-1386.455) (-1389.677) [-1387.809] * (-1388.960) [-1386.834] (-1392.722) (-1389.961) -- 0:00:03 951000 -- (-1389.478) (-1386.510) (-1391.635) [-1388.699] * [-1387.801] (-1387.616) (-1388.777) (-1387.171) -- 0:00:03 951500 -- [-1387.299] (-1390.753) (-1390.088) (-1392.493) * (-1392.761) (-1387.456) [-1387.403] (-1386.477) -- 0:00:03 952000 -- (-1388.295) (-1388.373) [-1387.684] (-1392.333) * (-1392.320) [-1388.309] (-1388.539) (-1391.218) -- 0:00:03 952500 -- (-1389.689) (-1391.948) [-1390.262] (-1391.156) * (-1391.467) (-1389.201) [-1387.248] (-1389.151) -- 0:00:02 953000 -- (-1387.764) [-1390.765] (-1387.161) (-1389.343) * (-1387.716) (-1387.903) (-1386.241) [-1387.480] -- 0:00:02 953500 -- (-1391.566) [-1389.449] (-1393.053) (-1387.766) * [-1388.698] (-1386.112) (-1387.866) (-1390.590) -- 0:00:02 954000 -- (-1389.000) [-1389.257] (-1386.671) (-1392.492) * (-1388.540) (-1388.042) [-1388.906] (-1386.916) -- 0:00:02 954500 -- (-1388.989) (-1388.688) [-1388.483] (-1387.885) * (-1389.004) (-1386.763) (-1386.922) [-1389.321] -- 0:00:02 955000 -- (-1389.691) (-1387.708) [-1387.672] (-1388.591) * (-1387.847) (-1386.904) (-1388.456) [-1387.578] -- 0:00:02 Average standard deviation of split frequencies: 0.008777 955500 -- [-1388.925] (-1387.019) (-1388.115) (-1388.947) * (-1388.405) (-1386.879) [-1387.890] (-1388.023) -- 0:00:02 956000 -- (-1391.649) (-1387.675) [-1387.275] (-1389.108) * [-1387.527] (-1387.569) (-1387.158) (-1388.649) -- 0:00:02 956500 -- [-1388.597] (-1388.989) (-1389.604) (-1389.175) * (-1388.396) [-1390.541] (-1387.723) (-1388.772) -- 0:00:02 957000 -- [-1387.836] (-1387.722) (-1392.156) (-1388.905) * (-1389.881) [-1388.332] (-1386.892) (-1390.485) -- 0:00:02 957500 -- (-1386.699) (-1388.726) [-1390.070] (-1386.714) * (-1388.523) (-1386.860) [-1387.475] (-1394.820) -- 0:00:02 958000 -- (-1387.286) [-1387.199] (-1388.330) (-1388.144) * (-1390.336) (-1390.335) (-1389.155) [-1389.047] -- 0:00:02 958500 -- (-1387.317) [-1388.867] (-1388.228) (-1394.706) * (-1394.419) [-1388.676] (-1392.109) (-1390.901) -- 0:00:02 959000 -- (-1393.486) (-1387.330) (-1388.322) [-1392.298] * (-1388.846) (-1394.270) (-1388.501) [-1388.068] -- 0:00:02 959500 -- (-1393.851) [-1387.978] (-1387.893) (-1388.061) * (-1388.344) (-1391.771) (-1387.302) [-1386.733] -- 0:00:02 960000 -- [-1390.822] (-1390.959) (-1390.423) (-1388.947) * (-1386.209) (-1390.567) (-1388.244) [-1386.774] -- 0:00:02 Average standard deviation of split frequencies: 0.008679 960500 -- (-1388.399) [-1387.932] (-1387.539) (-1386.343) * (-1386.223) (-1388.910) (-1387.963) [-1392.649] -- 0:00:02 961000 -- (-1388.191) [-1388.016] (-1389.555) (-1386.850) * (-1392.131) (-1388.319) [-1390.702] (-1391.488) -- 0:00:02 961500 -- [-1390.253] (-1389.468) (-1389.016) (-1390.158) * (-1388.989) [-1388.309] (-1389.410) (-1389.599) -- 0:00:02 962000 -- (-1388.737) (-1387.377) (-1386.720) [-1391.658] * (-1389.082) (-1388.315) [-1387.812] (-1391.958) -- 0:00:02 962500 -- (-1390.550) (-1387.022) [-1389.232] (-1388.152) * (-1387.294) [-1387.784] (-1391.008) (-1389.387) -- 0:00:02 963000 -- (-1389.572) [-1387.285] (-1389.968) (-1386.952) * (-1392.530) (-1388.681) (-1389.300) [-1388.395] -- 0:00:02 963500 -- (-1390.143) (-1388.764) [-1388.798] (-1387.133) * (-1390.096) (-1389.376) (-1392.507) [-1387.772] -- 0:00:02 964000 -- (-1387.994) [-1390.665] (-1388.994) (-1386.583) * [-1387.587] (-1390.057) (-1391.489) (-1387.752) -- 0:00:02 964500 -- (-1387.537) (-1389.021) (-1388.429) [-1388.512] * [-1388.084] (-1387.058) (-1387.870) (-1386.854) -- 0:00:02 965000 -- [-1389.070] (-1387.573) (-1388.129) (-1387.782) * (-1388.622) (-1389.020) [-1389.396] (-1386.780) -- 0:00:02 Average standard deviation of split frequencies: 0.008906 965500 -- (-1389.078) (-1387.752) (-1390.070) [-1390.176] * [-1387.761] (-1392.605) (-1391.149) (-1387.240) -- 0:00:02 966000 -- (-1388.311) [-1387.928] (-1389.086) (-1389.657) * [-1388.935] (-1391.422) (-1387.619) (-1388.856) -- 0:00:02 966500 -- [-1388.106] (-1387.006) (-1391.271) (-1390.178) * (-1392.222) [-1388.119] (-1386.917) (-1389.194) -- 0:00:02 967000 -- (-1389.654) (-1388.950) [-1389.005] (-1389.765) * (-1388.051) (-1390.065) [-1388.333] (-1387.210) -- 0:00:02 967500 -- (-1389.279) (-1388.466) (-1388.512) [-1388.425] * [-1388.821] (-1390.099) (-1386.744) (-1387.986) -- 0:00:02 968000 -- (-1388.923) (-1391.467) (-1386.774) [-1387.245] * (-1389.513) (-1386.395) (-1391.874) [-1391.551] -- 0:00:02 968500 -- (-1388.523) [-1386.487] (-1388.419) (-1390.306) * [-1388.178] (-1387.204) (-1387.557) (-1389.363) -- 0:00:01 969000 -- [-1388.064] (-1387.336) (-1387.794) (-1391.895) * (-1388.188) [-1387.281] (-1389.260) (-1387.306) -- 0:00:01 969500 -- (-1390.688) (-1388.403) (-1389.832) [-1389.171] * (-1386.830) (-1386.519) (-1390.197) [-1390.776] -- 0:00:01 970000 -- [-1387.451] (-1390.518) (-1388.893) (-1386.284) * (-1388.133) (-1387.307) [-1390.237] (-1392.572) -- 0:00:01 Average standard deviation of split frequencies: 0.008839 970500 -- (-1387.450) [-1386.183] (-1387.434) (-1387.425) * [-1389.328] (-1390.083) (-1387.811) (-1390.517) -- 0:00:01 971000 -- (-1387.837) (-1389.412) [-1386.821] (-1389.272) * (-1389.194) (-1389.512) [-1387.438] (-1387.647) -- 0:00:01 971500 -- [-1388.499] (-1389.916) (-1388.768) (-1391.819) * [-1389.604] (-1389.961) (-1387.921) (-1390.883) -- 0:00:01 972000 -- [-1387.687] (-1388.361) (-1389.397) (-1386.763) * [-1387.399] (-1387.935) (-1388.511) (-1387.145) -- 0:00:01 972500 -- [-1388.939] (-1387.304) (-1387.924) (-1387.531) * [-1389.187] (-1390.333) (-1390.314) (-1389.185) -- 0:00:01 973000 -- (-1386.859) (-1390.583) (-1387.118) [-1387.166] * (-1392.130) (-1389.845) (-1388.019) [-1386.447] -- 0:00:01 973500 -- (-1390.223) (-1388.248) (-1386.976) [-1388.401] * (-1391.532) (-1386.881) (-1386.997) [-1387.296] -- 0:00:01 974000 -- (-1387.903) (-1389.543) [-1387.712] (-1388.730) * (-1395.537) (-1386.958) [-1387.250] (-1395.231) -- 0:00:01 974500 -- (-1388.347) (-1386.840) (-1386.869) [-1389.345] * [-1386.661] (-1389.097) (-1387.253) (-1386.429) -- 0:00:01 975000 -- [-1388.230] (-1386.538) (-1388.288) (-1391.792) * (-1388.015) [-1386.997] (-1387.171) (-1390.837) -- 0:00:01 Average standard deviation of split frequencies: 0.009328 975500 -- [-1388.697] (-1387.683) (-1390.830) (-1387.164) * (-1387.161) (-1389.052) [-1387.724] (-1387.032) -- 0:00:01 976000 -- [-1389.047] (-1387.821) (-1391.096) (-1386.387) * (-1388.556) [-1389.640] (-1387.701) (-1386.159) -- 0:00:01 976500 -- (-1392.738) (-1389.193) (-1387.379) [-1386.236] * (-1386.765) (-1388.300) [-1388.673] (-1387.406) -- 0:00:01 977000 -- (-1386.836) (-1389.505) (-1387.579) [-1389.476] * (-1388.829) (-1387.714) (-1390.097) [-1387.241] -- 0:00:01 977500 -- (-1388.976) (-1389.425) [-1387.750] (-1387.515) * (-1387.034) (-1386.801) [-1388.818] (-1387.184) -- 0:00:01 978000 -- (-1388.060) (-1395.872) [-1386.115] (-1387.320) * [-1388.522] (-1388.018) (-1388.015) (-1388.098) -- 0:00:01 978500 -- (-1393.741) [-1388.682] (-1386.129) (-1389.039) * [-1386.388] (-1386.096) (-1389.549) (-1388.759) -- 0:00:01 979000 -- (-1392.066) [-1394.581] (-1387.635) (-1387.390) * (-1388.297) (-1390.283) [-1389.104] (-1388.181) -- 0:00:01 979500 -- (-1388.627) (-1391.696) [-1387.208] (-1386.794) * (-1387.686) (-1389.162) (-1388.991) [-1387.454] -- 0:00:01 980000 -- [-1390.845] (-1388.720) (-1390.598) (-1389.597) * (-1387.717) (-1389.606) [-1389.752] (-1387.561) -- 0:00:01 Average standard deviation of split frequencies: 0.009486 980500 -- (-1388.540) (-1388.062) (-1387.818) [-1388.221] * [-1388.267] (-1387.612) (-1387.343) (-1390.008) -- 0:00:01 981000 -- (-1392.817) (-1388.955) (-1387.468) [-1386.666] * (-1395.080) (-1388.019) [-1389.151] (-1386.498) -- 0:00:01 981500 -- (-1388.375) [-1388.089] (-1386.614) (-1387.450) * [-1386.528] (-1390.703) (-1387.152) (-1386.418) -- 0:00:01 982000 -- [-1389.371] (-1389.009) (-1388.477) (-1387.550) * (-1387.059) (-1387.188) [-1387.686] (-1387.744) -- 0:00:01 982500 -- (-1389.671) (-1390.000) [-1388.293] (-1386.921) * [-1389.901] (-1387.030) (-1388.495) (-1386.559) -- 0:00:01 983000 -- (-1387.738) (-1390.818) (-1389.077) [-1389.055] * [-1388.122] (-1389.271) (-1388.463) (-1389.779) -- 0:00:01 983500 -- [-1388.509] (-1390.733) (-1387.476) (-1394.834) * (-1389.331) (-1388.176) (-1387.808) [-1388.414] -- 0:00:01 984000 -- (-1387.484) (-1393.313) [-1388.609] (-1388.434) * (-1390.723) [-1387.659] (-1387.598) (-1387.493) -- 0:00:01 984500 -- (-1389.849) [-1395.110] (-1388.552) (-1387.202) * (-1390.160) (-1388.620) (-1391.659) [-1386.393] -- 0:00:00 985000 -- (-1390.515) (-1387.857) [-1388.753] (-1386.658) * [-1387.079] (-1386.929) (-1389.228) (-1389.197) -- 0:00:00 Average standard deviation of split frequencies: 0.008924 985500 -- (-1392.224) (-1389.804) (-1388.660) [-1387.747] * (-1387.390) [-1386.814] (-1389.036) (-1389.704) -- 0:00:00 986000 -- (-1387.067) [-1388.366] (-1389.633) (-1388.891) * (-1388.867) [-1386.604] (-1386.789) (-1387.611) -- 0:00:00 986500 -- [-1388.894] (-1389.190) (-1387.501) (-1388.240) * (-1389.286) (-1389.003) (-1387.280) [-1387.838] -- 0:00:00 987000 -- [-1387.470] (-1388.198) (-1388.681) (-1390.437) * [-1387.062] (-1388.078) (-1389.441) (-1391.067) -- 0:00:00 987500 -- [-1388.210] (-1389.761) (-1389.164) (-1387.358) * (-1388.941) (-1386.642) [-1391.269] (-1390.260) -- 0:00:00 988000 -- (-1388.063) [-1389.722] (-1390.887) (-1388.421) * [-1387.179] (-1389.384) (-1392.822) (-1391.805) -- 0:00:00 988500 -- (-1387.850) [-1387.872] (-1395.110) (-1394.721) * (-1389.527) (-1388.032) [-1388.928] (-1390.066) -- 0:00:00 989000 -- (-1392.228) [-1386.937] (-1395.532) (-1391.788) * (-1389.372) (-1387.233) [-1387.534] (-1388.540) -- 0:00:00 989500 -- (-1387.269) (-1387.046) (-1393.828) [-1389.692] * [-1388.788] (-1389.533) (-1389.090) (-1389.761) -- 0:00:00 990000 -- (-1390.162) [-1388.807] (-1389.547) (-1387.482) * (-1388.696) (-1388.335) (-1387.631) [-1389.400] -- 0:00:00 Average standard deviation of split frequencies: 0.008502 990500 -- (-1387.330) [-1391.932] (-1387.616) (-1386.995) * (-1386.487) (-1389.090) (-1389.206) [-1388.958] -- 0:00:00 991000 -- (-1388.713) (-1390.765) (-1386.373) [-1391.969] * (-1387.428) (-1386.956) (-1390.302) [-1388.146] -- 0:00:00 991500 -- (-1387.852) [-1388.227] (-1389.110) (-1387.588) * [-1389.154] (-1388.672) (-1390.447) (-1386.692) -- 0:00:00 992000 -- [-1388.553] (-1390.746) (-1388.691) (-1397.174) * (-1389.425) [-1386.938] (-1390.772) (-1387.177) -- 0:00:00 992500 -- [-1388.260] (-1394.885) (-1389.535) (-1387.754) * (-1389.272) (-1390.333) [-1386.438] (-1387.621) -- 0:00:00 993000 -- (-1387.348) (-1390.701) [-1392.233] (-1393.140) * (-1388.132) [-1393.345] (-1387.215) (-1391.218) -- 0:00:00 993500 -- (-1386.931) (-1393.855) (-1389.220) [-1387.602] * (-1386.821) (-1391.540) (-1387.704) [-1389.859] -- 0:00:00 994000 -- (-1386.704) (-1387.090) [-1394.763] (-1387.330) * (-1386.825) [-1387.608] (-1387.453) (-1392.283) -- 0:00:00 994500 -- (-1387.428) (-1390.235) (-1392.139) [-1387.840] * (-1391.601) [-1392.744] (-1388.196) (-1392.868) -- 0:00:00 995000 -- [-1387.204] (-1395.075) (-1388.171) (-1389.823) * (-1388.920) (-1386.937) (-1387.330) [-1387.246] -- 0:00:00 Average standard deviation of split frequencies: 0.008551 995500 -- (-1388.985) [-1388.969] (-1389.387) (-1387.801) * (-1391.164) (-1386.938) (-1388.733) [-1387.813] -- 0:00:00 996000 -- [-1388.611] (-1388.124) (-1394.247) (-1388.872) * [-1390.397] (-1389.671) (-1389.934) (-1387.570) -- 0:00:00 996500 -- (-1387.166) [-1387.617] (-1388.540) (-1387.635) * [-1390.876] (-1387.196) (-1392.062) (-1390.436) -- 0:00:00 997000 -- (-1387.150) [-1389.178] (-1389.495) (-1387.459) * [-1388.089] (-1386.763) (-1388.529) (-1388.494) -- 0:00:00 997500 -- (-1387.991) (-1390.722) (-1388.552) [-1389.414] * (-1386.429) (-1387.056) (-1388.730) [-1386.545] -- 0:00:00 998000 -- (-1387.492) (-1388.952) [-1391.528] (-1390.172) * (-1387.060) (-1387.775) [-1387.906] (-1388.854) -- 0:00:00 998500 -- (-1391.180) [-1386.993] (-1388.806) (-1389.628) * (-1388.198) [-1387.369] (-1386.687) (-1387.780) -- 0:00:00 999000 -- (-1394.133) [-1388.006] (-1388.170) (-1390.151) * (-1390.769) [-1389.924] (-1388.770) (-1390.318) -- 0:00:00 999500 -- (-1387.741) (-1388.443) [-1388.353] (-1387.279) * (-1388.773) (-1386.296) (-1386.308) [-1388.769] -- 0:00:00 1000000 -- (-1387.628) (-1388.415) (-1394.721) [-1388.574] * (-1394.710) [-1388.253] (-1389.248) (-1388.711) -- 0:00:00 Average standard deviation of split frequencies: 0.008637 Analysis completed in 1 mins 3 seconds Analysis used 61.97 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1385.97 Likelihood of best state for "cold" chain of run 2 was -1385.97 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.2 % ( 66 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.0 % ( 26 %) Dirichlet(Pi{all}) 27.4 % ( 22 %) Slider(Pi{all}) 78.9 % ( 58 %) Multiplier(Alpha{1,2}) 77.8 % ( 48 %) Multiplier(Alpha{3}) 18.9 % ( 28 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 73 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 91 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 25 %) Multiplier(V{all}) 97.5 % ( 99 %) Nodeslider(V{all}) 30.7 % ( 31 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.9 % ( 66 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.0 % ( 34 %) Dirichlet(Pi{all}) 27.8 % ( 19 %) Slider(Pi{all}) 78.9 % ( 50 %) Multiplier(Alpha{1,2}) 78.1 % ( 55 %) Multiplier(Alpha{3}) 18.6 % ( 30 %) Slider(Pinvar{all}) 98.7 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.4 % ( 73 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.6 % ( 91 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 25 %) Multiplier(V{all}) 97.4 % ( 97 %) Nodeslider(V{all}) 30.5 % ( 23 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166419 0.82 0.66 3 | 166168 166821 0.83 4 | 166626 166792 167174 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166717 0.82 0.67 3 | 167006 165759 0.84 4 | 166499 167032 166987 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1387.71 | 12 1 | | 2 1 2 | | 1 2 | | 1 1 2 1 2211 1 2 | | 1 1 1 1 2 1 2 2 1 1 | | 2 2 2 2 1 11 1 1 1 | | 12 2 1 2 1 2 1 12 1 1 1 2 22 | |2 2 22 1 2 2 1 2 12 * | | 1 2 1 12211 22 1 | | 1 * 22 1 22 1 2 12 2 2 | | 1 1 2 22 1 2 1 12| |1 2 2 1 2 22 2 | | 1 1 1 2 | | 2 1 1| | 2 1 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1389.29 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1387.70 -1390.90 2 -1387.76 -1390.51 -------------------------------------- TOTAL -1387.73 -1390.72 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.898071 0.088465 0.383982 1.494533 0.862297 1501.00 1501.00 1.000 r(A<->C){all} 0.158294 0.018088 0.000074 0.432477 0.121114 152.73 211.12 1.000 r(A<->G){all} 0.165175 0.019707 0.000026 0.447007 0.128568 150.02 191.53 1.003 r(A<->T){all} 0.174112 0.020685 0.000053 0.464534 0.137661 123.30 191.44 1.002 r(C<->G){all} 0.158754 0.018783 0.000039 0.442194 0.120150 110.01 230.93 1.002 r(C<->T){all} 0.183141 0.021868 0.000005 0.476931 0.148045 247.05 253.39 1.000 r(G<->T){all} 0.160525 0.019304 0.000026 0.445375 0.123819 162.14 224.81 1.009 pi(A){all} 0.239342 0.000188 0.213714 0.266805 0.238970 1239.23 1303.89 1.001 pi(C){all} 0.288202 0.000199 0.261400 0.315453 0.288248 1058.76 1091.99 1.000 pi(G){all} 0.296758 0.000205 0.269197 0.323569 0.296626 1249.17 1287.94 1.000 pi(T){all} 0.175698 0.000143 0.153310 0.200038 0.175628 1350.64 1410.17 1.000 alpha{1,2} 0.434347 0.235962 0.000234 1.398609 0.261147 1207.74 1254.06 1.000 alpha{3} 0.470431 0.247287 0.000261 1.527438 0.295765 1351.36 1421.87 1.000 pinvar{all} 0.998503 0.000003 0.995269 0.999999 0.999059 964.64 1069.80 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .*.*.. 8 -- ..*..* 9 -- .**.** 10 -- .****. 11 -- .**... 12 -- ....** 13 -- .*...* 14 -- ...**. 15 -- ..*.*. 16 -- .***.* 17 -- ..**.. 18 -- ..**** 19 -- .*.*** 20 -- ...*.* 21 -- .*..*. ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 456 0.151899 0.004711 0.148568 0.155230 2 8 452 0.150566 0.006595 0.145903 0.155230 2 9 449 0.149567 0.024968 0.131912 0.167222 2 10 439 0.146236 0.013662 0.136576 0.155896 2 11 439 0.146236 0.010835 0.138574 0.153897 2 12 431 0.143571 0.006124 0.139241 0.147901 2 13 428 0.142572 0.000942 0.141905 0.143238 2 14 426 0.141905 0.004711 0.138574 0.145237 2 15 424 0.141239 0.007537 0.135909 0.146569 2 16 424 0.141239 0.012248 0.132578 0.149900 2 17 424 0.141239 0.000000 0.141239 0.141239 2 18 418 0.139241 0.016017 0.127915 0.150566 2 19 409 0.136243 0.002355 0.134577 0.137908 2 20 409 0.136243 0.014604 0.125916 0.146569 2 21 399 0.132911 0.004240 0.129913 0.135909 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.100018 0.010150 0.000021 0.298555 0.069323 1.000 2 length{all}[2] 0.097780 0.009874 0.000046 0.301563 0.066083 1.000 2 length{all}[3] 0.098751 0.010267 0.000013 0.296698 0.068807 1.000 2 length{all}[4] 0.100353 0.010268 0.000059 0.299203 0.070642 1.000 2 length{all}[5] 0.100314 0.010091 0.000011 0.294598 0.069566 1.000 2 length{all}[6] 0.099143 0.009447 0.000020 0.286064 0.069537 1.000 2 length{all}[7] 0.097495 0.008997 0.000217 0.310341 0.070873 0.998 2 length{all}[8] 0.104713 0.011200 0.000236 0.331000 0.069501 0.998 2 length{all}[9] 0.106106 0.008432 0.000141 0.280801 0.079304 0.999 2 length{all}[10] 0.099803 0.009942 0.000089 0.283588 0.072799 0.998 2 length{all}[11] 0.102451 0.010133 0.000125 0.299314 0.071934 0.999 2 length{all}[12] 0.091000 0.007738 0.000046 0.267285 0.064780 0.998 2 length{all}[13] 0.111218 0.013140 0.000348 0.336745 0.075418 0.998 2 length{all}[14] 0.101362 0.011081 0.000093 0.295021 0.070098 0.999 2 length{all}[15] 0.099542 0.009850 0.000260 0.333250 0.064646 1.002 2 length{all}[16] 0.106195 0.010496 0.000009 0.294667 0.072218 1.001 2 length{all}[17] 0.099077 0.012205 0.000269 0.318843 0.061844 1.000 2 length{all}[18] 0.100565 0.009580 0.000026 0.296546 0.069337 0.999 2 length{all}[19] 0.105554 0.010299 0.000384 0.320446 0.071496 0.998 2 length{all}[20] 0.095147 0.008676 0.000019 0.293414 0.073251 1.007 2 length{all}[21] 0.107226 0.010646 0.000546 0.302700 0.073895 1.002 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.008637 Maximum standard deviation of split frequencies = 0.024968 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.007 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /----------------------------------------------------------------------- C1 (1) | |------------------------------------------------------------------- C2 (2) | |---------------------------------------------------------------------- C3 (3) + |------------------------------------------------------------------------ C4 (4) | |----------------------------------------------------------------------- C5 (5) | \----------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1014 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 57 patterns at 338 / 338 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 57 patterns at 338 / 338 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 55632 bytes for conP 5016 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.024091 0.071465 0.067966 0.032789 0.046273 0.064035 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1415.755213 Iterating by ming2 Initial: fx= 1415.755213 x= 0.02409 0.07147 0.06797 0.03279 0.04627 0.06403 0.30000 1.30000 1 h-m-p 0.0000 0.0001 811.4374 ++ 1368.017398 m 0.0001 13 | 1/8 2 h-m-p 0.0008 0.0059 63.0851 -----------.. | 1/8 3 h-m-p 0.0000 0.0000 743.3879 ++ 1353.545924 m 0.0000 44 | 2/8 4 h-m-p 0.0004 0.0091 46.6218 ----------.. | 2/8 5 h-m-p 0.0000 0.0000 665.2550 ++ 1335.525253 m 0.0000 74 | 3/8 6 h-m-p 0.0007 0.0131 35.5007 -----------.. | 3/8 7 h-m-p 0.0000 0.0001 577.0214 ++ 1317.597830 m 0.0001 105 | 4/8 8 h-m-p 0.0010 0.0256 24.5223 -----------.. | 4/8 9 h-m-p 0.0000 0.0000 472.5747 ++ 1314.938152 m 0.0000 136 | 5/8 10 h-m-p 0.0003 0.0654 15.6878 ----------.. | 5/8 11 h-m-p 0.0000 0.0000 334.3008 ++ 1313.752321 m 0.0000 166 | 6/8 12 h-m-p 0.1575 8.0000 0.0000 -C 1313.752321 0 0.0098 178 | 6/8 13 h-m-p 1.1678 8.0000 0.0000 --Y 1313.752321 0 0.0182 193 Out.. lnL = -1313.752321 194 lfun, 194 eigenQcodon, 1164 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.039808 0.012651 0.038247 0.030198 0.073745 0.040498 0.299961 0.645398 0.192884 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 12.491872 np = 9 lnL0 = -1387.984309 Iterating by ming2 Initial: fx= 1387.984309 x= 0.03981 0.01265 0.03825 0.03020 0.07375 0.04050 0.29996 0.64540 0.19288 1 h-m-p 0.0000 0.0000 737.3938 ++ 1364.940409 m 0.0000 14 | 1/9 2 h-m-p 0.0001 0.0003 315.7659 ++ 1336.589867 m 0.0003 26 | 2/9 3 h-m-p 0.0000 0.0000 11566.6139 ++ 1326.498812 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0000 963.0961 ++ 1324.889666 m 0.0000 50 | 4/9 5 h-m-p 0.0000 0.0000 7917.1489 ++ 1324.442301 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0000 3318.5211 ++ 1320.207778 m 0.0000 74 | 6/9 7 h-m-p 0.0006 0.0114 28.0017 +++ 1316.342797 m 0.0114 87 | 7/9 8 h-m-p 0.0017 0.0086 8.6034 ++ 1313.751941 m 0.0086 99 | 8/9 9 h-m-p 1.6000 8.0000 0.0002 ++ 1313.751940 m 8.0000 111 | 8/9 10 h-m-p 0.0160 8.0000 0.5171 -----------C 1313.751940 0 0.0000 135 | 8/9 11 h-m-p 0.0160 8.0000 0.0000 +++++ 1313.751940 m 8.0000 151 | 8/9 12 h-m-p 0.0160 8.0000 4.5920 -------------.. | 8/9 13 h-m-p 0.0160 8.0000 0.0003 +++++ 1313.751939 m 8.0000 190 | 8/9 14 h-m-p 0.0160 8.0000 5.9907 ------------C 1313.751939 0 0.0000 215 | 8/9 15 h-m-p 0.0160 8.0000 0.0000 --N 1313.751939 0 0.0003 229 | 8/9 16 h-m-p 0.0160 8.0000 0.0000 +++++ 1313.751939 m 8.0000 245 | 8/9 17 h-m-p 0.0009 0.4514 0.2762 +++++ 1313.751892 m 0.4514 261 | 9/9 18 h-m-p 0.0160 8.0000 0.0000 Y 1313.751892 0 0.0160 274 | 9/9 19 h-m-p 0.0160 8.0000 0.0000 Y 1313.751892 0 0.0160 286 Out.. lnL = -1313.751892 287 lfun, 861 eigenQcodon, 3444 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.090061 0.017034 0.012238 0.068243 0.028404 0.043694 0.000100 0.980877 0.597242 0.115502 1.515871 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 11.198767 np = 11 lnL0 = -1393.534587 Iterating by ming2 Initial: fx= 1393.534587 x= 0.09006 0.01703 0.01224 0.06824 0.02840 0.04369 0.00011 0.98088 0.59724 0.11550 1.51587 1 h-m-p 0.0000 0.0000 698.5159 ++ 1392.478119 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0004 256.3310 +++ 1370.189384 m 0.0004 31 | 2/11 3 h-m-p 0.0000 0.0000 285.1231 ++ 1364.354559 m 0.0000 45 | 3/11 4 h-m-p 0.0000 0.0001 155.4991 ++ 1361.203280 m 0.0001 59 | 4/11 5 h-m-p 0.0000 0.0003 403.2479 ++ 1332.148365 m 0.0003 73 | 5/11 6 h-m-p 0.0001 0.0003 313.0375 ++ 1329.566499 m 0.0003 87 | 6/11 7 h-m-p 0.0000 0.0002 773.9705 ++ 1324.037211 m 0.0002 101 | 7/11 8 h-m-p 0.0000 0.0002 1960.1585 ++ 1313.752228 m 0.0002 115 | 8/11 9 h-m-p 1.6000 8.0000 0.0001 ++ 1313.752228 m 8.0000 129 | 8/11 10 h-m-p 0.0160 8.0000 0.5060 ---------C 1313.752228 0 0.0000 155 | 8/11 11 h-m-p 0.0160 8.0000 0.0004 +++++ 1313.752228 m 8.0000 175 | 8/11 12 h-m-p 0.0160 8.0000 1.7794 -------------.. | 8/11 13 h-m-p 0.0160 8.0000 0.0001 +++++ 1313.752228 m 8.0000 220 | 8/11 14 h-m-p 0.0160 8.0000 0.1996 +++++ 1313.752045 m 8.0000 240 | 8/11 15 h-m-p 0.2908 8.0000 5.4914 --------------Y 1313.752045 0 0.0000 271 | 8/11 16 h-m-p 0.0160 8.0000 0.0004 +++++ 1313.752045 m 8.0000 288 | 8/11 17 h-m-p 0.0010 0.1389 3.5358 ++++ 1313.752000 m 0.1389 307 | 9/11 18 h-m-p 0.2107 8.0000 2.3240 +++ 1313.751892 m 8.0000 322 | 9/11 19 h-m-p 1.6000 8.0000 0.0000 C 1313.751892 0 1.6000 336 Out.. lnL = -1313.751892 337 lfun, 1348 eigenQcodon, 6066 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1313.863030 S = -1313.754174 -0.042668 Calculating f(w|X), posterior probabilities of site classes. did 10 / 57 patterns 0:02 did 20 / 57 patterns 0:02 did 30 / 57 patterns 0:02 did 40 / 57 patterns 0:02 did 50 / 57 patterns 0:02 did 57 / 57 patterns 0:03 Time used: 0:03 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.074110 0.015811 0.048403 0.039255 0.043080 0.018912 0.000100 0.295938 1.370372 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 26.756850 np = 9 lnL0 = -1386.900521 Iterating by ming2 Initial: fx= 1386.900521 x= 0.07411 0.01581 0.04840 0.03926 0.04308 0.01891 0.00011 0.29594 1.37037 1 h-m-p 0.0000 0.0000 704.0695 ++ 1386.313025 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0038 78.8487 +++++ 1366.555426 m 0.0038 29 | 2/9 3 h-m-p 0.0001 0.0004 217.8051 ++ 1352.482777 m 0.0004 41 | 3/9 4 h-m-p 0.0001 0.0003 183.8478 ++ 1331.952146 m 0.0003 53 | 4/9 5 h-m-p 0.0004 0.0020 39.9491 ++ 1330.393736 m 0.0020 65 | 5/9 6 h-m-p 0.0000 0.0000 332.0009 ++ 1328.390959 m 0.0000 77 | 6/9 7 h-m-p 0.0002 0.0010 35.6508 ++ 1327.480648 m 0.0010 89 | 7/9 8 h-m-p 0.0300 3.0746 0.8824 --------------.. | 7/9 9 h-m-p 0.0000 0.0001 299.1287 ++ 1313.751892 m 0.0001 127 | 8/9 10 h-m-p 1.6000 8.0000 0.0000 N 1313.751892 0 1.6000 139 | 8/9 11 h-m-p 0.0160 8.0000 0.0000 Y 1313.751892 0 0.0160 152 Out.. lnL = -1313.751892 153 lfun, 1683 eigenQcodon, 9180 P(t) Time used: 0:05 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.031569 0.031228 0.094265 0.092557 0.052556 0.018343 0.000100 0.900000 0.488169 1.546901 1.299956 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 18.078990 np = 11 lnL0 = -1408.420310 Iterating by ming2 Initial: fx= 1408.420310 x= 0.03157 0.03123 0.09426 0.09256 0.05256 0.01834 0.00011 0.90000 0.48817 1.54690 1.29996 1 h-m-p 0.0000 0.0000 656.3910 ++ 1407.994851 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0007 241.8307 ++++ 1375.111234 m 0.0007 32 | 2/11 3 h-m-p 0.0000 0.0001 659.8636 ++ 1356.734959 m 0.0001 46 | 3/11 4 h-m-p 0.0000 0.0000 198.2962 ++ 1356.202817 m 0.0000 60 | 4/11 5 h-m-p 0.0000 0.0001 2419.1912 ++ 1337.216018 m 0.0001 74 | 5/11 6 h-m-p 0.0000 0.0001 4565.5284 ++ 1321.623496 m 0.0001 88 | 6/11 7 h-m-p 0.0029 0.0144 14.9606 ++ 1318.224716 m 0.0144 102 | 7/11 8 h-m-p 0.0000 0.0000 31419.6877 ++ 1315.868771 m 0.0000 116 | 7/11 9 h-m-p 0.1391 0.6955 2.2191 ---------------.. | 7/11 10 h-m-p 0.0000 0.0000 333.7721 ++ 1313.752315 m 0.0000 157 | 8/11 11 h-m-p 0.0122 0.0611 0.0000 ++ 1313.752315 m 0.0611 171 | 8/11 12 h-m-p -0.0000 -0.0000 0.0000 h-m-p: -0.00000000e+00 -0.00000000e+00 1.94109618e-05 1313.752315 .. | 8/11 13 h-m-p 0.0160 8.0000 0.0001 +++++ 1313.752315 m 8.0000 205 | 8/11 14 h-m-p 0.0002 0.0011 0.4904 -------Y 1313.752315 0 0.0000 229 | 8/11 15 h-m-p 0.0160 8.0000 0.0000 --Y 1313.752315 0 0.0003 248 | 8/11 16 h-m-p 0.0160 8.0000 0.0001 +++++ 1313.752315 m 8.0000 268 | 8/11 17 h-m-p 0.0004 0.0019 0.6068 ---------Y 1313.752315 0 0.0000 294 | 8/11 18 h-m-p 0.0160 8.0000 0.0030 +++++ 1313.752314 m 8.0000 314 | 8/11 19 h-m-p 0.0087 0.0437 0.5791 ----------Y 1313.752314 0 0.0000 341 | 8/11 20 h-m-p 0.0160 8.0000 0.0000 +++++ 1313.752314 m 8.0000 361 | 8/11 21 h-m-p 0.0085 4.2419 0.2298 +++++ 1313.751892 m 4.2419 381 | 9/11 22 h-m-p 1.6000 8.0000 0.0000 --C 1313.751892 0 0.0250 400 | 9/11 23 h-m-p 0.0404 8.0000 0.0000 -----N 1313.751892 0 0.0000 421 Out.. lnL = -1313.751892 422 lfun, 5064 eigenQcodon, 27852 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1313.894874 S = -1313.754173 -0.063883 Calculating f(w|X), posterior probabilities of site classes. did 10 / 57 patterns 0:12 did 20 / 57 patterns 0:12 did 30 / 57 patterns 0:12 did 40 / 57 patterns 0:12 did 50 / 57 patterns 0:13 did 57 / 57 patterns 0:13 Time used: 0:13 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=338 NC_011896_1_WP_010908751_1_2333_MLBR_RS11080 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG NC_002677_1_NP_302431_1_1303_desA1 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG ************************************************** NC_011896_1_WP_010908751_1_2333_MLBR_RS11080 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NC_002677_1_NP_302431_1_1303_desA1 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315 GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV ************************************************** NC_011896_1_WP_010908751_1_2333_MLBR_RS11080 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG NC_002677_1_NP_302431_1_1303_desA1 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315 NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG ************************************************** NC_011896_1_WP_010908751_1_2333_MLBR_RS11080 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH NC_002677_1_NP_302431_1_1303_desA1 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315 LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH ************************************************** NC_011896_1_WP_010908751_1_2333_MLBR_RS11080 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG NC_002677_1_NP_302431_1_1303_desA1 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315 MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG ************************************************** NC_011896_1_WP_010908751_1_2333_MLBR_RS11080 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC NC_002677_1_NP_302431_1_1303_desA1 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315 GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC ************************************************** NC_011896_1_WP_010908751_1_2333_MLBR_RS11080 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR NC_002677_1_NP_302431_1_1303_desA1 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315 DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR **************************************
>NC_011896_1_WP_010908751_1_2333_MLBR_RS11080 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA GGATGAGTGGGCGG >NC_002677_1_NP_302431_1_1303_desA1 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA GGATGAGTGGGCGG >NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA GGATGAGTGGGCGG >NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA GGATGAGTGGGCGG >NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA GGATGAGTGGGCGG >NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315 ATGTCAGCCGAGCTGACCGACCTACAGCTGCTGCACGAGCTCGAACCGGT CGTGGAGAAGTACATGAACCGTCATGAACGCCTACACAAGAACTGGAATC CGCACGACTATATCCCGTGGTCGGATGGCAAGAACTTCTACGCTCTCGGC GGTCAGGATTGGGACCCCGAGCAGAGCCAGCTCTCCGATGTCGCCCAAGT AGCGATGGTACAGAACCTGGTCACCGAGGACAACCTGCCGTCGTATCACC GAGAAATCGCGATGACCATGGGCATGGACGGTGCATGGGGGCAGTGGGTC AACCGCTGGACAGCCGAGGAAAACCGGCACGGAATCGCGCTGCGCGACTA TCTGGTGGTGACCCGCGCGGTCGATCCGGTGGAGCTAGAGAAACTACGCA TCGAGGTAGTCAACCGGGGTTTCAGCCCGGGCCAGAATCACCAAGGCGGA CTCTTCGCCGACACCCTGTTCGACTCGATCCTCTACGTCACATTCCAGGA GCTGGCTACCCGCGTCTCGCACCGCAACACGGGTAAGGCCTGCAACGAGA CGATCGCTGACCAGCTGCTCGCTAAAATATCGAGCGATGAAAACCTGCAC ATGATCTTCTACCGGGACGTCAGCGAAGCTGGCATAGAGCTCGCACCCAA CCTTGCGATCAAGGCACTGCACAAGATCCTGCACAACTTTAAGATGCCGG GATTCCTGGTTCCTGAGTTCCGGCGTAAGGCCGTGATAATTGCCGTCGGT GGCGTCTACGACATTCGGATCCACCTTGACGAGGTGGTCATGCCGGTGCT CAAAAAATGGCGGATCTTGGAGCGCGAAGACTTCAGCGGCGAGGGTACAC GGTTGCGTGACGAAATCGGCGAGCATCTTACAGAGCTTGAGGCCGCGTGC GACAAGTTCGAAGTCTCCAAGCAGCGCTACATTGAACGCGAAGCCCGCCG GACTGAGAAAATCACCGCACGCAAGGTGCTATCTACCGAAGGCACGCTGA GGATGAGTGGGCGG
>NC_011896_1_WP_010908751_1_2333_MLBR_RS11080 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR >NC_002677_1_NP_302431_1_1303_desA1 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR >NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR >NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR >NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR >NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315 MSAELTDLQLLHELEPVVEKYMNRHERLHKNWNPHDYIPWSDGKNFYALG GQDWDPEQSQLSDVAQVAMVQNLVTEDNLPSYHREIAMTMGMDGAWGQWV NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQGG LFADTLFDSILYVTFQELATRVSHRNTGKACNETIADQLLAKISSDENLH MIFYRDVSEAGIELAPNLAIKALHKILHNFKMPGFLVPEFRRKAVIIAVG GVYDIRIHLDEVVMPVLKKWRILEREDFSGEGTRLRDEIGEHLTELEAAC DKFEVSKQRYIEREARRTEKITARKVLSTEGTLRMSGR
#NEXUS [ID: 9990930618] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908751_1_2333_MLBR_RS11080 NC_002677_1_NP_302431_1_1303_desA1 NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675 NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195 NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995 NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315 ; end; begin trees; translate 1 NC_011896_1_WP_010908751_1_2333_MLBR_RS11080, 2 NC_002677_1_NP_302431_1_1303_desA1, 3 NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675, 4 NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195, 5 NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995, 6 NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06932332,2:0.06608283,3:0.06880686,4:0.07064197,5:0.06956611,6:0.06953741); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06932332,2:0.06608283,3:0.06880686,4:0.07064197,5:0.06956611,6:0.06953741); end;
Estimated marginal likelihoods for runs sampled in files "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1387.70 -1390.90 2 -1387.76 -1390.51 -------------------------------------- TOTAL -1387.73 -1390.72 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/desA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.898071 0.088465 0.383982 1.494533 0.862297 1501.00 1501.00 1.000 r(A<->C){all} 0.158294 0.018088 0.000074 0.432477 0.121114 152.73 211.12 1.000 r(A<->G){all} 0.165175 0.019707 0.000026 0.447007 0.128568 150.02 191.53 1.003 r(A<->T){all} 0.174112 0.020685 0.000053 0.464534 0.137661 123.30 191.44 1.002 r(C<->G){all} 0.158754 0.018783 0.000039 0.442194 0.120150 110.01 230.93 1.002 r(C<->T){all} 0.183141 0.021868 0.000005 0.476931 0.148045 247.05 253.39 1.000 r(G<->T){all} 0.160525 0.019304 0.000026 0.445375 0.123819 162.14 224.81 1.009 pi(A){all} 0.239342 0.000188 0.213714 0.266805 0.238970 1239.23 1303.89 1.001 pi(C){all} 0.288202 0.000199 0.261400 0.315453 0.288248 1058.76 1091.99 1.000 pi(G){all} 0.296758 0.000205 0.269197 0.323569 0.296626 1249.17 1287.94 1.000 pi(T){all} 0.175698 0.000143 0.153310 0.200038 0.175628 1350.64 1410.17 1.000 alpha{1,2} 0.434347 0.235962 0.000234 1.398609 0.261147 1207.74 1254.06 1.000 alpha{3} 0.470431 0.247287 0.000261 1.527438 0.295765 1351.36 1421.87 1.000 pinvar{all} 0.998503 0.000003 0.995269 0.999999 0.999059 964.64 1069.80 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/desA1/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 338 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0 TTC 10 10 10 10 10 10 | TCC 2 2 2 2 2 2 | TAC 6 6 6 6 6 6 | TGC 2 2 2 2 2 2 Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 2 2 2 2 2 2 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 4 4 4 4 4 4 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 3 3 3 3 3 3 CTC 8 8 8 8 8 8 | CCC 2 2 2 2 2 2 | CAC 11 11 11 11 11 11 | CGC 12 12 12 12 12 12 CTA 5 5 5 5 5 5 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1 CTG 15 15 15 15 15 15 | CCG 8 8 8 8 8 8 | CAG 10 10 10 10 10 10 | CGG 9 9 9 9 9 9 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 3 3 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1 ATC 13 13 13 13 13 13 | ACC 8 8 8 8 8 8 | AAC 13 13 13 13 13 13 | AGC 5 5 5 5 5 5 ATA 3 3 3 3 3 3 | ACA 4 4 4 4 4 4 | Lys AAA 5 5 5 5 5 5 | Arg AGA 0 0 0 0 0 0 Met ATG 10 10 10 10 10 10 | ACG 3 3 3 3 3 3 | AAG 11 11 11 11 11 11 | AGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 1 1 1 1 1 1 | Ala GCT 5 5 5 5 5 5 | Asp GAT 5 5 5 5 5 5 | Gly GGT 6 6 6 6 6 6 GTC 13 13 13 13 13 13 | GCC 9 9 9 9 9 9 | GAC 15 15 15 15 15 15 | GGC 10 10 10 10 10 10 GTA 3 3 3 3 3 3 | GCA 4 4 4 4 4 4 | Glu GAA 12 12 12 12 12 12 | GGA 3 3 3 3 3 3 GTG 8 8 8 8 8 8 | GCG 6 6 6 6 6 6 | GAG 20 20 20 20 20 20 | GGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908751_1_2333_MLBR_RS11080 position 1: T:0.11834 C:0.27515 A:0.24556 G:0.36095 position 2: T:0.29290 C:0.17751 A:0.34615 G:0.18343 position 3: T:0.11538 C:0.41124 A:0.12722 G:0.34615 Average T:0.17554 C:0.28797 A:0.23964 G:0.29684 #2: NC_002677_1_NP_302431_1_1303_desA1 position 1: T:0.11834 C:0.27515 A:0.24556 G:0.36095 position 2: T:0.29290 C:0.17751 A:0.34615 G:0.18343 position 3: T:0.11538 C:0.41124 A:0.12722 G:0.34615 Average T:0.17554 C:0.28797 A:0.23964 G:0.29684 #3: NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675 position 1: T:0.11834 C:0.27515 A:0.24556 G:0.36095 position 2: T:0.29290 C:0.17751 A:0.34615 G:0.18343 position 3: T:0.11538 C:0.41124 A:0.12722 G:0.34615 Average T:0.17554 C:0.28797 A:0.23964 G:0.29684 #4: NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195 position 1: T:0.11834 C:0.27515 A:0.24556 G:0.36095 position 2: T:0.29290 C:0.17751 A:0.34615 G:0.18343 position 3: T:0.11538 C:0.41124 A:0.12722 G:0.34615 Average T:0.17554 C:0.28797 A:0.23964 G:0.29684 #5: NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995 position 1: T:0.11834 C:0.27515 A:0.24556 G:0.36095 position 2: T:0.29290 C:0.17751 A:0.34615 G:0.18343 position 3: T:0.11538 C:0.41124 A:0.12722 G:0.34615 Average T:0.17554 C:0.28797 A:0.23964 G:0.29684 #6: NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315 position 1: T:0.11834 C:0.27515 A:0.24556 G:0.36095 position 2: T:0.29290 C:0.17751 A:0.34615 G:0.18343 position 3: T:0.11538 C:0.41124 A:0.12722 G:0.34615 Average T:0.17554 C:0.28797 A:0.23964 G:0.29684 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 18 | Cys C TGT 0 TTC 60 | TCC 12 | TAC 36 | TGC 12 Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0 TTG 12 | TCG 30 | TAG 0 | Trp W TGG 42 ------------------------------------------------------------------------------ Leu L CTT 24 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 18 CTC 48 | CCC 12 | CAC 66 | CGC 72 CTA 30 | CCA 0 | Gln Q CAA 12 | CGA 6 CTG 90 | CCG 48 | CAG 60 | CGG 54 ------------------------------------------------------------------------------ Ile I ATT 18 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 6 ATC 78 | ACC 48 | AAC 78 | AGC 30 ATA 18 | ACA 24 | Lys K AAA 30 | Arg R AGA 0 Met M ATG 60 | ACG 18 | AAG 66 | AGG 6 ------------------------------------------------------------------------------ Val V GTT 6 | Ala A GCT 30 | Asp D GAT 30 | Gly G GGT 36 GTC 78 | GCC 54 | GAC 90 | GGC 60 GTA 18 | GCA 24 | Glu E GAA 72 | GGA 18 GTG 48 | GCG 36 | GAG 120 | GGG 12 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.11834 C:0.27515 A:0.24556 G:0.36095 position 2: T:0.29290 C:0.17751 A:0.34615 G:0.18343 position 3: T:0.11538 C:0.41124 A:0.12722 G:0.34615 Average T:0.17554 C:0.28797 A:0.23964 G:0.29684 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1313.752321 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299961 1.299956 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908751_1_2333_MLBR_RS11080: 0.000004, NC_002677_1_NP_302431_1_1303_desA1: 0.000004, NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675: 0.000004, NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195: 0.000004, NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995: 0.000004, NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.29996 omega (dN/dS) = 1.29996 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 848.2 165.8 1.3000 0.0000 0.0000 0.0 0.0 7..2 0.000 848.2 165.8 1.3000 0.0000 0.0000 0.0 0.0 7..3 0.000 848.2 165.8 1.3000 0.0000 0.0000 0.0 0.0 7..4 0.000 848.2 165.8 1.3000 0.0000 0.0000 0.0 0.0 7..5 0.000 848.2 165.8 1.3000 0.0000 0.0000 0.0 0.0 7..6 0.000 848.2 165.8 1.3000 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1313.751892 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908751_1_2333_MLBR_RS11080: 0.000004, NC_002677_1_NP_302431_1_1303_desA1: 0.000004, NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675: 0.000004, NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195: 0.000004, NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995: 0.000004, NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.99999 0.00001 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1313.751892 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908751_1_2333_MLBR_RS11080: 0.000004, NC_002677_1_NP_302431_1_1303_desA1: 0.000004, NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675: 0.000004, NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195: 0.000004, NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995: 0.000004, NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 1.00000 0.00000 0.00000 w: 0.00000 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908751_1_2333_MLBR_RS11080) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099 w2: 0.107 0.105 0.104 0.102 0.101 0.099 0.098 0.096 0.095 0.094 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.011 0.010 0.011 0.011 0.010 0.010 0.010 0.011 0.011 0.010 0.010 0.010 0.010 0.010 0.011 0.011 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 0.011 0.009 0.009 0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 0.011 0.009 0.009 0.009 0.009 0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 0.011 sum of density on p0-p1 = 1.000000 Time used: 0:03 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1313.751892 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.371316 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908751_1_2333_MLBR_RS11080: 0.000004, NC_002677_1_NP_302431_1_1303_desA1: 0.000004, NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675: 0.000004, NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195: 0.000004, NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995: 0.000004, NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.37132 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:05 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1313.751892 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.427008 1.217762 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908751_1_2333_MLBR_RS11080: 0.000004, NC_002677_1_NP_302431_1_1303_desA1: 0.000004, NZ_LVXE01000012_1_WP_010908751_1_429_A3216_RS05675: 0.000004, NZ_LYPH01000066_1_WP_010908751_1_2331_A8144_RS11195: 0.000004, NZ_CP029543_1_WP_010908751_1_2355_DIJ64_RS11995: 0.000004, NZ_AP014567_1_WP_010908751_1_2419_JK2ML_RS12315: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.00500 q = 1.42701 (p1 = 0.00001) w = 1.21776 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.21776 (note that p[10] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 861.4 152.6 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908751_1_2333_MLBR_RS11080) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.090 0.092 0.094 0.096 0.098 0.101 0.103 0.106 0.109 0.111 p : 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.110 0.108 0.105 0.103 0.101 0.099 0.097 0.094 0.092 0.091 Time used: 0:13
Model 1: NearlyNeutral -1313.751892 Model 2: PositiveSelection -1313.751892 Model 0: one-ratio -1313.752321 Model 7: beta -1313.751892 Model 8: beta&w>1 -1313.751892 Model 0 vs 1 8.579999998801213E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0