--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 10:28:22 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/1res/dnaA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/1res/dnaA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/dnaA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/dnaA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2155.84 -2159.87 2 -2156.00 -2160.12 -------------------------------------- TOTAL -2155.91 -2160.00 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/dnaA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/dnaA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/dnaA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.888108 0.090278 0.325721 1.467110 0.857160 1311.48 1406.24 1.000 r(A<->C){all} 0.168672 0.019241 0.000035 0.439987 0.134059 199.44 200.29 1.001 r(A<->G){all} 0.195062 0.022980 0.000076 0.488846 0.159692 153.33 163.88 1.000 r(A<->T){all} 0.160058 0.019592 0.000090 0.441361 0.121339 179.11 204.45 1.000 r(C<->G){all} 0.157530 0.017769 0.000068 0.423581 0.121553 197.93 314.26 1.001 r(C<->T){all} 0.159664 0.018863 0.000065 0.440428 0.123114 217.13 266.75 1.000 r(G<->T){all} 0.159013 0.017427 0.000077 0.424476 0.123963 177.71 228.80 1.000 pi(A){all} 0.270312 0.000126 0.249778 0.294816 0.270264 1248.69 1318.51 1.000 pi(C){all} 0.312623 0.000137 0.289853 0.335657 0.312546 1170.79 1223.58 1.000 pi(G){all} 0.224681 0.000113 0.204736 0.245036 0.224589 1260.70 1306.63 1.000 pi(T){all} 0.192384 0.000096 0.173675 0.211821 0.192134 1104.14 1263.53 1.000 alpha{1,2} 0.369543 0.195004 0.000163 1.221630 0.222985 1131.38 1260.98 1.000 alpha{3} 0.419079 0.225001 0.000121 1.373380 0.251378 1256.73 1298.69 1.000 pinvar{all} 0.997981 0.000003 0.994818 0.999957 0.998445 1346.59 1353.01 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2020.37807 Model 2: PositiveSelection -2013.794069 Model 0: one-ratio -2019.880152 Model 7: beta -2020.56949 Model 8: beta&w>1 -2013.794067 Model 0 vs 1 0.9958360000000539 Model 2 vs 1 13.168001999999888 Additional information for M1 vs M2: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_041323614_1_1_MLBR_RS00005) Pr(w>1) post mean +- SE for w 6 G 1.000** 999.000 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_041323614_1_1_MLBR_RS00005) Pr(w>1) post mean +- SE for w 6 G 0.865 5.797 +- 3.161 Model 8 vs 7 13.550846000000092 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_041323614_1_1_MLBR_RS00005) Pr(w>1) post mean +- SE for w 6 G 1.000** 999.000 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_041323614_1_1_MLBR_RS00005) Pr(w>1) post mean +- SE for w 6 G 0.935 5.779 +- 3.008
>C1 LADDLGLGFTTVWNAVVSELNGESNTDDEATNDSTLVTPLTPQQRAWLNL VQPLTIIEGFALLSVPSSFVQNEIERHLRTPITDALSRRLGQQIQLGVRI APPSTDHIDDNSSSADVLLTDDCGTDTDENYGEPLTGEYQGLPTYFTERP HHTESTVTGGTSLNRRYTFETFVIGASNRFAHAAALAIAEAPARAYNPLF IWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRK VAFKRSYRDVDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVISSD RPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMERLAVPG DVLELIASSIERNIRELEGALIRVTAFASLNKTAIDKALAEIVLRDLIAD ASTMQISAATIMTATAEYFDTTIEELRGPGKTRALAQSRQIAMYLCRELT DLSLPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRS KRooooooooooooooooooo >C2 MFVPHAKKPEIYENQRDTSLADDLSLGFTTVWNAVVSELNGESNTDDEAT NDSTLVTPLTPQQRAWLNLVQPLTIIEGFALLSVPSSFVQNEIERHLRTP ITDALSRRLGQQIQLGVRIAPPSTDHIDDNSSSADVLLTDDCGTDTDENY GEPLTGEYQGLPTYFTERPHHTESTVTGGTSLNRRYTFETFVIGASNRFA HAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKY VSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEF FHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELE TRIAILRKKAQMERLAVPGDVLELIASSIERNIRELEGALIRVTAFASLN KTAIDKALAEIVLRDLIADASTMQISAATIMTATAEYFDTTIEELRGPGK TRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAQRKILSEMAE RREVFDHVKELTTRIRQRSKR >C3 LADDLGLGFTTVWNAVVSELNGESNTDDEATNDSTLVTPLTPQQRAWLNL VQPLTIIEGFALLSVPSSFVQNEIERHLRTPITDALSRRLGQQIQLGVRI APPSTDHIDDNSSSADVLLTDDCGTDTDENYGEPLTGEYQGLPTYFTERP HHTESTVTGGTSLNRRYTFETFVIGASNRFAHAAALAIAEAPARAYNPLF IWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRK VAFKRSYRDVDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVISSD RPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMERLAVPG DVLELIASSIERNIRELEGALIRVTAFASLNKTAIDKALAEIVLRDLIAD ASTMQISAATIMTATAEYFDTTIEELRGPGKTRALAQSRQIAMYLCRELT DLSLPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRS KRooooooooooooooooooo >C4 LADDLGLGFTTVWNAVVSELNGESNTDDEATNDSTLVTPLTPQQRAWLNL VQPLTIIEGFALLSVPSSFVQNEIERHLRTPITDALSRRLGQQIQLGVRI APPSTDHIDDNSSSADVLLTDDCGTDTDENYGEPLTGEYQGLPTYFTERP HHTESTVTGGTSLNRRYTFETFVIGASNRFAHAAALAIAEAPARAYNPLF IWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRK VAFKRSYRDVDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVISSD RPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMERLAVPG DVLELIASSIERNIRELEGALIRVTAFASLNKTAIDKALAEIVLRDLIAD ASTMQISAATIMTATAEYFDTTIEELRGPGKTRALAQSRQIAMYLCRELT DLSLPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRS KRooooooooooooooooooo >C5 MFVPHAKKPEIYENQRDTSLADDLSLGFTTVWNAVVSELNGESNTDDEAT NDSTLVTPLTPQQRAWLNLVQPLTIIEGFALLSVPSSFVQNEIERHLRTP ITDALSRRLGQQIQLGVRIAPPSTDHIDDNSSSADVLLTDDCGTDTDENY GEPLTGEYQGLPTYFTERPHHTESTVTGGTSLNRRYTFETFVIGASNRFA HAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKY VSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEF FHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELE TRIAILRKKAQMERLAVPGDVLELIASSIERNIRELEGALIRVTAFASLN KTAIDKALAEIVLRDLIADASTMQISAATIMTATAEYFDTTIEELRGPGK TRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAQRKILSEMAE RREVFDHVKELTTRIRQRSKR >C6 LADDLGLGFTTVWNAVVSELNGESNTDDEATNDSTLVTPLTPQQRAWLNL VQPLTIIEGFALLSVPSSFVQNEIERHLRTPITDALSRRLGQQIQLGVRI APPSTDHIDDNSSSADVLLTDDCGTDTDENYGEPLTGEYQGLPTYFTERP HHTESTVTGGTSLNRRYTFETFVIGASNRFAHAAALAIAEAPARAYNPLF IWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRK VAFKRSYRDVDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVISSD RPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMERLAVPG DVLELIASSIERNIRELEGALIRVTAFASLNKTAIDKALAEIVLRDLIAD ASTMQISAATIMTATAEYFDTTIEELRGPGKTRALAQSRQIAMYLCRELT DLSLPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRS KRooooooooooooooooooo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=540 C1 -------------------LADDLGLGFTTVWNAVVSELNGESNTDDEAT C2 MFVPHAKKPEIYENQRDTSLADDLSLGFTTVWNAVVSELNGESNTDDEAT C3 -------------------LADDLGLGFTTVWNAVVSELNGESNTDDEAT C4 -------------------LADDLGLGFTTVWNAVVSELNGESNTDDEAT C5 MFVPHAKKPEIYENQRDTSLADDLSLGFTTVWNAVVSELNGESNTDDEAT C6 -------------------LADDLGLGFTTVWNAVVSELNGESNTDDEAT *****.************************* C1 NDSTLVTPLTPQQRAWLNLVQPLTIIEGFALLSVPSSFVQNEIERHLRTP C2 NDSTLVTPLTPQQRAWLNLVQPLTIIEGFALLSVPSSFVQNEIERHLRTP C3 NDSTLVTPLTPQQRAWLNLVQPLTIIEGFALLSVPSSFVQNEIERHLRTP C4 NDSTLVTPLTPQQRAWLNLVQPLTIIEGFALLSVPSSFVQNEIERHLRTP C5 NDSTLVTPLTPQQRAWLNLVQPLTIIEGFALLSVPSSFVQNEIERHLRTP C6 NDSTLVTPLTPQQRAWLNLVQPLTIIEGFALLSVPSSFVQNEIERHLRTP ************************************************** C1 ITDALSRRLGQQIQLGVRIAPPSTDHIDDNSSSADVLLTDDCGTDTDENY C2 ITDALSRRLGQQIQLGVRIAPPSTDHIDDNSSSADVLLTDDCGTDTDENY C3 ITDALSRRLGQQIQLGVRIAPPSTDHIDDNSSSADVLLTDDCGTDTDENY C4 ITDALSRRLGQQIQLGVRIAPPSTDHIDDNSSSADVLLTDDCGTDTDENY C5 ITDALSRRLGQQIQLGVRIAPPSTDHIDDNSSSADVLLTDDCGTDTDENY C6 ITDALSRRLGQQIQLGVRIAPPSTDHIDDNSSSADVLLTDDCGTDTDENY ************************************************** C1 GEPLTGEYQGLPTYFTERPHHTESTVTGGTSLNRRYTFETFVIGASNRFA C2 GEPLTGEYQGLPTYFTERPHHTESTVTGGTSLNRRYTFETFVIGASNRFA C3 GEPLTGEYQGLPTYFTERPHHTESTVTGGTSLNRRYTFETFVIGASNRFA C4 GEPLTGEYQGLPTYFTERPHHTESTVTGGTSLNRRYTFETFVIGASNRFA C5 GEPLTGEYQGLPTYFTERPHHTESTVTGGTSLNRRYTFETFVIGASNRFA C6 GEPLTGEYQGLPTYFTERPHHTESTVTGGTSLNRRYTFETFVIGASNRFA ************************************************** C1 HAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKY C2 HAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKY C3 HAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKY C4 HAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKY C5 HAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKY C6 HAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKY ************************************************** C1 VSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEF C2 VSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEF C3 VSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEF C4 VSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEF C5 VSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEF C6 VSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEF ************************************************** C1 FHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELE C2 FHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELE C3 FHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELE C4 FHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELE C5 FHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELE C6 FHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELE ************************************************** C1 TRIAILRKKAQMERLAVPGDVLELIASSIERNIRELEGALIRVTAFASLN C2 TRIAILRKKAQMERLAVPGDVLELIASSIERNIRELEGALIRVTAFASLN C3 TRIAILRKKAQMERLAVPGDVLELIASSIERNIRELEGALIRVTAFASLN C4 TRIAILRKKAQMERLAVPGDVLELIASSIERNIRELEGALIRVTAFASLN C5 TRIAILRKKAQMERLAVPGDVLELIASSIERNIRELEGALIRVTAFASLN C6 TRIAILRKKAQMERLAVPGDVLELIASSIERNIRELEGALIRVTAFASLN ************************************************** C1 KTAIDKALAEIVLRDLIADASTMQISAATIMTATAEYFDTTIEELRGPGK C2 KTAIDKALAEIVLRDLIADASTMQISAATIMTATAEYFDTTIEELRGPGK C3 KTAIDKALAEIVLRDLIADASTMQISAATIMTATAEYFDTTIEELRGPGK C4 KTAIDKALAEIVLRDLIADASTMQISAATIMTATAEYFDTTIEELRGPGK C5 KTAIDKALAEIVLRDLIADASTMQISAATIMTATAEYFDTTIEELRGPGK C6 KTAIDKALAEIVLRDLIADASTMQISAATIMTATAEYFDTTIEELRGPGK ************************************************** C1 TRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAQRKILSEMAE C2 TRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAQRKILSEMAE C3 TRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAQRKILSEMAE C4 TRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAQRKILSEMAE C5 TRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAQRKILSEMAE C6 TRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAQRKILSEMAE ************************************************** C1 RREVFDHVKELTTRIRQRSKRooooooooooooooooooo C2 RREVFDHVKELTTRIRQRSKR------------------- C3 RREVFDHVKELTTRIRQRSKRooooooooooooooooooo C4 RREVFDHVKELTTRIRQRSKRooooooooooooooooooo C5 RREVFDHVKELTTRIRQRSKR------------------- C6 RREVFDHVKELTTRIRQRSKRooooooooooooooooooo ********************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 521 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 521 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18162] Library Relaxation: Multi_proc [96] Relaxation Summary: [18162]--->[15790] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.570 Mb, Max= 31.174 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 LADDLGLGFTTVWNAVVSELNGESNTDDEATNDSTLVTPLTPQQRAWLNL C2 LADDLSLGFTTVWNAVVSELNGESNTDDEATNDSTLVTPLTPQQRAWLNL C3 LADDLGLGFTTVWNAVVSELNGESNTDDEATNDSTLVTPLTPQQRAWLNL C4 LADDLGLGFTTVWNAVVSELNGESNTDDEATNDSTLVTPLTPQQRAWLNL C5 LADDLSLGFTTVWNAVVSELNGESNTDDEATNDSTLVTPLTPQQRAWLNL C6 LADDLGLGFTTVWNAVVSELNGESNTDDEATNDSTLVTPLTPQQRAWLNL *****.******************************************** C1 VQPLTIIEGFALLSVPSSFVQNEIERHLRTPITDALSRRLGQQIQLGVRI C2 VQPLTIIEGFALLSVPSSFVQNEIERHLRTPITDALSRRLGQQIQLGVRI C3 VQPLTIIEGFALLSVPSSFVQNEIERHLRTPITDALSRRLGQQIQLGVRI C4 VQPLTIIEGFALLSVPSSFVQNEIERHLRTPITDALSRRLGQQIQLGVRI C5 VQPLTIIEGFALLSVPSSFVQNEIERHLRTPITDALSRRLGQQIQLGVRI C6 VQPLTIIEGFALLSVPSSFVQNEIERHLRTPITDALSRRLGQQIQLGVRI ************************************************** C1 APPSTDHIDDNSSSADVLLTDDCGTDTDENYGEPLTGEYQGLPTYFTERP C2 APPSTDHIDDNSSSADVLLTDDCGTDTDENYGEPLTGEYQGLPTYFTERP C3 APPSTDHIDDNSSSADVLLTDDCGTDTDENYGEPLTGEYQGLPTYFTERP C4 APPSTDHIDDNSSSADVLLTDDCGTDTDENYGEPLTGEYQGLPTYFTERP C5 APPSTDHIDDNSSSADVLLTDDCGTDTDENYGEPLTGEYQGLPTYFTERP C6 APPSTDHIDDNSSSADVLLTDDCGTDTDENYGEPLTGEYQGLPTYFTERP ************************************************** C1 HHTESTVTGGTSLNRRYTFETFVIGASNRFAHAAALAIAEAPARAYNPLF C2 HHTESTVTGGTSLNRRYTFETFVIGASNRFAHAAALAIAEAPARAYNPLF C3 HHTESTVTGGTSLNRRYTFETFVIGASNRFAHAAALAIAEAPARAYNPLF C4 HHTESTVTGGTSLNRRYTFETFVIGASNRFAHAAALAIAEAPARAYNPLF C5 HHTESTVTGGTSLNRRYTFETFVIGASNRFAHAAALAIAEAPARAYNPLF C6 HHTESTVTGGTSLNRRYTFETFVIGASNRFAHAAALAIAEAPARAYNPLF ************************************************** C1 IWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRK C2 IWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRK C3 IWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRK C4 IWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRK C5 IWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRK C6 IWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRK ************************************************** C1 VAFKRSYRDVDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVISSD C2 VAFKRSYRDVDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVISSD C3 VAFKRSYRDVDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVISSD C4 VAFKRSYRDVDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVISSD C5 VAFKRSYRDVDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVISSD C6 VAFKRSYRDVDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVISSD ************************************************** C1 RPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMERLAVPG C2 RPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMERLAVPG C3 RPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMERLAVPG C4 RPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMERLAVPG C5 RPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMERLAVPG C6 RPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMERLAVPG ************************************************** C1 DVLELIASSIERNIRELEGALIRVTAFASLNKTAIDKALAEIVLRDLIAD C2 DVLELIASSIERNIRELEGALIRVTAFASLNKTAIDKALAEIVLRDLIAD C3 DVLELIASSIERNIRELEGALIRVTAFASLNKTAIDKALAEIVLRDLIAD C4 DVLELIASSIERNIRELEGALIRVTAFASLNKTAIDKALAEIVLRDLIAD C5 DVLELIASSIERNIRELEGALIRVTAFASLNKTAIDKALAEIVLRDLIAD C6 DVLELIASSIERNIRELEGALIRVTAFASLNKTAIDKALAEIVLRDLIAD ************************************************** C1 ASTMQISAATIMTATAEYFDTTIEELRGPGKTRALAQSRQIAMYLCRELT C2 ASTMQISAATIMTATAEYFDTTIEELRGPGKTRALAQSRQIAMYLCRELT C3 ASTMQISAATIMTATAEYFDTTIEELRGPGKTRALAQSRQIAMYLCRELT C4 ASTMQISAATIMTATAEYFDTTIEELRGPGKTRALAQSRQIAMYLCRELT C5 ASTMQISAATIMTATAEYFDTTIEELRGPGKTRALAQSRQIAMYLCRELT C6 ASTMQISAATIMTATAEYFDTTIEELRGPGKTRALAQSRQIAMYLCRELT ************************************************** C1 DLSLPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRS C2 DLSLPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRS C3 DLSLPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRS C4 DLSLPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRS C5 DLSLPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRS C6 DLSLPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRS ************************************************** C1 KR C2 KR C3 KR C4 KR C5 KR C6 KR ** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:97 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 99.80 C1 C2 99.80 TOP 1 0 99.80 C2 C1 99.80 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 99.80 C1 C5 99.80 TOP 4 0 99.80 C5 C1 99.80 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 99.80 C2 C3 99.80 TOP 2 1 99.80 C3 C2 99.80 BOT 1 3 99.80 C2 C4 99.80 TOP 3 1 99.80 C4 C2 99.80 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 99.80 C2 C6 99.80 TOP 5 1 99.80 C6 C2 99.80 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 99.80 C3 C5 99.80 TOP 4 2 99.80 C5 C3 99.80 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 99.80 C4 C5 99.80 TOP 4 3 99.80 C5 C4 99.80 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 99.80 C5 C6 99.80 TOP 5 4 99.80 C6 C5 99.80 AVG 0 C1 * 99.92 AVG 1 C2 * 99.84 AVG 2 C3 * 99.92 AVG 3 C4 * 99.92 AVG 4 C5 * 99.84 AVG 5 C6 * 99.92 TOT TOT * 99.89 CLUSTAL W (1.83) multiple sequence alignment C1 -------------------------------------------------- C2 ATGTTTGTACCGCACGCCAAAAAGCCCGAAATTTACGAGAACCAGAGAGA C3 -------------------------------------------------- C4 -------------------------------------------------- C5 ATGTTTGTACCGCACGCCAAAAAGCCCGAAATTTACGAGAACCAGAGAGA C6 -------------------------------------------------- C1 -------TTGGCCGATGACCTTGGTCTAGGTTTCACCACGGTTTGGAACG C2 TACGTCGTTGGCCGATGACCTTAGTCTAGGTTTCACCACGGTTTGGAACG C3 -------TTGGCCGATGACCTTGGTCTAGGTTTCACCACGGTTTGGAACG C4 -------TTGGCCGATGACCTTGGTCTAGGTTTCACCACGGTTTGGAACG C5 TACGTCGTTGGCCGATGACCTTAGTCTAGGTTTCACCACGGTTTGGAACG C6 -------TTGGCCGATGACCTTGGTCTAGGTTTCACCACGGTTTGGAACG ***************.*************************** C1 CAGTCGTCTCCGAACTCAACGGCGAATCCAACACAGACGACGAAGCCACC C2 CAGTCGTCTCCGAACTCAACGGCGAATCCAACACAGACGACGAAGCCACC C3 CAGTCGTCTCCGAACTCAACGGCGAATCCAACACAGACGACGAAGCCACC C4 CAGTCGTCTCCGAACTCAACGGCGAATCCAACACAGACGACGAAGCCACC C5 CAGTCGTCTCCGAACTCAACGGCGAATCCAACACAGACGACGAAGCCACC C6 CAGTCGTCTCCGAACTCAACGGCGAATCCAACACAGACGACGAAGCCACC ************************************************** C1 AACGACAGCACCCTAGTCACTCCGCTAACTCCTCAGCAAAGAGCATGGCT C2 AACGACAGCACCCTAGTCACTCCGCTAACTCCTCAGCAAAGAGCATGGCT C3 AACGACAGCACCCTAGTCACTCCGCTAACTCCTCAGCAAAGAGCATGGCT C4 AACGACAGCACCCTAGTCACTCCGCTAACTCCTCAGCAAAGAGCATGGCT C5 AACGACAGCACCCTAGTCACTCCGCTAACTCCTCAGCAAAGAGCATGGCT C6 AACGACAGCACCCTAGTCACTCCGCTAACTCCTCAGCAAAGAGCATGGCT ************************************************** C1 AAATCTGGTTCAACCACTCACCATCATCGAGGGATTTGCTCTTTTATCGG C2 AAATCTGGTTCAACCACTCACCATCATCGAGGGATTTGCTCTTTTATCGG C3 AAATCTGGTTCAACCACTCACCATCATCGAGGGATTTGCTCTTTTATCGG C4 AAATCTGGTTCAACCACTCACCATCATCGAGGGATTTGCTCTTTTATCGG C5 AAATCTGGTTCAACCACTCACCATCATCGAGGGATTTGCTCTTTTATCGG C6 AAATCTGGTTCAACCACTCACCATCATCGAGGGATTTGCTCTTTTATCGG ************************************************** C1 TGCCCAGCAGCTTTGTCCAAAATGAAATTGAACGTCATCTACGAACGCCA C2 TGCCCAGCAGCTTTGTCCAAAATGAAATTGAACGTCATCTACGAACGCCA C3 TGCCCAGCAGCTTTGTCCAAAATGAAATTGAACGTCATCTACGAACGCCA C4 TGCCCAGCAGCTTTGTCCAAAATGAAATTGAACGTCATCTACGAACGCCA C5 TGCCCAGCAGCTTTGTCCAAAATGAAATTGAACGTCATCTACGAACGCCA C6 TGCCCAGCAGCTTTGTCCAAAATGAAATTGAACGTCATCTACGAACGCCA ************************************************** C1 ATCACCGATGCACTCAGCCGTCGACTCGGACAACAGATACAGCTCGGAGT C2 ATCACCGATGCACTCAGCCGTCGACTCGGACAACAGATACAGCTCGGAGT C3 ATCACCGATGCACTCAGCCGTCGACTCGGACAACAGATACAGCTCGGAGT C4 ATCACCGATGCACTCAGCCGTCGACTCGGACAACAGATACAGCTCGGAGT C5 ATCACCGATGCACTCAGCCGTCGACTCGGACAACAGATACAGCTCGGAGT C6 ATCACCGATGCACTCAGCCGTCGACTCGGACAACAGATACAGCTCGGAGT ************************************************** C1 CCGTATCGCACCGCCCTCTACCGACCATATTGACGACAATTCCTCGTCAG C2 CCGTATCGCACCGCCCTCTACCGACCATATTGACGACAATTCCTCGTCAG C3 CCGTATCGCACCGCCCTCTACCGACCATATTGACGACAATTCCTCGTCAG C4 CCGTATCGCACCGCCCTCTACCGACCATATTGACGACAATTCCTCGTCAG C5 CCGTATCGCACCGCCCTCTACCGACCATATTGACGACAATTCCTCGTCAG C6 CCGTATCGCACCGCCCTCTACCGACCATATTGACGACAATTCCTCGTCAG ************************************************** C1 CCGACGTCCTTCTAACCGACGATTGCGGCACAGATACAGACGAAAATTAC C2 CCGACGTCCTTCTAACCGACGATTGCGGCACAGATACAGACGAAAATTAC C3 CCGACGTCCTTCTAACCGACGATTGCGGCACAGATACAGACGAAAATTAC C4 CCGACGTCCTTCTAACCGACGATTGCGGCACAGATACAGACGAAAATTAC C5 CCGACGTCCTTCTAACCGACGATTGCGGCACAGATACAGACGAAAATTAC C6 CCGACGTCCTTCTAACCGACGATTGCGGCACAGATACAGACGAAAATTAC ************************************************** C1 GGGGAGCCTCTTACAGGCGAGTACCAGGGTTTGCCAACCTACTTCACCGA C2 GGGGAGCCTCTTACAGGCGAGTACCAGGGTTTGCCAACCTACTTCACCGA C3 GGGGAGCCTCTTACAGGCGAGTACCAGGGTTTGCCAACCTACTTCACCGA C4 GGGGAGCCTCTTACAGGCGAGTACCAGGGTTTGCCAACCTACTTCACCGA C5 GGGGAGCCTCTTACAGGCGAGTACCAGGGTTTGCCAACCTACTTCACCGA C6 GGGGAGCCTCTTACAGGCGAGTACCAGGGTTTGCCAACCTACTTCACCGA ************************************************** C1 ACGTCCGCACCATACCGAATCAACCGTCACGGGAGGTACCAGCCTTAATC C2 ACGTCCGCACCATACCGAATCAACCGTCACGGGAGGTACCAGCCTTAATC C3 ACGTCCGCACCATACCGAATCAACCGTCACGGGAGGTACCAGCCTTAATC C4 ACGTCCGCACCATACCGAATCAACCGTCACGGGAGGTACCAGCCTTAATC C5 ACGTCCGCACCATACCGAATCAACCGTCACGGGAGGTACCAGCCTTAATC C6 ACGTCCGCACCATACCGAATCAACCGTCACGGGAGGTACCAGCCTTAATC ************************************************** C1 GCCGTTACACCTTCGAAACGTTCGTTATTGGCGCGTCGAATCGGTTCGCG C2 GCCGTTACACCTTCGAAACGTTCGTTATTGGCGCGTCGAATCGGTTCGCG C3 GCCGTTACACCTTCGAAACGTTCGTTATTGGCGCGTCGAATCGGTTCGCG C4 GCCGTTACACCTTCGAAACGTTCGTTATTGGCGCGTCGAATCGGTTCGCG C5 GCCGTTACACCTTCGAAACGTTCGTTATTGGCGCGTCGAATCGGTTCGCG C6 GCCGTTACACCTTCGAAACGTTCGTTATTGGCGCGTCGAATCGGTTCGCG ************************************************** C1 CATGCTGCCGCGCTAGCGATAGCCGAAGCACCGGCCCGAGCCTACAACCC C2 CATGCTGCCGCGCTAGCGATAGCCGAAGCACCGGCCCGAGCCTACAACCC C3 CATGCTGCCGCGCTAGCGATAGCCGAAGCACCGGCCCGAGCCTACAACCC C4 CATGCTGCCGCGCTAGCGATAGCCGAAGCACCGGCCCGAGCCTACAACCC C5 CATGCTGCCGCGCTAGCGATAGCCGAAGCACCGGCCCGAGCCTACAACCC C6 CATGCTGCCGCGCTAGCGATAGCCGAAGCACCGGCCCGAGCCTACAACCC ************************************************** C1 CCTTTTCATTTGGGGCGAGTCAGGTCTTGGCAAAACCCACCTATTGCACG C2 CCTTTTCATTTGGGGCGAGTCAGGTCTTGGCAAAACCCACCTATTGCACG C3 CCTTTTCATTTGGGGCGAGTCAGGTCTTGGCAAAACCCACCTATTGCACG C4 CCTTTTCATTTGGGGCGAGTCAGGTCTTGGCAAAACCCACCTATTGCACG C5 CCTTTTCATTTGGGGCGAGTCAGGTCTTGGCAAAACCCACCTATTGCACG C6 CCTTTTCATTTGGGGCGAGTCAGGTCTTGGCAAAACCCACCTATTGCACG ************************************************** C1 CCGCCGGGAACTACGCACAACGACTGTTTCCCGGCATGCGGGTCAAATAT C2 CCGCCGGGAACTACGCACAACGACTGTTTCCCGGCATGCGGGTCAAATAT C3 CCGCCGGGAACTACGCACAACGACTGTTTCCCGGCATGCGGGTCAAATAT C4 CCGCCGGGAACTACGCACAACGACTGTTTCCCGGCATGCGGGTCAAATAT C5 CCGCCGGGAACTACGCACAACGACTGTTTCCCGGCATGCGGGTCAAATAT C6 CCGCCGGGAACTACGCACAACGACTGTTTCCCGGCATGCGGGTCAAATAT ************************************************** C1 GTCTCCACAGAAGAATTCACCAACGACTTCATCAACTCGCTCCGTGACGA C2 GTCTCCACAGAAGAATTCACCAACGACTTCATCAACTCGCTCCGTGACGA C3 GTCTCCACAGAAGAATTCACCAACGACTTCATCAACTCGCTCCGTGACGA C4 GTCTCCACAGAAGAATTCACCAACGACTTCATCAACTCGCTCCGTGACGA C5 GTCTCCACAGAAGAATTCACCAACGACTTCATCAACTCGCTCCGTGACGA C6 GTCTCCACAGAAGAATTCACCAACGACTTCATCAACTCGCTCCGTGACGA ************************************************** C1 CCGCAAAGTAGCGTTCAAACGCAGCTACCGCGACGTCGATGTGCTACTGG C2 CCGCAAAGTAGCGTTCAAACGCAGCTACCGCGACGTCGATGTGCTACTGG C3 CCGCAAAGTAGCGTTCAAACGCAGCTACCGCGACGTCGATGTGCTACTGG C4 CCGCAAAGTAGCGTTCAAACGCAGCTACCGCGACGTCGATGTGCTACTGG C5 CCGCAAAGTAGCGTTCAAACGCAGCTACCGCGACGTCGATGTGCTACTGG C6 CCGCAAAGTAGCGTTCAAACGCAGCTACCGCGACGTCGATGTGCTACTGG ************************************************** C1 TCGATGACATCCAATTCATCGAAGGAAAAGAAGGTATACAAGAAGAGTTC C2 TCGATGACATCCAATTCATCGAAGGAAAAGAAGGTATACAAGAAGAGTTC C3 TCGATGACATCCAATTCATCGAAGGAAAAGAAGGTATACAAGAAGAGTTC C4 TCGATGACATCCAATTCATCGAAGGAAAAGAAGGTATACAAGAAGAGTTC C5 TCGATGACATCCAATTCATCGAAGGAAAAGAAGGTATACAAGAAGAGTTC C6 TCGATGACATCCAATTCATCGAAGGAAAAGAAGGTATACAAGAAGAGTTC ************************************************** C1 TTCCATACCTTTAATACCTTACATAACGCCAACAAGCAAATCGTCATCTC C2 TTCCATACCTTTAATACCTTACATAACGCCAACAAGCAAATCGTCATCTC C3 TTCCATACCTTTAATACCTTACATAACGCCAACAAGCAAATCGTCATCTC C4 TTCCATACCTTTAATACCTTACATAACGCCAACAAGCAAATCGTCATCTC C5 TTCCATACCTTTAATACCTTACATAACGCCAACAAGCAAATCGTCATCTC C6 TTCCATACCTTTAATACCTTACATAACGCCAACAAGCAAATCGTCATCTC ************************************************** C1 TTCTGACCGCCCACCGAAACAACTCGCCACCCTCGAAGACCGACTAAGGA C2 TTCTGACCGCCCACCGAAACAACTCGCCACCCTCGAAGACCGACTAAGGA C3 TTCTGACCGCCCACCGAAACAACTCGCCACCCTCGAAGACCGACTAAGGA C4 TTCTGACCGCCCACCGAAACAACTCGCCACCCTCGAAGACCGACTAAGGA C5 TTCTGACCGCCCACCGAAACAACTCGCCACCCTCGAAGACCGACTAAGGA C6 TTCTGACCGCCCACCGAAACAACTCGCCACCCTCGAAGACCGACTAAGGA ************************************************** C1 CCCGGTTCGAGTGGGGGCTTATTACCGACGTACAACCCCCTGAACTAGAA C2 CCCGGTTCGAGTGGGGGCTTATTACCGACGTACAACCCCCTGAACTAGAA C3 CCCGGTTCGAGTGGGGGCTTATTACCGACGTACAACCCCCTGAACTAGAA C4 CCCGGTTCGAGTGGGGGCTTATTACCGACGTACAACCCCCTGAACTAGAA C5 CCCGGTTCGAGTGGGGGCTTATTACCGACGTACAACCCCCTGAACTAGAA C6 CCCGGTTCGAGTGGGGGCTTATTACCGACGTACAACCCCCTGAACTAGAA ************************************************** C1 ACCCGCATCGCCATCTTGCGTAAGAAAGCCCAGATGGAACGCCTAGCGGT C2 ACCCGCATCGCCATCTTGCGTAAGAAAGCCCAGATGGAACGCCTAGCGGT C3 ACCCGCATCGCCATCTTGCGTAAGAAAGCCCAGATGGAACGCCTAGCGGT C4 ACCCGCATCGCCATCTTGCGTAAGAAAGCCCAGATGGAACGCCTAGCGGT C5 ACCCGCATCGCCATCTTGCGTAAGAAAGCCCAGATGGAACGCCTAGCGGT C6 ACCCGCATCGCCATCTTGCGTAAGAAAGCCCAGATGGAACGCCTAGCGGT ************************************************** C1 GCCTGGCGATGTCCTCGAACTCATCGCCAGCAGTATCGAACGTAACATCC C2 GCCTGGCGATGTCCTCGAACTCATCGCCAGCAGTATCGAACGTAACATCC C3 GCCTGGCGATGTCCTCGAACTCATCGCCAGCAGTATCGAACGTAACATCC C4 GCCTGGCGATGTCCTCGAACTCATCGCCAGCAGTATCGAACGTAACATCC C5 GCCTGGCGATGTCCTCGAACTCATCGCCAGCAGTATCGAACGTAACATCC C6 GCCTGGCGATGTCCTCGAACTCATCGCCAGCAGTATCGAACGTAACATCC ************************************************** C1 GTGAACTCGAGGGAGCTCTCATCAGAGTCACCGCGTTTGCTTCGCTCAAC C2 GTGAACTCGAGGGAGCTCTCATCAGAGTCACCGCGTTTGCTTCGCTCAAC C3 GTGAACTCGAGGGAGCTCTCATCAGAGTCACCGCGTTTGCTTCGCTCAAC C4 GTGAACTCGAGGGAGCTCTCATCAGAGTCACCGCGTTTGCTTCGCTCAAC C5 GTGAACTCGAGGGAGCTCTCATCAGAGTCACCGCGTTTGCTTCGCTCAAC C6 GTGAACTCGAGGGAGCTCTCATCAGAGTCACCGCGTTTGCTTCGCTCAAC ************************************************** C1 AAGACTGCAATCGACAAAGCATTAGCGGAAATCGTACTGCGTGACCTGAT C2 AAGACTGCAATCGACAAAGCATTAGCGGAAATCGTACTGCGTGACCTGAT C3 AAGACTGCAATCGACAAAGCATTAGCGGAAATCGTACTGCGTGACCTGAT C4 AAGACTGCAATCGACAAAGCATTAGCGGAAATCGTACTGCGTGACCTGAT C5 AAGACTGCAATCGACAAAGCATTAGCGGAAATCGTACTGCGTGACCTGAT C6 AAGACTGCAATCGACAAAGCATTAGCGGAAATCGTACTGCGTGACCTGAT ************************************************** C1 CGCAGACGCCAGCACGATGCAAATCAGTGCGGCAACCATAATGACAGCCA C2 CGCAGACGCCAGCACGATGCAAATCAGTGCGGCAACCATAATGACAGCCA C3 CGCAGACGCCAGCACGATGCAAATCAGTGCGGCAACCATAATGACAGCCA C4 CGCAGACGCCAGCACGATGCAAATCAGTGCGGCAACCATAATGACAGCCA C5 CGCAGACGCCAGCACGATGCAAATCAGTGCGGCAACCATAATGACAGCCA C6 CGCAGACGCCAGCACGATGCAAATCAGTGCGGCAACCATAATGACAGCCA ************************************************** C1 CCGCCGAATACTTCGATACCACCATCGAAGAACTCCGTGGGCCAGGCAAA C2 CCGCCGAATACTTCGATACCACCATCGAAGAACTCCGTGGGCCAGGCAAA C3 CCGCCGAATACTTCGATACCACCATCGAAGAACTCCGTGGGCCAGGCAAA C4 CCGCCGAATACTTCGATACCACCATCGAAGAACTCCGTGGGCCAGGCAAA C5 CCGCCGAATACTTCGATACCACCATCGAAGAACTCCGTGGGCCAGGCAAA C6 CCGCCGAATACTTCGATACCACCATCGAAGAACTCCGTGGGCCAGGCAAA ************************************************** C1 ACCCGAGCACTGGCCCAGTCACGCCAGATCGCGATGTATTTGTGTCGTGA C2 ACCCGAGCACTGGCCCAGTCACGCCAGATCGCGATGTATTTGTGTCGTGA C3 ACCCGAGCACTGGCCCAGTCACGCCAGATCGCGATGTATTTGTGTCGTGA C4 ACCCGAGCACTGGCCCAGTCACGCCAGATCGCGATGTATTTGTGTCGTGA C5 ACCCGAGCACTGGCCCAGTCACGCCAGATCGCGATGTATTTGTGTCGTGA C6 ACCCGAGCACTGGCCCAGTCACGCCAGATCGCGATGTATTTGTGTCGTGA ************************************************** C1 ACTCACCGACCTCTCGCTACCCAAGATCGGCCAAGCATTCGGCCGTGACC C2 ACTCACCGACCTCTCGCTACCCAAGATCGGCCAAGCATTCGGCCGTGACC C3 ACTCACCGACCTCTCGCTACCCAAGATCGGCCAAGCATTCGGCCGTGACC C4 ACTCACCGACCTCTCGCTACCCAAGATCGGCCAAGCATTCGGCCGTGACC C5 ACTCACCGACCTCTCGCTACCCAAGATCGGCCAAGCATTCGGCCGTGACC C6 ACTCACCGACCTCTCGCTACCCAAGATCGGCCAAGCATTCGGCCGTGACC ************************************************** C1 ACACCACGGTTATGTACGCACAACGAAAAATCTTGTCCGAGATGGCTGAA C2 ACACCACGGTTATGTACGCACAACGAAAAATCTTGTCCGAGATGGCTGAA C3 ACACCACGGTTATGTACGCACAACGAAAAATCTTGTCCGAGATGGCTGAA C4 ACACCACGGTTATGTACGCACAACGAAAAATCTTGTCCGAGATGGCTGAA C5 ACACCACGGTTATGTACGCACAACGAAAAATCTTGTCCGAGATGGCTGAA C6 ACACCACGGTTATGTACGCACAACGAAAAATCTTGTCCGAGATGGCTGAA ************************************************** C1 CGTCGCGAAGTGTTCGACCACGTCAAGGAACTCACCACTCGCATCCGGCA C2 CGTCGCGAAGTGTTCGACCACGTCAAGGAACTCACCACTCGCATCCGGCA C3 CGTCGCGAAGTGTTCGACCACGTCAAGGAACTCACCACTCGCATCCGGCA C4 CGTCGCGAAGTGTTCGACCACGTCAAGGAACTCACCACTCGCATCCGGCA C5 CGTCGCGAAGTGTTCGACCACGTCAAGGAACTCACCACTCGCATCCGGCA C6 CGTCGCGAAGTGTTCGACCACGTCAAGGAACTCACCACTCGCATCCGGCA ************************************************** C1 ACGGTCTAAGCGC------------------------------------- C2 ACGGTCTAAGCGC------------------------------------- C3 ACGGTCTAAGCGC------------------------------------- C4 ACGGTCTAAGCGC------------------------------------- C5 ACGGTCTAAGCGC------------------------------------- C6 ACGGTCTAAGCGC------------------------------------- ************* C1 -------------------- C2 -------------------- C3 -------------------- C4 -------------------- C5 -------------------- C6 -------------------- >C1 -------------------------------------------------- -------TTGGCCGATGACCTTGGTCTAGGTTTCACCACGGTTTGGAACG CAGTCGTCTCCGAACTCAACGGCGAATCCAACACAGACGACGAAGCCACC AACGACAGCACCCTAGTCACTCCGCTAACTCCTCAGCAAAGAGCATGGCT AAATCTGGTTCAACCACTCACCATCATCGAGGGATTTGCTCTTTTATCGG TGCCCAGCAGCTTTGTCCAAAATGAAATTGAACGTCATCTACGAACGCCA ATCACCGATGCACTCAGCCGTCGACTCGGACAACAGATACAGCTCGGAGT CCGTATCGCACCGCCCTCTACCGACCATATTGACGACAATTCCTCGTCAG CCGACGTCCTTCTAACCGACGATTGCGGCACAGATACAGACGAAAATTAC GGGGAGCCTCTTACAGGCGAGTACCAGGGTTTGCCAACCTACTTCACCGA ACGTCCGCACCATACCGAATCAACCGTCACGGGAGGTACCAGCCTTAATC GCCGTTACACCTTCGAAACGTTCGTTATTGGCGCGTCGAATCGGTTCGCG CATGCTGCCGCGCTAGCGATAGCCGAAGCACCGGCCCGAGCCTACAACCC CCTTTTCATTTGGGGCGAGTCAGGTCTTGGCAAAACCCACCTATTGCACG CCGCCGGGAACTACGCACAACGACTGTTTCCCGGCATGCGGGTCAAATAT GTCTCCACAGAAGAATTCACCAACGACTTCATCAACTCGCTCCGTGACGA CCGCAAAGTAGCGTTCAAACGCAGCTACCGCGACGTCGATGTGCTACTGG TCGATGACATCCAATTCATCGAAGGAAAAGAAGGTATACAAGAAGAGTTC TTCCATACCTTTAATACCTTACATAACGCCAACAAGCAAATCGTCATCTC TTCTGACCGCCCACCGAAACAACTCGCCACCCTCGAAGACCGACTAAGGA CCCGGTTCGAGTGGGGGCTTATTACCGACGTACAACCCCCTGAACTAGAA ACCCGCATCGCCATCTTGCGTAAGAAAGCCCAGATGGAACGCCTAGCGGT GCCTGGCGATGTCCTCGAACTCATCGCCAGCAGTATCGAACGTAACATCC GTGAACTCGAGGGAGCTCTCATCAGAGTCACCGCGTTTGCTTCGCTCAAC AAGACTGCAATCGACAAAGCATTAGCGGAAATCGTACTGCGTGACCTGAT CGCAGACGCCAGCACGATGCAAATCAGTGCGGCAACCATAATGACAGCCA CCGCCGAATACTTCGATACCACCATCGAAGAACTCCGTGGGCCAGGCAAA ACCCGAGCACTGGCCCAGTCACGCCAGATCGCGATGTATTTGTGTCGTGA ACTCACCGACCTCTCGCTACCCAAGATCGGCCAAGCATTCGGCCGTGACC ACACCACGGTTATGTACGCACAACGAAAAATCTTGTCCGAGATGGCTGAA CGTCGCGAAGTGTTCGACCACGTCAAGGAACTCACCACTCGCATCCGGCA ACGGTCTAAGCGC------------------------------------- -------------------- >C2 ATGTTTGTACCGCACGCCAAAAAGCCCGAAATTTACGAGAACCAGAGAGA TACGTCGTTGGCCGATGACCTTAGTCTAGGTTTCACCACGGTTTGGAACG CAGTCGTCTCCGAACTCAACGGCGAATCCAACACAGACGACGAAGCCACC AACGACAGCACCCTAGTCACTCCGCTAACTCCTCAGCAAAGAGCATGGCT AAATCTGGTTCAACCACTCACCATCATCGAGGGATTTGCTCTTTTATCGG TGCCCAGCAGCTTTGTCCAAAATGAAATTGAACGTCATCTACGAACGCCA ATCACCGATGCACTCAGCCGTCGACTCGGACAACAGATACAGCTCGGAGT CCGTATCGCACCGCCCTCTACCGACCATATTGACGACAATTCCTCGTCAG CCGACGTCCTTCTAACCGACGATTGCGGCACAGATACAGACGAAAATTAC GGGGAGCCTCTTACAGGCGAGTACCAGGGTTTGCCAACCTACTTCACCGA ACGTCCGCACCATACCGAATCAACCGTCACGGGAGGTACCAGCCTTAATC GCCGTTACACCTTCGAAACGTTCGTTATTGGCGCGTCGAATCGGTTCGCG CATGCTGCCGCGCTAGCGATAGCCGAAGCACCGGCCCGAGCCTACAACCC CCTTTTCATTTGGGGCGAGTCAGGTCTTGGCAAAACCCACCTATTGCACG CCGCCGGGAACTACGCACAACGACTGTTTCCCGGCATGCGGGTCAAATAT GTCTCCACAGAAGAATTCACCAACGACTTCATCAACTCGCTCCGTGACGA CCGCAAAGTAGCGTTCAAACGCAGCTACCGCGACGTCGATGTGCTACTGG TCGATGACATCCAATTCATCGAAGGAAAAGAAGGTATACAAGAAGAGTTC TTCCATACCTTTAATACCTTACATAACGCCAACAAGCAAATCGTCATCTC TTCTGACCGCCCACCGAAACAACTCGCCACCCTCGAAGACCGACTAAGGA CCCGGTTCGAGTGGGGGCTTATTACCGACGTACAACCCCCTGAACTAGAA ACCCGCATCGCCATCTTGCGTAAGAAAGCCCAGATGGAACGCCTAGCGGT GCCTGGCGATGTCCTCGAACTCATCGCCAGCAGTATCGAACGTAACATCC GTGAACTCGAGGGAGCTCTCATCAGAGTCACCGCGTTTGCTTCGCTCAAC AAGACTGCAATCGACAAAGCATTAGCGGAAATCGTACTGCGTGACCTGAT CGCAGACGCCAGCACGATGCAAATCAGTGCGGCAACCATAATGACAGCCA CCGCCGAATACTTCGATACCACCATCGAAGAACTCCGTGGGCCAGGCAAA ACCCGAGCACTGGCCCAGTCACGCCAGATCGCGATGTATTTGTGTCGTGA ACTCACCGACCTCTCGCTACCCAAGATCGGCCAAGCATTCGGCCGTGACC ACACCACGGTTATGTACGCACAACGAAAAATCTTGTCCGAGATGGCTGAA CGTCGCGAAGTGTTCGACCACGTCAAGGAACTCACCACTCGCATCCGGCA ACGGTCTAAGCGC------------------------------------- -------------------- >C3 -------------------------------------------------- -------TTGGCCGATGACCTTGGTCTAGGTTTCACCACGGTTTGGAACG CAGTCGTCTCCGAACTCAACGGCGAATCCAACACAGACGACGAAGCCACC AACGACAGCACCCTAGTCACTCCGCTAACTCCTCAGCAAAGAGCATGGCT AAATCTGGTTCAACCACTCACCATCATCGAGGGATTTGCTCTTTTATCGG TGCCCAGCAGCTTTGTCCAAAATGAAATTGAACGTCATCTACGAACGCCA ATCACCGATGCACTCAGCCGTCGACTCGGACAACAGATACAGCTCGGAGT CCGTATCGCACCGCCCTCTACCGACCATATTGACGACAATTCCTCGTCAG CCGACGTCCTTCTAACCGACGATTGCGGCACAGATACAGACGAAAATTAC GGGGAGCCTCTTACAGGCGAGTACCAGGGTTTGCCAACCTACTTCACCGA ACGTCCGCACCATACCGAATCAACCGTCACGGGAGGTACCAGCCTTAATC GCCGTTACACCTTCGAAACGTTCGTTATTGGCGCGTCGAATCGGTTCGCG CATGCTGCCGCGCTAGCGATAGCCGAAGCACCGGCCCGAGCCTACAACCC CCTTTTCATTTGGGGCGAGTCAGGTCTTGGCAAAACCCACCTATTGCACG CCGCCGGGAACTACGCACAACGACTGTTTCCCGGCATGCGGGTCAAATAT GTCTCCACAGAAGAATTCACCAACGACTTCATCAACTCGCTCCGTGACGA CCGCAAAGTAGCGTTCAAACGCAGCTACCGCGACGTCGATGTGCTACTGG TCGATGACATCCAATTCATCGAAGGAAAAGAAGGTATACAAGAAGAGTTC TTCCATACCTTTAATACCTTACATAACGCCAACAAGCAAATCGTCATCTC TTCTGACCGCCCACCGAAACAACTCGCCACCCTCGAAGACCGACTAAGGA CCCGGTTCGAGTGGGGGCTTATTACCGACGTACAACCCCCTGAACTAGAA ACCCGCATCGCCATCTTGCGTAAGAAAGCCCAGATGGAACGCCTAGCGGT GCCTGGCGATGTCCTCGAACTCATCGCCAGCAGTATCGAACGTAACATCC GTGAACTCGAGGGAGCTCTCATCAGAGTCACCGCGTTTGCTTCGCTCAAC AAGACTGCAATCGACAAAGCATTAGCGGAAATCGTACTGCGTGACCTGAT CGCAGACGCCAGCACGATGCAAATCAGTGCGGCAACCATAATGACAGCCA CCGCCGAATACTTCGATACCACCATCGAAGAACTCCGTGGGCCAGGCAAA ACCCGAGCACTGGCCCAGTCACGCCAGATCGCGATGTATTTGTGTCGTGA ACTCACCGACCTCTCGCTACCCAAGATCGGCCAAGCATTCGGCCGTGACC ACACCACGGTTATGTACGCACAACGAAAAATCTTGTCCGAGATGGCTGAA CGTCGCGAAGTGTTCGACCACGTCAAGGAACTCACCACTCGCATCCGGCA ACGGTCTAAGCGC------------------------------------- -------------------- >C4 -------------------------------------------------- -------TTGGCCGATGACCTTGGTCTAGGTTTCACCACGGTTTGGAACG CAGTCGTCTCCGAACTCAACGGCGAATCCAACACAGACGACGAAGCCACC AACGACAGCACCCTAGTCACTCCGCTAACTCCTCAGCAAAGAGCATGGCT AAATCTGGTTCAACCACTCACCATCATCGAGGGATTTGCTCTTTTATCGG TGCCCAGCAGCTTTGTCCAAAATGAAATTGAACGTCATCTACGAACGCCA ATCACCGATGCACTCAGCCGTCGACTCGGACAACAGATACAGCTCGGAGT CCGTATCGCACCGCCCTCTACCGACCATATTGACGACAATTCCTCGTCAG CCGACGTCCTTCTAACCGACGATTGCGGCACAGATACAGACGAAAATTAC GGGGAGCCTCTTACAGGCGAGTACCAGGGTTTGCCAACCTACTTCACCGA ACGTCCGCACCATACCGAATCAACCGTCACGGGAGGTACCAGCCTTAATC GCCGTTACACCTTCGAAACGTTCGTTATTGGCGCGTCGAATCGGTTCGCG CATGCTGCCGCGCTAGCGATAGCCGAAGCACCGGCCCGAGCCTACAACCC CCTTTTCATTTGGGGCGAGTCAGGTCTTGGCAAAACCCACCTATTGCACG CCGCCGGGAACTACGCACAACGACTGTTTCCCGGCATGCGGGTCAAATAT GTCTCCACAGAAGAATTCACCAACGACTTCATCAACTCGCTCCGTGACGA CCGCAAAGTAGCGTTCAAACGCAGCTACCGCGACGTCGATGTGCTACTGG TCGATGACATCCAATTCATCGAAGGAAAAGAAGGTATACAAGAAGAGTTC TTCCATACCTTTAATACCTTACATAACGCCAACAAGCAAATCGTCATCTC TTCTGACCGCCCACCGAAACAACTCGCCACCCTCGAAGACCGACTAAGGA CCCGGTTCGAGTGGGGGCTTATTACCGACGTACAACCCCCTGAACTAGAA ACCCGCATCGCCATCTTGCGTAAGAAAGCCCAGATGGAACGCCTAGCGGT GCCTGGCGATGTCCTCGAACTCATCGCCAGCAGTATCGAACGTAACATCC GTGAACTCGAGGGAGCTCTCATCAGAGTCACCGCGTTTGCTTCGCTCAAC AAGACTGCAATCGACAAAGCATTAGCGGAAATCGTACTGCGTGACCTGAT CGCAGACGCCAGCACGATGCAAATCAGTGCGGCAACCATAATGACAGCCA CCGCCGAATACTTCGATACCACCATCGAAGAACTCCGTGGGCCAGGCAAA ACCCGAGCACTGGCCCAGTCACGCCAGATCGCGATGTATTTGTGTCGTGA ACTCACCGACCTCTCGCTACCCAAGATCGGCCAAGCATTCGGCCGTGACC ACACCACGGTTATGTACGCACAACGAAAAATCTTGTCCGAGATGGCTGAA CGTCGCGAAGTGTTCGACCACGTCAAGGAACTCACCACTCGCATCCGGCA ACGGTCTAAGCGC------------------------------------- -------------------- >C5 ATGTTTGTACCGCACGCCAAAAAGCCCGAAATTTACGAGAACCAGAGAGA TACGTCGTTGGCCGATGACCTTAGTCTAGGTTTCACCACGGTTTGGAACG CAGTCGTCTCCGAACTCAACGGCGAATCCAACACAGACGACGAAGCCACC AACGACAGCACCCTAGTCACTCCGCTAACTCCTCAGCAAAGAGCATGGCT AAATCTGGTTCAACCACTCACCATCATCGAGGGATTTGCTCTTTTATCGG TGCCCAGCAGCTTTGTCCAAAATGAAATTGAACGTCATCTACGAACGCCA ATCACCGATGCACTCAGCCGTCGACTCGGACAACAGATACAGCTCGGAGT CCGTATCGCACCGCCCTCTACCGACCATATTGACGACAATTCCTCGTCAG CCGACGTCCTTCTAACCGACGATTGCGGCACAGATACAGACGAAAATTAC GGGGAGCCTCTTACAGGCGAGTACCAGGGTTTGCCAACCTACTTCACCGA ACGTCCGCACCATACCGAATCAACCGTCACGGGAGGTACCAGCCTTAATC GCCGTTACACCTTCGAAACGTTCGTTATTGGCGCGTCGAATCGGTTCGCG CATGCTGCCGCGCTAGCGATAGCCGAAGCACCGGCCCGAGCCTACAACCC CCTTTTCATTTGGGGCGAGTCAGGTCTTGGCAAAACCCACCTATTGCACG CCGCCGGGAACTACGCACAACGACTGTTTCCCGGCATGCGGGTCAAATAT GTCTCCACAGAAGAATTCACCAACGACTTCATCAACTCGCTCCGTGACGA CCGCAAAGTAGCGTTCAAACGCAGCTACCGCGACGTCGATGTGCTACTGG TCGATGACATCCAATTCATCGAAGGAAAAGAAGGTATACAAGAAGAGTTC TTCCATACCTTTAATACCTTACATAACGCCAACAAGCAAATCGTCATCTC TTCTGACCGCCCACCGAAACAACTCGCCACCCTCGAAGACCGACTAAGGA CCCGGTTCGAGTGGGGGCTTATTACCGACGTACAACCCCCTGAACTAGAA ACCCGCATCGCCATCTTGCGTAAGAAAGCCCAGATGGAACGCCTAGCGGT GCCTGGCGATGTCCTCGAACTCATCGCCAGCAGTATCGAACGTAACATCC GTGAACTCGAGGGAGCTCTCATCAGAGTCACCGCGTTTGCTTCGCTCAAC AAGACTGCAATCGACAAAGCATTAGCGGAAATCGTACTGCGTGACCTGAT CGCAGACGCCAGCACGATGCAAATCAGTGCGGCAACCATAATGACAGCCA CCGCCGAATACTTCGATACCACCATCGAAGAACTCCGTGGGCCAGGCAAA ACCCGAGCACTGGCCCAGTCACGCCAGATCGCGATGTATTTGTGTCGTGA ACTCACCGACCTCTCGCTACCCAAGATCGGCCAAGCATTCGGCCGTGACC ACACCACGGTTATGTACGCACAACGAAAAATCTTGTCCGAGATGGCTGAA CGTCGCGAAGTGTTCGACCACGTCAAGGAACTCACCACTCGCATCCGGCA ACGGTCTAAGCGC------------------------------------- -------------------- >C6 -------------------------------------------------- -------TTGGCCGATGACCTTGGTCTAGGTTTCACCACGGTTTGGAACG CAGTCGTCTCCGAACTCAACGGCGAATCCAACACAGACGACGAAGCCACC AACGACAGCACCCTAGTCACTCCGCTAACTCCTCAGCAAAGAGCATGGCT AAATCTGGTTCAACCACTCACCATCATCGAGGGATTTGCTCTTTTATCGG TGCCCAGCAGCTTTGTCCAAAATGAAATTGAACGTCATCTACGAACGCCA ATCACCGATGCACTCAGCCGTCGACTCGGACAACAGATACAGCTCGGAGT CCGTATCGCACCGCCCTCTACCGACCATATTGACGACAATTCCTCGTCAG CCGACGTCCTTCTAACCGACGATTGCGGCACAGATACAGACGAAAATTAC GGGGAGCCTCTTACAGGCGAGTACCAGGGTTTGCCAACCTACTTCACCGA ACGTCCGCACCATACCGAATCAACCGTCACGGGAGGTACCAGCCTTAATC GCCGTTACACCTTCGAAACGTTCGTTATTGGCGCGTCGAATCGGTTCGCG CATGCTGCCGCGCTAGCGATAGCCGAAGCACCGGCCCGAGCCTACAACCC CCTTTTCATTTGGGGCGAGTCAGGTCTTGGCAAAACCCACCTATTGCACG CCGCCGGGAACTACGCACAACGACTGTTTCCCGGCATGCGGGTCAAATAT GTCTCCACAGAAGAATTCACCAACGACTTCATCAACTCGCTCCGTGACGA CCGCAAAGTAGCGTTCAAACGCAGCTACCGCGACGTCGATGTGCTACTGG TCGATGACATCCAATTCATCGAAGGAAAAGAAGGTATACAAGAAGAGTTC TTCCATACCTTTAATACCTTACATAACGCCAACAAGCAAATCGTCATCTC TTCTGACCGCCCACCGAAACAACTCGCCACCCTCGAAGACCGACTAAGGA CCCGGTTCGAGTGGGGGCTTATTACCGACGTACAACCCCCTGAACTAGAA ACCCGCATCGCCATCTTGCGTAAGAAAGCCCAGATGGAACGCCTAGCGGT GCCTGGCGATGTCCTCGAACTCATCGCCAGCAGTATCGAACGTAACATCC GTGAACTCGAGGGAGCTCTCATCAGAGTCACCGCGTTTGCTTCGCTCAAC AAGACTGCAATCGACAAAGCATTAGCGGAAATCGTACTGCGTGACCTGAT CGCAGACGCCAGCACGATGCAAATCAGTGCGGCAACCATAATGACAGCCA CCGCCGAATACTTCGATACCACCATCGAAGAACTCCGTGGGCCAGGCAAA ACCCGAGCACTGGCCCAGTCACGCCAGATCGCGATGTATTTGTGTCGTGA ACTCACCGACCTCTCGCTACCCAAGATCGGCCAAGCATTCGGCCGTGACC ACACCACGGTTATGTACGCACAACGAAAAATCTTGTCCGAGATGGCTGAA CGTCGCGAAGTGTTCGACCACGTCAAGGAACTCACCACTCGCATCCGGCA ACGGTCTAAGCGC------------------------------------- -------------------- >C1 oooooooooooooooooooLADDLGLGFTTVWNAVVSELNGESNTDDEAT NDSTLVTPLTPQQRAWLNLVQPLTIIEGFALLSVPSSFVQNEIERHLRTP ITDALSRRLGQQIQLGVRIAPPSTDHIDDNSSSADVLLTDDCGTDTDENY GEPLTGEYQGLPTYFTERPHHTESTVTGGTSLNRRYTFETFVIGASNRFA HAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKY VSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEF FHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELE TRIAILRKKAQMERLAVPGDVLELIASSIERNIRELEGALIRVTAFASLN KTAIDKALAEIVLRDLIADASTMQISAATIMTATAEYFDTTIEELRGPGK TRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAQRKILSEMAE RREVFDHVKELTTRIRQRSKR >C2 MFVPHAKKPEIYENQRDTSLADDLSLGFTTVWNAVVSELNGESNTDDEAT NDSTLVTPLTPQQRAWLNLVQPLTIIEGFALLSVPSSFVQNEIERHLRTP ITDALSRRLGQQIQLGVRIAPPSTDHIDDNSSSADVLLTDDCGTDTDENY GEPLTGEYQGLPTYFTERPHHTESTVTGGTSLNRRYTFETFVIGASNRFA HAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKY VSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEF FHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELE TRIAILRKKAQMERLAVPGDVLELIASSIERNIRELEGALIRVTAFASLN KTAIDKALAEIVLRDLIADASTMQISAATIMTATAEYFDTTIEELRGPGK TRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAQRKILSEMAE RREVFDHVKELTTRIRQRSKR >C3 oooooooooooooooooooLADDLGLGFTTVWNAVVSELNGESNTDDEAT NDSTLVTPLTPQQRAWLNLVQPLTIIEGFALLSVPSSFVQNEIERHLRTP ITDALSRRLGQQIQLGVRIAPPSTDHIDDNSSSADVLLTDDCGTDTDENY GEPLTGEYQGLPTYFTERPHHTESTVTGGTSLNRRYTFETFVIGASNRFA HAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKY VSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEF FHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELE TRIAILRKKAQMERLAVPGDVLELIASSIERNIRELEGALIRVTAFASLN KTAIDKALAEIVLRDLIADASTMQISAATIMTATAEYFDTTIEELRGPGK TRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAQRKILSEMAE RREVFDHVKELTTRIRQRSKR >C4 oooooooooooooooooooLADDLGLGFTTVWNAVVSELNGESNTDDEAT NDSTLVTPLTPQQRAWLNLVQPLTIIEGFALLSVPSSFVQNEIERHLRTP ITDALSRRLGQQIQLGVRIAPPSTDHIDDNSSSADVLLTDDCGTDTDENY GEPLTGEYQGLPTYFTERPHHTESTVTGGTSLNRRYTFETFVIGASNRFA HAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKY VSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEF FHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELE TRIAILRKKAQMERLAVPGDVLELIASSIERNIRELEGALIRVTAFASLN KTAIDKALAEIVLRDLIADASTMQISAATIMTATAEYFDTTIEELRGPGK TRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAQRKILSEMAE RREVFDHVKELTTRIRQRSKR >C5 MFVPHAKKPEIYENQRDTSLADDLSLGFTTVWNAVVSELNGESNTDDEAT NDSTLVTPLTPQQRAWLNLVQPLTIIEGFALLSVPSSFVQNEIERHLRTP ITDALSRRLGQQIQLGVRIAPPSTDHIDDNSSSADVLLTDDCGTDTDENY GEPLTGEYQGLPTYFTERPHHTESTVTGGTSLNRRYTFETFVIGASNRFA HAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKY VSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEF FHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELE TRIAILRKKAQMERLAVPGDVLELIASSIERNIRELEGALIRVTAFASLN KTAIDKALAEIVLRDLIADASTMQISAATIMTATAEYFDTTIEELRGPGK TRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAQRKILSEMAE RREVFDHVKELTTRIRQRSKR >C6 oooooooooooooooooooLADDLGLGFTTVWNAVVSELNGESNTDDEAT NDSTLVTPLTPQQRAWLNLVQPLTIIEGFALLSVPSSFVQNEIERHLRTP ITDALSRRLGQQIQLGVRIAPPSTDHIDDNSSSADVLLTDDCGTDTDENY GEPLTGEYQGLPTYFTERPHHTESTVTGGTSLNRRYTFETFVIGASNRFA HAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKY VSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEF FHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELE TRIAILRKKAQMERLAVPGDVLELIASSIERNIRELEGALIRVTAFASLN KTAIDKALAEIVLRDLIADASTMQISAATIMTATAEYFDTTIEELRGPGK TRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAQRKILSEMAE RREVFDHVKELTTRIRQRSKR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/1res/dnaA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1620 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579775184 Setting output file names to "/data/1res/dnaA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1415106740 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9495582056 Seed = 1682660066 Swapseed = 1579775184 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 10 unique site patterns Division 2 has 9 unique site patterns Division 3 has 9 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3471.467527 -- -24.965149 Chain 2 -- -3476.909680 -- -24.965149 Chain 3 -- -3481.466449 -- -24.965149 Chain 4 -- -3481.466449 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3476.910763 -- -24.965149 Chain 2 -- -3476.909680 -- -24.965149 Chain 3 -- -3471.487483 -- -24.965149 Chain 4 -- -3471.487495 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3471.468] (-3476.910) (-3481.466) (-3481.466) * [-3476.911] (-3476.910) (-3471.487) (-3471.487) 500 -- (-2167.501) (-2177.265) (-2167.903) [-2164.097] * (-2166.476) [-2156.417] (-2171.976) (-2155.944) -- 0:00:00 1000 -- (-2160.458) (-2166.533) [-2166.690] (-2163.363) * (-2159.744) (-2158.617) (-2168.873) [-2160.859] -- 0:00:00 1500 -- (-2162.205) (-2160.241) (-2160.616) [-2157.204] * (-2161.032) (-2159.558) [-2163.280] (-2168.089) -- 0:00:00 2000 -- (-2157.375) (-2155.819) (-2169.094) [-2157.727] * (-2164.941) [-2158.741] (-2164.033) (-2159.219) -- 0:08:19 2500 -- (-2162.851) [-2162.642] (-2169.972) (-2160.401) * (-2167.727) [-2158.372] (-2171.019) (-2157.552) -- 0:06:39 3000 -- (-2163.069) [-2169.060] (-2159.882) (-2165.953) * (-2154.311) (-2161.279) (-2160.792) [-2157.327] -- 0:05:32 3500 -- (-2161.292) [-2156.947] (-2160.490) (-2159.970) * (-2159.984) (-2154.784) [-2154.832] (-2168.005) -- 0:04:44 4000 -- [-2159.190] (-2162.356) (-2164.243) (-2157.795) * (-2162.315) (-2154.569) (-2165.594) [-2158.055] -- 0:04:09 4500 -- (-2158.586) [-2161.618] (-2167.128) (-2160.106) * (-2161.625) (-2155.314) (-2163.657) [-2160.671] -- 0:03:41 5000 -- (-2164.847) (-2160.823) [-2162.207] (-2161.926) * [-2162.297] (-2156.481) (-2167.402) (-2171.008) -- 0:03:19 Average standard deviation of split frequencies: 0.065473 5500 -- (-2165.783) (-2155.702) (-2161.003) [-2162.453] * [-2159.516] (-2155.020) (-2165.489) (-2158.463) -- 0:03:00 6000 -- [-2167.306] (-2156.432) (-2164.939) (-2171.522) * (-2160.216) [-2157.834] (-2165.058) (-2162.969) -- 0:02:45 6500 -- [-2157.050] (-2164.480) (-2167.821) (-2181.567) * (-2159.616) (-2159.575) (-2156.517) [-2158.681] -- 0:02:32 7000 -- (-2161.096) [-2164.773] (-2161.652) (-2155.086) * (-2160.857) [-2157.824] (-2161.470) (-2156.969) -- 0:02:21 7500 -- (-2156.484) (-2157.128) [-2158.566] (-2154.899) * (-2161.114) [-2160.492] (-2158.274) (-2158.790) -- 0:02:12 8000 -- (-2166.848) [-2165.095] (-2174.177) (-2156.630) * (-2167.391) [-2159.929] (-2156.695) (-2157.817) -- 0:02:04 8500 -- (-2158.374) [-2157.044] (-2160.694) (-2156.318) * (-2172.588) (-2162.246) (-2162.730) [-2159.203] -- 0:01:56 9000 -- (-2159.889) [-2159.073] (-2156.847) (-2158.463) * (-2163.039) (-2161.050) [-2162.689] (-2158.863) -- 0:01:50 9500 -- (-2159.916) (-2164.339) [-2162.896] (-2159.207) * (-2163.900) (-2162.266) [-2155.460] (-2159.297) -- 0:01:44 10000 -- (-2168.571) (-2156.509) [-2162.647] (-2158.434) * [-2159.908] (-2166.291) (-2168.318) (-2156.643) -- 0:01:39 Average standard deviation of split frequencies: 0.101647 10500 -- (-2161.347) (-2163.731) [-2159.971] (-2157.112) * (-2161.965) [-2157.039] (-2159.559) (-2156.553) -- 0:01:34 11000 -- (-2155.684) (-2155.554) [-2161.472] (-2157.739) * (-2161.187) (-2162.211) (-2166.543) [-2154.399] -- 0:01:29 11500 -- [-2155.672] (-2167.465) (-2160.675) (-2158.569) * (-2156.038) [-2158.649] (-2161.323) (-2163.283) -- 0:01:25 12000 -- (-2168.541) [-2159.620] (-2162.905) (-2157.633) * (-2163.636) [-2160.996] (-2166.405) (-2159.068) -- 0:01:22 12500 -- [-2159.959] (-2155.496) (-2159.413) (-2158.260) * [-2161.650] (-2173.136) (-2165.331) (-2157.271) -- 0:02:38 13000 -- (-2161.309) [-2157.812] (-2163.929) (-2156.927) * (-2157.997) (-2161.132) [-2154.711] (-2156.206) -- 0:02:31 13500 -- (-2171.355) [-2156.618] (-2164.224) (-2157.597) * (-2162.471) (-2160.598) [-2157.354] (-2159.847) -- 0:02:26 14000 -- (-2163.347) [-2160.469] (-2162.427) (-2157.687) * (-2167.610) [-2159.789] (-2158.629) (-2154.115) -- 0:02:20 14500 -- (-2158.608) [-2157.523] (-2160.948) (-2157.386) * (-2161.115) [-2158.876] (-2154.245) (-2156.424) -- 0:02:15 15000 -- [-2160.636] (-2154.226) (-2160.988) (-2157.423) * (-2162.166) (-2168.994) (-2160.277) [-2155.338] -- 0:02:11 Average standard deviation of split frequencies: 0.069639 15500 -- [-2161.092] (-2157.718) (-2167.607) (-2157.879) * [-2157.694] (-2159.067) (-2156.115) (-2157.881) -- 0:02:07 16000 -- [-2163.537] (-2169.838) (-2162.716) (-2158.995) * (-2161.856) [-2159.472] (-2159.267) (-2158.191) -- 0:02:03 16500 -- [-2171.708] (-2168.108) (-2164.070) (-2158.300) * (-2160.291) [-2159.695] (-2165.878) (-2155.736) -- 0:01:59 17000 -- (-2161.567) (-2169.483) (-2164.202) [-2160.852] * (-2165.707) (-2158.790) (-2157.524) [-2154.349] -- 0:01:55 17500 -- (-2160.534) [-2162.928] (-2160.511) (-2167.450) * (-2156.546) [-2162.085] (-2159.258) (-2158.228) -- 0:01:52 18000 -- [-2160.356] (-2161.962) (-2158.748) (-2166.193) * (-2164.613) (-2160.423) [-2159.627] (-2158.006) -- 0:01:49 18500 -- (-2161.008) (-2157.888) [-2162.650] (-2158.189) * (-2154.421) [-2156.489] (-2168.374) (-2157.698) -- 0:01:46 19000 -- (-2158.717) [-2153.815] (-2157.281) (-2158.123) * [-2153.919] (-2169.402) (-2167.824) (-2161.673) -- 0:01:43 19500 -- (-2156.552) [-2156.826] (-2155.625) (-2157.805) * (-2157.998) [-2160.104] (-2158.008) (-2161.693) -- 0:01:40 20000 -- (-2161.434) [-2159.616] (-2160.193) (-2157.792) * [-2165.398] (-2159.063) (-2168.232) (-2159.168) -- 0:01:38 Average standard deviation of split frequencies: 0.078798 20500 -- [-2163.707] (-2160.593) (-2158.729) (-2157.726) * (-2163.400) (-2160.507) [-2161.080] (-2157.320) -- 0:01:35 21000 -- [-2165.606] (-2159.479) (-2158.637) (-2160.223) * (-2161.591) [-2158.353] (-2157.607) (-2157.757) -- 0:01:33 21500 -- [-2159.107] (-2160.640) (-2159.352) (-2158.920) * (-2164.409) [-2162.178] (-2157.750) (-2158.784) -- 0:01:31 22000 -- (-2165.740) [-2156.764] (-2161.154) (-2157.618) * [-2155.145] (-2157.608) (-2159.663) (-2157.732) -- 0:01:28 22500 -- (-2157.973) (-2164.578) (-2159.860) [-2153.850] * [-2157.984] (-2162.716) (-2157.524) (-2160.991) -- 0:01:26 23000 -- [-2163.888] (-2161.900) (-2159.993) (-2157.222) * (-2161.967) (-2159.253) (-2158.017) [-2159.246] -- 0:01:24 23500 -- (-2157.095) [-2156.954] (-2160.615) (-2159.336) * (-2160.289) [-2160.481] (-2158.113) (-2157.674) -- 0:02:04 24000 -- (-2157.398) [-2159.988] (-2159.438) (-2156.755) * [-2160.311] (-2168.066) (-2164.498) (-2157.414) -- 0:02:02 24500 -- [-2155.926] (-2161.753) (-2159.228) (-2156.060) * [-2155.423] (-2160.015) (-2159.435) (-2157.107) -- 0:01:59 25000 -- [-2158.655] (-2161.631) (-2156.483) (-2158.384) * (-2156.485) [-2162.383] (-2156.580) (-2155.826) -- 0:01:57 Average standard deviation of split frequencies: 0.069227 25500 -- (-2156.710) [-2163.349] (-2157.168) (-2159.233) * [-2157.433] (-2160.156) (-2156.762) (-2156.552) -- 0:01:54 26000 -- (-2168.844) [-2161.126] (-2160.783) (-2158.909) * (-2154.087) (-2157.070) (-2161.041) [-2157.077] -- 0:01:52 26500 -- [-2172.542] (-2164.642) (-2157.595) (-2159.904) * (-2157.371) (-2161.180) (-2159.412) [-2156.766] -- 0:01:50 27000 -- [-2162.233] (-2163.124) (-2153.966) (-2157.028) * (-2159.024) [-2155.721] (-2159.422) (-2156.915) -- 0:01:48 27500 -- [-2154.216] (-2169.105) (-2155.876) (-2158.417) * (-2157.437) [-2158.097] (-2160.183) (-2155.486) -- 0:01:46 28000 -- (-2166.129) (-2162.898) (-2154.532) [-2158.235] * (-2166.993) (-2157.128) (-2157.230) [-2157.127] -- 0:01:44 28500 -- [-2160.837] (-2158.596) (-2156.407) (-2160.607) * [-2159.161] (-2167.523) (-2157.025) (-2158.192) -- 0:01:42 29000 -- [-2157.892] (-2160.173) (-2158.400) (-2157.490) * (-2155.141) [-2163.705] (-2156.791) (-2156.857) -- 0:01:40 29500 -- [-2158.037] (-2161.748) (-2155.987) (-2159.933) * [-2159.283] (-2160.404) (-2156.369) (-2160.395) -- 0:01:38 30000 -- [-2161.934] (-2156.234) (-2158.171) (-2159.953) * [-2155.968] (-2159.616) (-2158.984) (-2157.301) -- 0:01:37 Average standard deviation of split frequencies: 0.057295 30500 -- (-2158.379) (-2156.812) (-2161.228) [-2158.281] * (-2166.057) [-2158.348] (-2160.392) (-2159.148) -- 0:01:35 31000 -- (-2156.408) (-2156.895) (-2156.493) [-2157.085] * [-2158.256] (-2161.188) (-2157.164) (-2157.602) -- 0:01:33 31500 -- (-2169.466) (-2157.449) (-2156.960) [-2157.253] * (-2161.392) (-2166.556) [-2158.344] (-2154.613) -- 0:01:32 32000 -- (-2157.404) (-2156.667) (-2159.109) [-2156.551] * [-2161.837] (-2162.624) (-2157.707) (-2156.361) -- 0:01:30 32500 -- (-2160.988) [-2156.779] (-2161.877) (-2158.743) * [-2164.315] (-2159.041) (-2157.208) (-2154.226) -- 0:01:29 33000 -- [-2161.411] (-2157.043) (-2160.607) (-2156.968) * (-2170.370) (-2160.294) (-2155.940) [-2156.328] -- 0:01:27 33500 -- (-2157.231) (-2156.905) (-2159.991) [-2157.872] * (-2162.292) (-2165.858) [-2158.481] (-2158.416) -- 0:01:26 34000 -- (-2153.425) (-2156.757) [-2156.888] (-2160.341) * (-2183.152) (-2157.602) (-2157.000) [-2157.451] -- 0:01:53 34500 -- (-2157.497) (-2159.223) (-2158.700) [-2158.711] * (-2165.222) (-2162.964) [-2156.307] (-2156.432) -- 0:01:51 35000 -- (-2161.481) [-2159.998] (-2156.311) (-2157.622) * (-2158.622) (-2166.124) (-2157.141) [-2158.429] -- 0:01:50 Average standard deviation of split frequencies: 0.051188 35500 -- (-2162.107) (-2158.127) (-2157.351) [-2158.689] * (-2154.560) [-2159.730] (-2154.419) (-2155.922) -- 0:01:48 36000 -- (-2158.952) (-2156.796) (-2157.070) [-2158.198] * (-2159.715) [-2154.240] (-2157.784) (-2156.192) -- 0:01:47 36500 -- [-2152.761] (-2156.663) (-2156.643) (-2163.785) * [-2161.085] (-2166.937) (-2157.655) (-2156.489) -- 0:01:45 37000 -- [-2159.124] (-2156.197) (-2156.923) (-2157.946) * (-2158.378) (-2159.055) [-2156.899] (-2152.939) -- 0:01:44 37500 -- (-2159.442) (-2157.403) [-2159.228] (-2156.990) * (-2160.766) (-2160.033) (-2160.732) [-2155.476] -- 0:01:42 38000 -- (-2158.673) (-2157.470) (-2158.090) [-2154.601] * (-2158.662) [-2161.148] (-2160.763) (-2158.400) -- 0:01:41 38500 -- (-2161.232) (-2157.331) [-2160.371] (-2156.717) * (-2158.937) [-2163.934] (-2157.688) (-2158.327) -- 0:01:39 39000 -- [-2155.257] (-2157.503) (-2157.492) (-2162.208) * (-2158.009) [-2154.871] (-2157.077) (-2157.737) -- 0:01:38 39500 -- [-2157.410] (-2160.133) (-2156.928) (-2159.185) * [-2157.516] (-2161.606) (-2157.888) (-2158.119) -- 0:01:37 40000 -- (-2155.323) [-2157.714] (-2158.995) (-2158.542) * (-2153.071) (-2157.701) (-2158.124) [-2158.429] -- 0:01:36 Average standard deviation of split frequencies: 0.033722 40500 -- (-2164.112) (-2161.706) [-2159.794] (-2156.972) * (-2154.005) (-2155.631) (-2157.162) [-2157.987] -- 0:01:34 41000 -- (-2155.667) (-2160.990) (-2158.886) [-2156.850] * (-2156.808) (-2162.646) [-2155.197] (-2158.952) -- 0:01:33 41500 -- (-2163.362) [-2157.910] (-2159.091) (-2159.287) * (-2155.523) (-2162.045) (-2156.178) [-2156.202] -- 0:01:32 42000 -- [-2159.877] (-2158.590) (-2160.748) (-2159.006) * (-2159.311) [-2152.917] (-2156.407) (-2154.872) -- 0:01:31 42500 -- (-2161.918) (-2157.513) (-2158.939) [-2159.744] * (-2159.873) [-2157.590] (-2158.191) (-2162.276) -- 0:01:30 43000 -- [-2159.387] (-2156.176) (-2157.386) (-2159.094) * (-2159.770) [-2164.929] (-2156.245) (-2162.958) -- 0:01:29 43500 -- (-2157.488) [-2157.533] (-2158.072) (-2159.685) * (-2158.083) [-2161.988] (-2156.456) (-2156.742) -- 0:01:27 44000 -- [-2157.071] (-2156.772) (-2157.703) (-2158.417) * (-2162.434) [-2156.109] (-2156.777) (-2156.449) -- 0:01:26 44500 -- (-2164.362) [-2155.956] (-2162.114) (-2159.205) * (-2158.048) [-2156.557] (-2157.262) (-2157.689) -- 0:01:25 45000 -- (-2155.590) [-2156.601] (-2154.385) (-2158.611) * (-2156.717) (-2167.746) (-2157.452) [-2159.258] -- 0:01:46 Average standard deviation of split frequencies: 0.027949 45500 -- [-2154.701] (-2154.966) (-2156.495) (-2157.669) * (-2157.945) [-2158.622] (-2156.746) (-2159.858) -- 0:01:44 46000 -- [-2160.680] (-2156.867) (-2156.429) (-2158.675) * (-2157.633) (-2158.343) (-2157.097) [-2158.712] -- 0:01:43 46500 -- (-2164.352) (-2156.244) [-2154.711] (-2159.066) * (-2157.630) [-2158.972] (-2157.998) (-2154.373) -- 0:01:42 47000 -- (-2161.418) [-2154.655] (-2158.601) (-2158.877) * (-2157.513) [-2161.099] (-2157.551) (-2155.754) -- 0:01:41 47500 -- [-2162.146] (-2154.533) (-2158.519) (-2158.181) * (-2157.855) [-2156.633] (-2158.074) (-2160.370) -- 0:01:40 48000 -- (-2182.302) (-2156.811) [-2158.455] (-2156.971) * (-2157.394) [-2160.148] (-2157.283) (-2155.901) -- 0:01:39 48500 -- (-2159.341) (-2155.272) [-2158.347] (-2156.016) * (-2157.212) (-2167.260) (-2157.042) [-2155.916] -- 0:01:38 49000 -- (-2154.786) (-2159.620) [-2158.498] (-2158.843) * (-2157.205) [-2162.484] (-2157.603) (-2155.887) -- 0:01:37 49500 -- [-2156.638] (-2158.714) (-2159.710) (-2158.013) * (-2156.897) (-2165.370) [-2156.832] (-2159.604) -- 0:01:36 50000 -- (-2158.320) (-2158.096) (-2157.986) [-2156.915] * (-2155.511) (-2165.263) [-2159.115] (-2156.923) -- 0:01:35 Average standard deviation of split frequencies: 0.022837 50500 -- (-2157.458) [-2155.961] (-2159.053) (-2157.662) * (-2157.371) [-2160.600] (-2157.345) (-2158.000) -- 0:01:34 51000 -- (-2163.715) [-2159.533] (-2158.162) (-2154.293) * (-2154.808) (-2157.404) (-2159.551) [-2157.629] -- 0:01:33 51500 -- (-2162.052) [-2157.564] (-2159.386) (-2156.297) * (-2157.214) (-2160.797) [-2162.278] (-2161.205) -- 0:01:32 52000 -- (-2156.970) (-2157.145) [-2157.227] (-2158.658) * (-2157.221) (-2158.270) [-2158.565] (-2164.431) -- 0:01:31 52500 -- [-2155.843] (-2156.981) (-2156.596) (-2157.357) * (-2156.826) [-2159.276] (-2157.735) (-2157.672) -- 0:01:30 53000 -- (-2160.372) (-2157.163) (-2156.417) [-2157.656] * [-2157.461] (-2157.904) (-2156.482) (-2159.508) -- 0:01:29 53500 -- [-2158.172] (-2155.946) (-2163.815) (-2158.534) * (-2157.467) (-2156.363) (-2158.417) [-2157.119] -- 0:01:28 54000 -- (-2159.593) [-2156.373] (-2159.319) (-2158.506) * [-2159.638] (-2155.498) (-2160.479) (-2156.050) -- 0:01:27 54500 -- (-2158.072) (-2156.454) (-2157.324) [-2158.554] * (-2158.848) [-2155.144] (-2160.523) (-2164.800) -- 0:01:26 55000 -- (-2157.525) (-2157.162) (-2159.944) [-2158.615] * (-2162.076) [-2156.366] (-2164.107) (-2158.811) -- 0:01:25 Average standard deviation of split frequencies: 0.026019 55500 -- [-2156.724] (-2156.867) (-2158.259) (-2159.704) * (-2161.819) [-2155.784] (-2155.637) (-2160.851) -- 0:01:25 56000 -- [-2156.190] (-2158.465) (-2157.558) (-2157.946) * (-2157.841) (-2154.921) (-2159.367) [-2160.393] -- 0:01:41 56500 -- (-2156.094) (-2158.595) [-2156.501] (-2159.224) * (-2157.206) (-2154.679) (-2156.853) [-2163.633] -- 0:01:40 57000 -- (-2156.735) [-2155.349] (-2156.112) (-2158.827) * (-2157.081) (-2159.545) (-2158.250) [-2160.287] -- 0:01:39 57500 -- (-2156.465) [-2156.519] (-2159.688) (-2156.460) * (-2159.658) (-2156.246) (-2159.564) [-2157.561] -- 0:01:38 58000 -- [-2158.287] (-2156.291) (-2162.459) (-2161.440) * (-2155.120) [-2155.086] (-2160.510) (-2160.994) -- 0:01:37 58500 -- (-2156.263) (-2157.051) (-2155.992) [-2159.142] * (-2156.551) (-2155.487) [-2157.653] (-2160.682) -- 0:01:36 59000 -- (-2158.872) (-2157.820) [-2157.926] (-2157.333) * (-2157.006) (-2155.708) [-2159.338] (-2157.142) -- 0:01:35 59500 -- (-2155.290) (-2157.170) [-2160.206] (-2158.194) * (-2155.832) (-2157.681) [-2157.385] (-2155.892) -- 0:01:34 60000 -- (-2156.364) (-2156.403) (-2157.670) [-2157.853] * (-2156.061) [-2154.620] (-2156.848) (-2157.832) -- 0:01:34 Average standard deviation of split frequencies: 0.026549 60500 -- (-2158.176) (-2159.102) (-2154.486) [-2156.896] * [-2158.359] (-2157.040) (-2156.849) (-2158.140) -- 0:01:33 61000 -- [-2156.464] (-2159.869) (-2155.752) (-2156.913) * (-2156.906) (-2159.088) (-2156.849) [-2155.186] -- 0:01:32 61500 -- [-2155.175] (-2161.189) (-2156.166) (-2158.421) * (-2158.592) (-2155.302) [-2157.591] (-2153.979) -- 0:01:31 62000 -- (-2159.323) (-2158.714) [-2155.383] (-2157.008) * (-2159.091) (-2158.605) (-2159.510) [-2157.900] -- 0:01:30 62500 -- [-2157.129] (-2160.623) (-2156.582) (-2156.239) * [-2155.483] (-2158.044) (-2156.613) (-2156.212) -- 0:01:30 63000 -- (-2161.040) (-2158.846) [-2158.211] (-2158.159) * (-2156.871) (-2155.285) [-2156.432] (-2154.560) -- 0:01:29 63500 -- (-2157.523) (-2159.797) [-2159.385] (-2158.099) * [-2157.825] (-2158.038) (-2157.645) (-2155.217) -- 0:01:28 64000 -- [-2154.813] (-2158.170) (-2156.049) (-2158.013) * (-2156.896) (-2156.514) (-2157.840) [-2162.038] -- 0:01:27 64500 -- [-2156.319] (-2160.419) (-2160.119) (-2154.420) * (-2155.580) (-2153.797) [-2154.331] (-2155.090) -- 0:01:27 65000 -- [-2154.542] (-2164.565) (-2160.931) (-2159.064) * (-2155.856) (-2156.996) (-2154.953) [-2156.207] -- 0:01:26 Average standard deviation of split frequencies: 0.034064 65500 -- (-2155.028) [-2157.808] (-2156.723) (-2157.337) * (-2154.243) [-2155.599] (-2157.067) (-2156.076) -- 0:01:25 66000 -- (-2159.847) (-2156.287) (-2156.244) [-2155.295] * (-2156.209) [-2157.191] (-2157.575) (-2163.636) -- 0:01:24 66500 -- (-2153.868) (-2158.052) [-2156.970] (-2160.488) * (-2153.224) (-2158.341) [-2156.899] (-2157.728) -- 0:01:24 67000 -- (-2159.854) (-2157.191) (-2156.254) [-2156.495] * [-2155.771] (-2157.805) (-2158.998) (-2157.978) -- 0:01:37 67500 -- (-2157.970) [-2157.146] (-2157.664) (-2157.805) * [-2155.259] (-2156.324) (-2159.366) (-2154.225) -- 0:01:36 68000 -- (-2156.158) [-2159.273] (-2158.997) (-2157.005) * (-2158.761) [-2156.556] (-2157.493) (-2157.781) -- 0:01:35 68500 -- [-2153.609] (-2157.513) (-2159.130) (-2155.364) * (-2158.009) (-2156.945) (-2158.863) [-2157.292] -- 0:01:35 69000 -- [-2154.987] (-2156.733) (-2158.147) (-2156.524) * (-2155.769) [-2155.920] (-2157.749) (-2157.650) -- 0:01:34 69500 -- (-2156.758) (-2161.769) [-2157.939] (-2156.061) * (-2155.905) (-2156.402) [-2158.181] (-2155.716) -- 0:01:33 70000 -- (-2155.009) [-2162.399] (-2159.202) (-2156.899) * (-2159.812) (-2156.445) [-2157.106] (-2157.641) -- 0:01:33 Average standard deviation of split frequencies: 0.032878 70500 -- [-2157.531] (-2159.871) (-2157.476) (-2161.132) * (-2161.296) [-2154.497] (-2157.772) (-2157.443) -- 0:01:32 71000 -- [-2159.151] (-2158.591) (-2160.905) (-2158.332) * (-2160.273) (-2156.146) [-2157.937] (-2155.729) -- 0:01:31 71500 -- (-2160.684) [-2155.670] (-2159.498) (-2156.106) * (-2158.269) (-2156.724) (-2158.026) [-2157.311] -- 0:01:30 72000 -- [-2155.431] (-2156.435) (-2157.624) (-2158.377) * (-2157.775) (-2155.075) (-2158.456) [-2155.946] -- 0:01:30 72500 -- (-2154.586) (-2155.954) (-2157.794) [-2164.103] * (-2159.888) (-2154.679) (-2159.507) [-2158.300] -- 0:01:29 73000 -- (-2159.366) (-2156.825) (-2157.669) [-2156.840] * (-2157.012) [-2159.668] (-2157.220) (-2155.284) -- 0:01:28 73500 -- [-2155.950] (-2159.336) (-2165.729) (-2157.817) * [-2157.344] (-2161.956) (-2158.286) (-2158.833) -- 0:01:28 74000 -- [-2153.618] (-2162.519) (-2159.803) (-2157.419) * (-2156.638) (-2161.666) [-2157.623] (-2158.637) -- 0:01:27 74500 -- [-2153.881] (-2157.178) (-2157.691) (-2156.469) * (-2156.459) [-2156.504] (-2158.665) (-2159.070) -- 0:01:26 75000 -- [-2153.376] (-2157.024) (-2158.270) (-2156.250) * (-2158.835) (-2157.894) (-2157.592) [-2155.925] -- 0:01:26 Average standard deviation of split frequencies: 0.033908 75500 -- (-2157.789) (-2158.494) (-2156.921) [-2157.150] * (-2156.825) (-2160.819) (-2158.285) [-2156.850] -- 0:01:25 76000 -- (-2155.680) (-2158.702) [-2159.253] (-2158.790) * (-2154.296) (-2157.726) [-2158.828] (-2158.804) -- 0:01:25 76500 -- [-2155.573] (-2157.376) (-2159.258) (-2156.962) * (-2157.722) (-2158.746) (-2159.312) [-2157.683] -- 0:01:24 77000 -- (-2157.540) (-2158.477) (-2158.474) [-2157.651] * (-2159.342) [-2156.679] (-2159.054) (-2157.437) -- 0:01:23 77500 -- [-2155.881] (-2160.596) (-2158.211) (-2156.362) * (-2161.042) (-2158.383) [-2158.587] (-2160.325) -- 0:01:23 78000 -- (-2157.713) (-2159.952) [-2156.993] (-2158.543) * [-2159.184] (-2156.892) (-2156.630) (-2160.061) -- 0:01:34 78500 -- (-2159.029) (-2157.436) (-2157.033) [-2157.092] * (-2157.095) (-2157.882) (-2156.840) [-2157.744] -- 0:01:33 79000 -- (-2157.205) (-2159.112) [-2154.652] (-2157.037) * (-2160.116) [-2156.976] (-2158.074) (-2163.359) -- 0:01:33 79500 -- [-2154.233] (-2158.925) (-2162.028) (-2157.130) * (-2157.540) (-2157.728) (-2156.803) [-2156.593] -- 0:01:32 80000 -- [-2155.469] (-2157.150) (-2157.746) (-2156.684) * (-2156.072) [-2157.014] (-2157.600) (-2156.491) -- 0:01:32 Average standard deviation of split frequencies: 0.035453 80500 -- (-2157.387) (-2158.403) (-2157.606) [-2154.698] * (-2159.624) [-2158.622] (-2158.376) (-2156.778) -- 0:01:31 81000 -- (-2154.395) (-2156.864) [-2157.955] (-2156.551) * (-2156.509) (-2157.293) (-2153.385) [-2155.300] -- 0:01:30 81500 -- [-2153.142] (-2157.389) (-2156.859) (-2158.469) * (-2159.985) (-2158.341) [-2155.698] (-2156.289) -- 0:01:30 82000 -- [-2155.171] (-2156.875) (-2157.565) (-2158.981) * (-2158.531) [-2158.470] (-2156.964) (-2156.791) -- 0:01:29 82500 -- (-2159.289) (-2162.601) [-2159.950] (-2157.281) * (-2158.285) [-2158.294] (-2157.706) (-2154.473) -- 0:01:28 83000 -- (-2157.401) [-2156.524] (-2156.244) (-2155.794) * (-2158.204) [-2157.564] (-2157.174) (-2156.707) -- 0:01:28 83500 -- [-2157.936] (-2158.275) (-2157.683) (-2155.258) * [-2155.711] (-2157.407) (-2157.297) (-2155.512) -- 0:01:27 84000 -- (-2157.350) (-2162.478) (-2157.093) [-2152.859] * [-2156.648] (-2158.299) (-2163.591) (-2159.221) -- 0:01:27 84500 -- [-2155.975] (-2162.735) (-2159.045) (-2155.654) * (-2154.308) (-2159.859) (-2157.724) [-2156.447] -- 0:01:26 85000 -- [-2153.787] (-2161.571) (-2156.756) (-2156.570) * (-2154.954) (-2157.742) (-2157.642) [-2161.017] -- 0:01:26 Average standard deviation of split frequencies: 0.029120 85500 -- (-2159.106) (-2159.951) [-2156.456] (-2153.034) * (-2158.068) [-2157.583] (-2157.372) (-2157.277) -- 0:01:25 86000 -- (-2157.060) (-2160.266) [-2158.565] (-2157.995) * [-2155.564] (-2158.689) (-2156.348) (-2160.333) -- 0:01:25 86500 -- (-2157.391) (-2158.222) [-2159.447] (-2156.916) * (-2158.067) [-2157.772] (-2158.781) (-2159.901) -- 0:01:24 87000 -- (-2158.533) (-2156.966) (-2156.541) [-2155.526] * (-2157.804) [-2158.487] (-2159.467) (-2162.666) -- 0:01:23 87500 -- (-2159.162) (-2157.682) (-2159.229) [-2157.111] * [-2154.559] (-2156.888) (-2158.382) (-2160.859) -- 0:01:23 88000 -- [-2157.257] (-2157.378) (-2153.898) (-2159.845) * (-2156.590) [-2158.099] (-2158.318) (-2157.968) -- 0:01:22 88500 -- (-2159.868) (-2158.950) (-2156.206) [-2159.916] * (-2156.145) (-2157.738) (-2157.046) [-2156.969] -- 0:01:22 89000 -- (-2156.828) (-2159.646) [-2156.004] (-2157.810) * (-2156.500) [-2158.436] (-2156.050) (-2156.715) -- 0:01:32 89500 -- [-2156.406] (-2158.137) (-2156.614) (-2154.770) * (-2157.282) [-2158.217] (-2158.556) (-2157.928) -- 0:01:31 90000 -- (-2156.976) (-2158.474) (-2157.175) [-2157.206] * (-2156.272) (-2159.722) [-2158.667] (-2157.734) -- 0:01:31 Average standard deviation of split frequencies: 0.029571 90500 -- [-2156.608] (-2163.704) (-2158.828) (-2155.067) * (-2156.348) [-2159.800] (-2164.257) (-2158.171) -- 0:01:30 91000 -- (-2157.597) (-2166.218) (-2158.586) [-2158.829] * (-2156.620) [-2157.372] (-2160.228) (-2161.705) -- 0:01:29 91500 -- [-2157.679] (-2158.047) (-2158.082) (-2161.570) * (-2155.841) (-2162.009) [-2161.224] (-2161.978) -- 0:01:29 92000 -- (-2156.992) (-2157.610) (-2156.234) [-2159.081] * [-2156.095] (-2154.713) (-2159.112) (-2160.210) -- 0:01:28 92500 -- (-2154.986) (-2158.139) (-2157.374) [-2159.214] * (-2158.358) (-2154.955) [-2159.100] (-2160.191) -- 0:01:28 93000 -- (-2161.207) (-2156.472) (-2159.052) [-2156.987] * (-2156.836) (-2154.253) [-2159.078] (-2158.745) -- 0:01:27 93500 -- (-2157.006) (-2156.472) [-2158.855] (-2157.678) * (-2160.534) (-2159.271) [-2158.268] (-2157.283) -- 0:01:27 94000 -- [-2156.884] (-2156.606) (-2160.004) (-2157.229) * (-2162.831) (-2156.560) (-2159.066) [-2158.360] -- 0:01:26 94500 -- (-2157.222) [-2157.056] (-2157.361) (-2158.504) * (-2158.524) [-2156.667] (-2157.708) (-2159.279) -- 0:01:26 95000 -- (-2156.811) (-2157.047) [-2156.221] (-2157.327) * (-2160.805) [-2156.730] (-2158.863) (-2160.030) -- 0:01:25 Average standard deviation of split frequencies: 0.027621 95500 -- [-2158.361] (-2156.463) (-2162.483) (-2156.462) * (-2157.766) [-2155.021] (-2156.879) (-2157.282) -- 0:01:25 96000 -- (-2156.758) [-2159.769] (-2159.425) (-2159.393) * [-2162.734] (-2154.685) (-2159.648) (-2159.816) -- 0:01:24 96500 -- (-2156.707) (-2158.392) (-2159.525) [-2159.149] * [-2160.897] (-2161.981) (-2158.192) (-2159.644) -- 0:01:24 97000 -- [-2156.472] (-2158.269) (-2156.533) (-2160.287) * (-2152.238) [-2157.732] (-2156.964) (-2157.002) -- 0:01:23 97500 -- (-2155.600) (-2156.948) (-2161.814) [-2154.706] * (-2161.097) (-2156.953) [-2155.986] (-2156.555) -- 0:01:23 98000 -- (-2156.375) [-2156.587] (-2156.360) (-2160.181) * (-2160.132) (-2154.461) (-2159.192) [-2155.877] -- 0:01:22 98500 -- [-2156.492] (-2157.097) (-2156.415) (-2155.260) * (-2156.520) (-2156.468) [-2154.106] (-2154.710) -- 0:01:22 99000 -- [-2155.795] (-2157.092) (-2163.715) (-2160.469) * (-2156.489) (-2157.361) [-2156.055] (-2162.316) -- 0:01:21 99500 -- (-2159.282) [-2157.846] (-2162.356) (-2158.929) * (-2157.612) (-2156.200) (-2155.997) [-2157.710] -- 0:01:21 100000 -- [-2157.802] (-2156.838) (-2159.222) (-2159.175) * (-2159.950) (-2156.924) [-2156.676] (-2155.883) -- 0:01:30 Average standard deviation of split frequencies: 0.028409 100500 -- (-2156.862) (-2168.545) (-2155.874) [-2156.378] * (-2160.515) [-2157.253] (-2159.437) (-2154.397) -- 0:01:29 101000 -- (-2159.690) (-2158.171) (-2156.389) [-2156.956] * [-2158.649] (-2156.867) (-2160.902) (-2159.249) -- 0:01:29 101500 -- [-2159.670] (-2155.355) (-2154.536) (-2155.548) * [-2158.914] (-2155.759) (-2157.779) (-2155.493) -- 0:01:28 102000 -- [-2157.375] (-2157.800) (-2155.906) (-2157.477) * [-2157.687] (-2154.794) (-2159.603) (-2155.727) -- 0:01:28 102500 -- [-2156.875] (-2156.570) (-2156.030) (-2160.469) * (-2160.762) [-2154.861] (-2158.218) (-2158.135) -- 0:01:27 103000 -- (-2156.926) (-2157.529) [-2156.146] (-2160.195) * (-2154.879) (-2156.193) (-2156.995) [-2159.888] -- 0:01:27 103500 -- (-2158.664) [-2157.202] (-2158.700) (-2158.654) * [-2157.018] (-2159.149) (-2158.053) (-2158.049) -- 0:01:26 104000 -- (-2156.380) [-2156.638] (-2159.843) (-2154.323) * (-2156.712) [-2159.046] (-2159.384) (-2156.389) -- 0:01:26 104500 -- [-2160.447] (-2157.026) (-2156.993) (-2155.588) * (-2158.230) (-2156.461) (-2158.591) [-2158.199] -- 0:01:25 105000 -- (-2160.814) [-2157.015] (-2156.251) (-2160.736) * (-2161.191) [-2159.630] (-2157.394) (-2155.843) -- 0:01:25 Average standard deviation of split frequencies: 0.027795 105500 -- [-2158.510] (-2157.449) (-2156.825) (-2160.613) * (-2159.921) (-2159.755) [-2157.092] (-2157.682) -- 0:01:24 106000 -- [-2158.909] (-2157.915) (-2159.403) (-2157.741) * (-2157.847) (-2156.275) (-2156.635) [-2158.981] -- 0:01:24 106500 -- (-2158.909) (-2165.075) (-2159.826) [-2156.070] * [-2157.540] (-2159.237) (-2158.399) (-2159.883) -- 0:01:23 107000 -- (-2159.691) (-2163.251) [-2159.076] (-2160.435) * (-2158.586) (-2158.915) (-2156.167) [-2157.907] -- 0:01:23 107500 -- (-2160.745) (-2158.313) [-2155.332] (-2158.829) * (-2157.900) (-2159.793) [-2156.153] (-2160.112) -- 0:01:23 108000 -- (-2164.111) (-2159.557) [-2155.636] (-2155.856) * [-2158.214] (-2156.137) (-2156.373) (-2156.634) -- 0:01:22 108500 -- (-2157.902) (-2158.492) (-2153.502) [-2155.343] * [-2158.224] (-2160.120) (-2160.454) (-2157.819) -- 0:01:22 109000 -- (-2161.300) (-2160.055) (-2155.357) [-2155.392] * (-2155.404) [-2154.729] (-2160.799) (-2155.909) -- 0:01:21 109500 -- (-2156.461) [-2162.181] (-2155.176) (-2157.662) * (-2163.213) [-2156.176] (-2156.546) (-2157.278) -- 0:01:21 110000 -- (-2159.253) (-2168.283) [-2157.853] (-2157.472) * (-2159.576) [-2155.141] (-2156.954) (-2156.441) -- 0:01:20 Average standard deviation of split frequencies: 0.026889 110500 -- (-2158.319) (-2164.448) [-2154.596] (-2160.461) * (-2158.632) [-2159.218] (-2157.353) (-2155.287) -- 0:01:20 111000 -- (-2159.250) [-2157.246] (-2156.250) (-2160.216) * [-2158.993] (-2156.532) (-2158.841) (-2156.706) -- 0:01:28 111500 -- (-2159.139) [-2156.006] (-2157.271) (-2157.830) * (-2159.100) [-2154.548] (-2159.884) (-2158.635) -- 0:01:27 112000 -- (-2158.137) [-2158.285] (-2156.543) (-2157.467) * [-2159.529] (-2159.089) (-2157.970) (-2156.726) -- 0:01:27 112500 -- (-2158.156) (-2162.466) [-2155.014] (-2156.051) * (-2157.068) (-2160.112) (-2158.281) [-2156.773] -- 0:01:26 113000 -- [-2157.597] (-2158.812) (-2157.089) (-2155.665) * [-2156.203] (-2158.002) (-2156.343) (-2156.117) -- 0:01:26 113500 -- (-2155.352) [-2162.950] (-2157.055) (-2156.197) * [-2156.803] (-2156.594) (-2155.406) (-2157.293) -- 0:01:25 114000 -- [-2154.830] (-2157.390) (-2157.032) (-2156.327) * (-2157.511) [-2157.098] (-2158.052) (-2157.633) -- 0:01:25 114500 -- (-2157.591) (-2161.114) [-2157.225] (-2156.426) * (-2159.005) [-2156.165] (-2157.002) (-2160.692) -- 0:01:25 115000 -- (-2162.062) (-2159.876) (-2157.307) [-2156.406] * (-2159.132) [-2155.780] (-2156.384) (-2160.254) -- 0:01:24 Average standard deviation of split frequencies: 0.025578 115500 -- (-2160.545) (-2157.200) [-2156.646] (-2158.892) * (-2159.881) [-2157.552] (-2156.518) (-2162.605) -- 0:01:24 116000 -- (-2156.365) (-2157.323) [-2157.332] (-2156.692) * (-2160.033) (-2156.966) [-2155.414] (-2155.490) -- 0:01:23 116500 -- (-2158.200) (-2156.890) (-2156.725) [-2154.548] * (-2159.551) (-2156.326) (-2155.952) [-2155.759] -- 0:01:23 117000 -- (-2162.339) [-2157.018] (-2155.145) (-2156.560) * (-2158.961) [-2156.118] (-2156.261) (-2159.635) -- 0:01:23 117500 -- (-2154.971) [-2160.112] (-2157.163) (-2157.939) * (-2156.988) [-2156.221] (-2158.292) (-2156.533) -- 0:01:22 118000 -- (-2155.149) (-2157.382) (-2154.577) [-2158.902] * (-2155.324) [-2156.852] (-2156.216) (-2156.248) -- 0:01:22 118500 -- (-2159.520) (-2156.866) [-2154.094] (-2155.402) * [-2155.836] (-2154.900) (-2157.325) (-2156.954) -- 0:01:21 119000 -- (-2157.101) (-2156.095) (-2158.645) [-2154.957] * [-2158.298] (-2157.714) (-2160.461) (-2159.856) -- 0:01:21 119500 -- (-2157.867) (-2156.307) (-2159.711) [-2156.714] * (-2157.419) (-2156.990) (-2158.051) [-2155.708] -- 0:01:21 120000 -- (-2155.790) [-2156.010] (-2155.666) (-2156.456) * (-2155.682) (-2157.088) (-2157.686) [-2154.795] -- 0:01:20 Average standard deviation of split frequencies: 0.024359 120500 -- (-2157.582) (-2154.728) [-2156.214] (-2156.657) * (-2159.439) (-2156.449) [-2155.997] (-2155.110) -- 0:01:20 121000 -- [-2158.499] (-2158.433) (-2156.299) (-2160.364) * (-2155.527) (-2156.864) [-2156.825] (-2154.354) -- 0:01:19 121500 -- (-2155.962) (-2155.836) (-2153.670) [-2157.946] * (-2157.479) (-2158.988) [-2156.963] (-2155.692) -- 0:01:19 122000 -- [-2155.978] (-2156.859) (-2158.615) (-2156.972) * [-2155.996] (-2158.989) (-2160.010) (-2157.534) -- 0:01:26 122500 -- (-2159.095) (-2157.115) (-2155.653) [-2157.138] * (-2156.823) [-2156.901] (-2154.812) (-2155.693) -- 0:01:25 123000 -- (-2155.329) (-2158.024) (-2157.541) [-2155.882] * (-2158.696) (-2156.310) [-2156.833] (-2159.555) -- 0:01:25 123500 -- [-2158.707] (-2157.410) (-2158.521) (-2165.121) * (-2159.493) (-2155.734) (-2159.443) [-2155.694] -- 0:01:25 124000 -- (-2157.124) [-2157.718] (-2159.320) (-2155.890) * (-2160.249) (-2158.592) [-2156.994] (-2158.340) -- 0:01:24 124500 -- (-2158.146) (-2156.917) [-2156.944] (-2160.019) * (-2162.711) (-2158.927) (-2154.815) [-2156.917] -- 0:01:24 125000 -- [-2158.114] (-2156.181) (-2153.922) (-2159.339) * (-2157.450) (-2158.331) (-2158.978) [-2155.287] -- 0:01:24 Average standard deviation of split frequencies: 0.023988 125500 -- (-2155.832) (-2156.609) (-2153.969) [-2159.339] * (-2157.545) [-2157.303] (-2158.447) (-2157.772) -- 0:01:23 126000 -- [-2153.817] (-2155.961) (-2157.252) (-2159.425) * (-2156.049) [-2156.707] (-2164.860) (-2157.642) -- 0:01:23 126500 -- [-2155.195] (-2155.833) (-2159.115) (-2159.811) * [-2157.380] (-2156.803) (-2158.956) (-2158.144) -- 0:01:22 127000 -- (-2158.717) (-2157.047) [-2160.582] (-2157.673) * (-2157.304) (-2156.519) [-2155.644] (-2157.103) -- 0:01:22 127500 -- (-2158.527) (-2159.314) (-2159.646) [-2158.856] * (-2157.630) [-2157.490] (-2156.239) (-2159.709) -- 0:01:22 128000 -- (-2157.750) (-2158.523) (-2156.611) [-2157.133] * (-2158.869) (-2153.804) (-2157.553) [-2158.448] -- 0:01:21 128500 -- (-2156.147) (-2156.483) [-2159.476] (-2161.052) * (-2158.448) (-2156.256) [-2160.498] (-2166.011) -- 0:01:21 129000 -- (-2155.546) (-2156.854) (-2160.054) [-2155.693] * (-2159.341) (-2157.620) [-2158.953] (-2154.532) -- 0:01:21 129500 -- [-2155.284] (-2157.044) (-2156.432) (-2158.221) * (-2158.967) [-2154.826] (-2157.364) (-2158.070) -- 0:01:20 130000 -- (-2156.639) (-2157.975) [-2157.520] (-2156.959) * (-2158.620) (-2154.078) [-2157.306] (-2159.085) -- 0:01:20 Average standard deviation of split frequencies: 0.020797 130500 -- (-2156.270) [-2154.075] (-2160.750) (-2157.125) * (-2158.847) [-2156.827] (-2154.872) (-2162.980) -- 0:01:19 131000 -- (-2156.993) [-2159.780] (-2160.547) (-2157.344) * (-2158.906) (-2157.032) [-2158.995] (-2162.247) -- 0:01:19 131500 -- (-2157.359) (-2157.537) (-2156.883) [-2160.050] * (-2156.994) [-2156.242] (-2158.603) (-2161.337) -- 0:01:19 132000 -- (-2156.588) [-2157.712] (-2157.269) (-2161.160) * (-2156.466) (-2157.057) [-2159.134] (-2156.896) -- 0:01:18 132500 -- (-2156.804) (-2158.406) [-2157.299] (-2160.787) * [-2154.794] (-2156.731) (-2160.775) (-2158.090) -- 0:01:18 133000 -- (-2158.541) (-2154.676) [-2156.778] (-2164.091) * [-2159.055] (-2154.917) (-2160.818) (-2156.760) -- 0:01:24 133500 -- [-2158.424] (-2154.498) (-2158.058) (-2158.009) * (-2161.519) [-2157.039] (-2157.723) (-2156.111) -- 0:01:24 134000 -- (-2156.976) [-2155.817] (-2156.546) (-2157.989) * (-2158.455) (-2155.087) (-2156.347) [-2155.053] -- 0:01:24 134500 -- (-2156.238) [-2154.556] (-2156.500) (-2158.507) * (-2157.053) (-2157.502) (-2158.311) [-2157.528] -- 0:01:23 135000 -- (-2156.913) (-2157.655) (-2157.134) [-2157.095] * (-2156.899) (-2156.559) [-2159.479] (-2158.483) -- 0:01:23 Average standard deviation of split frequencies: 0.019370 135500 -- (-2159.033) [-2157.005] (-2159.484) (-2159.639) * (-2157.464) [-2159.618] (-2158.572) (-2158.296) -- 0:01:22 136000 -- [-2157.724] (-2159.688) (-2159.611) (-2165.322) * [-2155.875] (-2157.407) (-2153.864) (-2157.314) -- 0:01:22 136500 -- (-2157.698) (-2155.659) (-2155.958) [-2156.047] * (-2154.831) [-2154.882] (-2155.834) (-2154.557) -- 0:01:22 137000 -- (-2156.744) (-2157.543) [-2155.528] (-2158.968) * (-2156.986) [-2158.373] (-2156.897) (-2155.997) -- 0:01:21 137500 -- (-2157.114) [-2160.220] (-2155.222) (-2156.998) * (-2155.059) (-2155.592) (-2156.897) [-2156.280] -- 0:01:21 138000 -- [-2156.911] (-2158.832) (-2158.185) (-2156.569) * (-2160.427) (-2157.333) (-2157.043) [-2157.358] -- 0:01:21 138500 -- (-2158.703) (-2159.180) [-2154.282] (-2161.426) * (-2157.515) (-2156.782) (-2157.157) [-2158.885] -- 0:01:20 139000 -- (-2158.404) [-2157.064] (-2157.127) (-2161.017) * (-2157.391) (-2155.904) [-2156.246] (-2154.495) -- 0:01:20 139500 -- (-2158.647) [-2156.306] (-2157.493) (-2158.843) * [-2161.870] (-2155.002) (-2156.256) (-2155.549) -- 0:01:20 140000 -- (-2155.970) (-2156.900) [-2154.260] (-2158.107) * (-2157.688) [-2158.481] (-2157.758) (-2158.265) -- 0:01:19 Average standard deviation of split frequencies: 0.017939 140500 -- [-2156.707] (-2158.132) (-2155.785) (-2157.185) * (-2158.697) (-2157.692) (-2156.700) [-2155.051] -- 0:01:19 141000 -- (-2157.070) [-2157.980] (-2156.435) (-2156.697) * (-2156.518) [-2159.036] (-2156.925) (-2159.332) -- 0:01:19 141500 -- (-2157.301) [-2156.532] (-2157.825) (-2157.336) * (-2156.767) [-2158.795] (-2157.526) (-2158.458) -- 0:01:18 142000 -- (-2158.223) (-2157.141) [-2158.816] (-2159.337) * (-2158.509) [-2161.456] (-2156.903) (-2159.217) -- 0:01:18 142500 -- (-2158.993) [-2155.241] (-2157.938) (-2158.167) * (-2158.834) [-2158.797] (-2159.502) (-2157.673) -- 0:01:18 143000 -- (-2152.686) [-2156.912] (-2159.584) (-2159.748) * (-2159.339) (-2160.544) (-2158.858) [-2156.552] -- 0:01:17 143500 -- (-2157.432) [-2157.937] (-2156.151) (-2158.509) * (-2158.233) [-2158.279] (-2157.034) (-2155.513) -- 0:01:17 144000 -- [-2159.406] (-2156.970) (-2155.436) (-2155.314) * (-2156.740) (-2156.820) [-2158.114] (-2156.121) -- 0:01:23 144500 -- [-2158.511] (-2156.305) (-2156.093) (-2159.362) * (-2155.788) [-2157.510] (-2157.263) (-2159.152) -- 0:01:22 145000 -- [-2159.062] (-2155.947) (-2156.241) (-2159.613) * (-2156.348) (-2157.897) (-2157.931) [-2156.836] -- 0:01:22 Average standard deviation of split frequencies: 0.018613 145500 -- (-2156.241) [-2155.013] (-2156.644) (-2154.991) * [-2156.381] (-2159.976) (-2161.953) (-2162.686) -- 0:01:22 146000 -- (-2158.763) (-2156.779) [-2154.999] (-2158.098) * (-2156.209) [-2159.902] (-2156.663) (-2156.734) -- 0:01:21 146500 -- (-2159.520) (-2154.428) [-2157.511] (-2154.559) * (-2156.701) (-2157.462) [-2155.930] (-2160.125) -- 0:01:21 147000 -- (-2164.325) (-2157.184) [-2156.246] (-2158.068) * [-2154.873] (-2154.993) (-2156.917) (-2162.002) -- 0:01:21 147500 -- [-2155.542] (-2159.227) (-2156.929) (-2159.239) * [-2159.675] (-2157.811) (-2155.465) (-2159.587) -- 0:01:20 148000 -- (-2158.368) [-2157.887] (-2156.968) (-2158.470) * (-2158.576) (-2159.096) (-2154.928) [-2157.813] -- 0:01:20 148500 -- (-2159.399) (-2157.041) [-2155.450] (-2156.499) * (-2158.050) [-2159.029] (-2157.906) (-2159.352) -- 0:01:20 149000 -- [-2159.397] (-2154.997) (-2156.455) (-2158.013) * (-2158.397) (-2161.993) (-2155.336) [-2159.555] -- 0:01:19 149500 -- (-2155.675) (-2158.650) [-2156.153] (-2158.680) * (-2159.618) [-2161.368] (-2157.090) (-2158.360) -- 0:01:19 150000 -- [-2162.026] (-2159.313) (-2156.126) (-2157.655) * (-2156.423) (-2157.333) (-2156.954) [-2155.048] -- 0:01:19 Average standard deviation of split frequencies: 0.019877 150500 -- [-2157.374] (-2158.544) (-2157.464) (-2156.721) * (-2157.025) [-2157.914] (-2154.432) (-2158.765) -- 0:01:19 151000 -- (-2159.354) [-2157.212] (-2158.683) (-2156.415) * (-2156.978) (-2158.817) (-2158.158) [-2154.426] -- 0:01:18 151500 -- (-2157.744) [-2160.023] (-2157.521) (-2156.496) * (-2157.610) [-2159.457] (-2157.045) (-2155.062) -- 0:01:18 152000 -- (-2157.621) (-2159.072) (-2158.484) [-2158.816] * (-2158.546) (-2157.552) (-2157.200) [-2154.955] -- 0:01:18 152500 -- (-2156.154) [-2157.907] (-2156.798) (-2156.396) * [-2157.755] (-2157.380) (-2157.117) (-2158.041) -- 0:01:17 153000 -- (-2157.196) [-2156.513] (-2157.539) (-2156.910) * (-2157.025) [-2160.212] (-2156.572) (-2157.630) -- 0:01:17 153500 -- (-2162.883) (-2158.871) [-2156.736] (-2156.608) * [-2160.051] (-2157.775) (-2157.051) (-2154.275) -- 0:01:17 154000 -- (-2160.273) [-2157.306] (-2162.626) (-2156.685) * (-2159.101) [-2159.451] (-2157.025) (-2159.966) -- 0:01:16 154500 -- (-2158.081) (-2156.112) (-2159.331) [-2156.519] * (-2159.374) (-2155.296) (-2156.265) [-2154.488] -- 0:01:22 155000 -- (-2156.726) [-2161.102] (-2158.613) (-2159.160) * [-2158.759] (-2159.216) (-2156.268) (-2158.156) -- 0:01:21 Average standard deviation of split frequencies: 0.020817 155500 -- (-2156.037) (-2161.994) (-2161.954) [-2156.654] * (-2158.806) (-2157.148) (-2156.782) [-2155.783] -- 0:01:21 156000 -- (-2156.098) (-2162.707) (-2153.911) [-2159.254] * [-2157.323] (-2160.517) (-2160.260) (-2157.693) -- 0:01:21 156500 -- (-2157.399) (-2156.702) [-2154.022] (-2157.275) * (-2160.115) (-2162.670) (-2160.670) [-2154.578] -- 0:01:20 157000 -- [-2157.883] (-2156.575) (-2155.813) (-2158.495) * (-2158.965) [-2158.701] (-2162.450) (-2156.624) -- 0:01:20 157500 -- (-2157.426) [-2157.548] (-2162.193) (-2157.249) * (-2159.964) (-2156.871) [-2158.068] (-2158.660) -- 0:01:20 158000 -- (-2156.031) (-2156.158) (-2160.259) [-2158.932] * (-2158.195) [-2156.677] (-2156.828) (-2157.022) -- 0:01:19 158500 -- (-2159.511) (-2154.930) [-2153.109] (-2161.521) * (-2158.067) (-2159.230) [-2156.292] (-2154.797) -- 0:01:19 159000 -- [-2157.755] (-2155.688) (-2159.318) (-2160.322) * (-2159.213) (-2159.402) [-2157.803] (-2156.650) -- 0:01:19 159500 -- [-2156.843] (-2155.918) (-2158.218) (-2160.347) * [-2160.048] (-2159.745) (-2157.039) (-2156.590) -- 0:01:19 160000 -- (-2155.936) [-2153.743] (-2156.215) (-2160.896) * (-2157.686) (-2156.301) (-2156.160) [-2157.069] -- 0:01:18 Average standard deviation of split frequencies: 0.019723 160500 -- (-2155.976) [-2156.839] (-2157.328) (-2156.181) * (-2156.849) (-2156.056) (-2157.956) [-2158.210] -- 0:01:18 161000 -- [-2156.970] (-2157.312) (-2157.877) (-2157.015) * (-2156.754) [-2158.364] (-2160.164) (-2156.822) -- 0:01:18 161500 -- (-2158.168) [-2158.048] (-2156.727) (-2160.833) * (-2158.561) (-2158.668) (-2157.769) [-2156.793] -- 0:01:17 162000 -- (-2156.338) (-2158.648) [-2158.983] (-2157.712) * [-2156.696] (-2158.333) (-2161.378) (-2157.015) -- 0:01:17 162500 -- [-2156.093] (-2158.662) (-2159.514) (-2156.567) * (-2156.703) (-2157.053) (-2160.432) [-2157.994] -- 0:01:17 163000 -- (-2158.939) [-2155.862] (-2154.263) (-2156.903) * [-2157.314] (-2157.409) (-2158.318) (-2157.966) -- 0:01:17 163500 -- (-2157.323) (-2157.207) [-2154.312] (-2158.396) * (-2156.975) (-2158.307) (-2156.188) [-2156.870] -- 0:01:16 164000 -- (-2155.132) (-2157.762) (-2156.265) [-2156.971] * (-2157.724) [-2157.491] (-2156.108) (-2159.895) -- 0:01:16 164500 -- (-2156.146) (-2159.222) (-2156.203) [-2155.474] * (-2158.868) (-2157.925) [-2156.270] (-2159.042) -- 0:01:16 165000 -- (-2154.812) [-2157.256] (-2157.509) (-2156.254) * (-2158.309) (-2160.257) [-2156.598] (-2155.359) -- 0:01:15 Average standard deviation of split frequencies: 0.017196 165500 -- [-2156.045] (-2157.338) (-2156.546) (-2156.994) * (-2156.668) [-2158.060] (-2157.975) (-2158.073) -- 0:01:20 166000 -- (-2155.513) (-2157.327) [-2156.536] (-2158.929) * (-2158.885) [-2157.036] (-2156.342) (-2160.328) -- 0:01:20 166500 -- [-2155.981] (-2159.218) (-2156.244) (-2159.902) * [-2154.648] (-2158.433) (-2157.186) (-2158.080) -- 0:01:20 167000 -- (-2159.830) (-2158.451) [-2155.689] (-2166.960) * [-2157.685] (-2157.821) (-2158.201) (-2157.192) -- 0:01:19 167500 -- (-2158.803) (-2156.861) (-2157.119) [-2161.040] * (-2159.269) (-2157.462) [-2155.054] (-2156.905) -- 0:01:19 168000 -- (-2158.639) (-2158.341) [-2154.631] (-2158.117) * (-2158.660) [-2159.199] (-2157.851) (-2158.129) -- 0:01:19 168500 -- [-2154.085] (-2160.307) (-2156.279) (-2158.501) * [-2159.133] (-2157.147) (-2156.301) (-2156.644) -- 0:01:18 169000 -- (-2156.463) (-2161.624) (-2154.523) [-2160.781] * (-2155.423) [-2156.816] (-2158.638) (-2157.801) -- 0:01:18 169500 -- (-2157.295) [-2158.813] (-2154.973) (-2157.749) * [-2156.204] (-2155.565) (-2162.809) (-2155.991) -- 0:01:18 170000 -- (-2157.450) (-2157.849) [-2157.636] (-2155.830) * (-2159.108) (-2157.929) [-2157.833] (-2158.930) -- 0:01:18 Average standard deviation of split frequencies: 0.016112 170500 -- (-2157.742) (-2158.013) (-2158.374) [-2157.924] * (-2158.735) (-2154.795) [-2154.483] (-2157.139) -- 0:01:17 171000 -- [-2157.420] (-2157.739) (-2157.490) (-2160.104) * (-2156.412) [-2156.173] (-2158.867) (-2157.525) -- 0:01:17 171500 -- [-2158.796] (-2157.011) (-2157.520) (-2156.501) * (-2158.625) (-2157.207) [-2158.162] (-2156.835) -- 0:01:17 172000 -- (-2155.766) (-2157.833) (-2157.090) [-2155.756] * [-2159.153] (-2156.184) (-2159.265) (-2152.381) -- 0:01:17 172500 -- (-2157.753) [-2157.677] (-2157.009) (-2156.698) * (-2157.434) (-2156.106) [-2157.394] (-2158.226) -- 0:01:16 173000 -- (-2155.597) (-2156.963) (-2155.518) [-2155.169] * (-2156.782) (-2158.139) [-2158.731] (-2156.704) -- 0:01:16 173500 -- (-2154.132) (-2156.933) (-2157.632) [-2154.370] * (-2156.331) (-2158.795) (-2157.518) [-2155.381] -- 0:01:16 174000 -- (-2156.970) (-2157.995) [-2156.034] (-2161.823) * (-2156.690) (-2156.790) (-2158.614) [-2156.270] -- 0:01:15 174500 -- [-2157.125] (-2157.906) (-2158.013) (-2156.965) * (-2159.161) [-2157.240] (-2159.590) (-2156.592) -- 0:01:15 175000 -- (-2158.933) (-2158.585) [-2158.112] (-2158.552) * (-2157.369) (-2157.614) (-2159.624) [-2156.882] -- 0:01:15 Average standard deviation of split frequencies: 0.016368 175500 -- (-2158.077) (-2158.953) [-2156.796] (-2158.591) * [-2155.128] (-2158.487) (-2157.129) (-2158.481) -- 0:01:15 176000 -- [-2158.007] (-2157.306) (-2159.564) (-2160.676) * (-2156.239) (-2157.879) (-2158.276) [-2156.536] -- 0:01:14 176500 -- (-2160.023) (-2157.049) [-2158.046] (-2158.571) * (-2157.271) [-2155.869] (-2156.601) (-2154.757) -- 0:01:19 177000 -- (-2157.104) (-2157.020) [-2157.593] (-2157.728) * (-2160.216) (-2157.256) [-2157.217] (-2158.673) -- 0:01:19 177500 -- (-2156.409) (-2157.722) (-2158.202) [-2157.858] * (-2158.265) (-2157.486) (-2157.056) [-2157.708] -- 0:01:18 178000 -- (-2154.816) [-2154.550] (-2159.375) (-2154.737) * [-2156.808] (-2161.461) (-2155.873) (-2160.964) -- 0:01:18 178500 -- [-2155.946] (-2155.463) (-2158.857) (-2156.343) * (-2155.399) (-2161.093) (-2157.101) [-2157.786] -- 0:01:18 179000 -- [-2162.069] (-2156.611) (-2156.130) (-2154.255) * (-2156.849) (-2160.460) (-2156.604) [-2160.217] -- 0:01:17 179500 -- (-2154.721) (-2155.639) (-2158.443) [-2156.852] * (-2159.955) (-2158.042) [-2157.590] (-2162.693) -- 0:01:17 180000 -- (-2158.003) (-2155.293) [-2158.808] (-2158.257) * (-2159.838) (-2157.179) [-2157.178] (-2161.959) -- 0:01:17 Average standard deviation of split frequencies: 0.016116 180500 -- (-2158.073) [-2157.397] (-2159.003) (-2158.170) * [-2156.651] (-2157.088) (-2156.837) (-2157.355) -- 0:01:17 181000 -- (-2156.670) (-2157.397) [-2155.834] (-2157.028) * [-2157.454] (-2156.404) (-2160.068) (-2159.998) -- 0:01:16 181500 -- [-2156.409] (-2157.602) (-2155.687) (-2163.054) * (-2156.999) (-2156.768) [-2158.155] (-2158.181) -- 0:01:16 182000 -- (-2156.675) [-2157.025] (-2159.754) (-2161.226) * [-2157.782] (-2157.256) (-2157.959) (-2157.725) -- 0:01:16 182500 -- (-2158.563) [-2157.146] (-2159.589) (-2159.495) * (-2157.890) [-2157.619] (-2156.875) (-2159.341) -- 0:01:16 183000 -- (-2156.582) (-2156.578) [-2158.531] (-2157.402) * (-2159.553) (-2159.045) (-2157.974) [-2159.010] -- 0:01:15 183500 -- (-2156.394) (-2156.021) [-2157.049] (-2159.400) * [-2157.233] (-2158.239) (-2156.458) (-2157.654) -- 0:01:15 184000 -- [-2156.517] (-2156.486) (-2161.246) (-2155.914) * [-2157.421] (-2159.256) (-2157.535) (-2158.813) -- 0:01:15 184500 -- (-2156.285) (-2161.180) (-2159.179) [-2154.313] * (-2160.802) [-2164.052] (-2156.634) (-2158.784) -- 0:01:15 185000 -- [-2155.966] (-2158.611) (-2157.918) (-2155.111) * (-2159.231) (-2164.599) (-2153.594) [-2158.747] -- 0:01:14 Average standard deviation of split frequencies: 0.016474 185500 -- (-2159.317) [-2156.175] (-2156.889) (-2156.483) * [-2161.119] (-2160.429) (-2156.527) (-2157.874) -- 0:01:14 186000 -- (-2160.095) (-2160.319) [-2156.046] (-2157.017) * [-2160.555] (-2161.261) (-2160.121) (-2163.319) -- 0:01:14 186500 -- (-2157.179) [-2156.644] (-2157.076) (-2158.059) * (-2159.180) [-2157.611] (-2157.722) (-2158.412) -- 0:01:14 187000 -- (-2157.139) [-2157.922] (-2158.032) (-2157.224) * (-2155.905) (-2156.608) [-2158.335] (-2158.409) -- 0:01:18 187500 -- (-2158.117) [-2158.047] (-2161.799) (-2155.272) * [-2158.254] (-2156.122) (-2160.614) (-2156.464) -- 0:01:18 188000 -- (-2156.708) (-2158.000) [-2157.533] (-2157.458) * (-2158.216) [-2155.607] (-2157.252) (-2157.913) -- 0:01:17 188500 -- (-2156.734) (-2158.061) [-2156.850] (-2156.437) * (-2155.641) [-2153.738] (-2157.095) (-2161.130) -- 0:01:17 189000 -- (-2155.326) (-2156.800) (-2157.503) [-2154.685] * (-2157.309) [-2157.104] (-2156.255) (-2159.934) -- 0:01:17 189500 -- [-2158.097] (-2157.066) (-2157.331) (-2159.263) * [-2156.574] (-2156.510) (-2157.998) (-2157.005) -- 0:01:16 190000 -- (-2160.790) [-2156.608] (-2157.635) (-2155.179) * (-2158.790) [-2157.116] (-2158.184) (-2157.288) -- 0:01:16 Average standard deviation of split frequencies: 0.016895 190500 -- (-2157.685) (-2157.295) (-2156.513) [-2154.328] * (-2161.292) (-2158.626) [-2156.304] (-2159.798) -- 0:01:16 191000 -- (-2158.726) (-2157.293) (-2157.704) [-2161.005] * (-2161.292) (-2156.498) (-2156.517) [-2157.468] -- 0:01:16 191500 -- (-2159.007) (-2158.744) [-2158.255] (-2159.597) * [-2156.841] (-2156.572) (-2156.656) (-2157.350) -- 0:01:15 192000 -- (-2158.639) (-2157.907) [-2156.484] (-2154.557) * [-2156.317] (-2156.958) (-2158.034) (-2157.206) -- 0:01:15 192500 -- (-2158.059) (-2159.950) [-2156.549] (-2156.269) * (-2152.612) (-2154.308) (-2157.909) [-2159.706] -- 0:01:15 193000 -- (-2158.998) (-2161.326) [-2160.218] (-2156.075) * (-2160.149) (-2153.700) [-2157.315] (-2159.854) -- 0:01:15 193500 -- (-2160.263) [-2156.892] (-2157.028) (-2154.546) * (-2159.575) (-2156.933) [-2157.964] (-2157.577) -- 0:01:15 194000 -- (-2156.863) (-2157.193) (-2156.743) [-2153.382] * (-2158.121) (-2156.485) [-2160.048] (-2158.729) -- 0:01:14 194500 -- [-2155.769] (-2159.405) (-2159.927) (-2154.430) * (-2161.283) (-2160.691) (-2160.888) [-2156.622] -- 0:01:14 195000 -- (-2160.627) (-2161.582) [-2162.103] (-2155.582) * (-2160.318) (-2158.324) [-2156.645] (-2157.433) -- 0:01:14 Average standard deviation of split frequencies: 0.019508 195500 -- (-2158.220) [-2156.903] (-2154.877) (-2156.913) * (-2154.667) (-2162.377) (-2156.450) [-2157.384] -- 0:01:14 196000 -- (-2157.851) (-2157.688) (-2155.741) [-2156.451] * (-2155.602) (-2158.130) (-2163.057) [-2154.496] -- 0:01:13 196500 -- (-2158.572) (-2158.081) [-2156.160] (-2155.406) * (-2157.356) (-2156.635) (-2159.390) [-2154.725] -- 0:01:13 197000 -- (-2155.907) (-2159.830) (-2158.140) [-2153.679] * [-2157.486] (-2156.541) (-2157.174) (-2156.133) -- 0:01:13 197500 -- (-2160.821) (-2157.654) (-2156.127) [-2156.350] * (-2157.944) (-2155.067) [-2158.643] (-2156.318) -- 0:01:13 198000 -- (-2155.960) [-2158.488] (-2157.861) (-2154.730) * [-2157.496] (-2155.378) (-2156.500) (-2158.583) -- 0:01:16 198500 -- (-2163.097) (-2156.769) (-2156.878) [-2155.866] * (-2161.255) [-2155.332] (-2157.464) (-2156.909) -- 0:01:16 199000 -- (-2156.758) (-2156.281) (-2156.998) [-2158.840] * (-2155.467) [-2159.791] (-2157.751) (-2156.949) -- 0:01:16 199500 -- (-2156.739) (-2155.369) (-2159.604) [-2156.908] * (-2155.856) (-2155.392) [-2156.548] (-2157.939) -- 0:01:16 200000 -- (-2157.368) [-2155.264] (-2158.251) (-2156.276) * (-2155.724) [-2154.069] (-2156.959) (-2159.523) -- 0:01:16 Average standard deviation of split frequencies: 0.019761 200500 -- (-2158.926) (-2159.074) [-2156.488] (-2154.347) * [-2158.005] (-2157.245) (-2158.085) (-2159.789) -- 0:01:15 201000 -- [-2156.150] (-2159.900) (-2157.436) (-2156.175) * (-2157.273) (-2156.931) (-2157.308) [-2156.603] -- 0:01:15 201500 -- [-2156.882] (-2158.275) (-2154.380) (-2154.648) * [-2158.022] (-2157.253) (-2157.004) (-2156.192) -- 0:01:15 202000 -- (-2157.309) (-2156.750) [-2156.977] (-2155.583) * [-2157.044] (-2158.908) (-2158.032) (-2156.763) -- 0:01:15 202500 -- [-2157.282] (-2156.252) (-2158.440) (-2156.665) * (-2157.980) (-2158.627) (-2156.992) [-2156.728] -- 0:01:14 203000 -- (-2155.474) [-2154.652] (-2158.820) (-2159.499) * [-2162.440] (-2157.188) (-2158.601) (-2158.436) -- 0:01:14 203500 -- (-2155.550) [-2156.374] (-2162.050) (-2160.231) * [-2157.191] (-2159.027) (-2156.268) (-2157.132) -- 0:01:14 204000 -- [-2157.719] (-2156.872) (-2158.797) (-2154.315) * (-2157.504) [-2159.848] (-2158.622) (-2161.149) -- 0:01:14 204500 -- (-2156.441) (-2158.313) (-2158.228) [-2156.045] * (-2159.289) (-2155.480) [-2155.001] (-2158.795) -- 0:01:13 205000 -- (-2158.098) [-2155.978] (-2159.681) (-2161.006) * (-2156.513) (-2154.812) [-2158.929] (-2160.763) -- 0:01:13 Average standard deviation of split frequencies: 0.019922 205500 -- (-2160.789) (-2158.079) (-2156.565) [-2156.479] * (-2155.838) [-2161.344] (-2157.998) (-2159.587) -- 0:01:13 206000 -- (-2157.476) (-2158.804) [-2155.482] (-2155.134) * [-2153.403] (-2158.255) (-2156.553) (-2156.978) -- 0:01:13 206500 -- (-2157.846) [-2155.535] (-2157.751) (-2158.327) * (-2155.786) (-2157.787) (-2160.639) [-2155.223] -- 0:01:13 207000 -- (-2159.119) [-2157.092] (-2158.431) (-2157.600) * [-2157.121] (-2156.563) (-2164.328) (-2154.465) -- 0:01:12 207500 -- (-2158.439) (-2158.660) (-2156.960) [-2157.084] * (-2155.057) (-2157.119) (-2162.025) [-2160.810] -- 0:01:12 208000 -- (-2158.604) (-2161.961) (-2158.387) [-2153.795] * (-2156.883) [-2157.179] (-2159.741) (-2160.583) -- 0:01:12 208500 -- [-2157.856] (-2159.431) (-2157.659) (-2154.165) * (-2158.583) (-2162.852) [-2156.947] (-2155.554) -- 0:01:12 209000 -- (-2156.291) [-2160.564] (-2163.855) (-2154.559) * (-2158.636) [-2157.226] (-2157.939) (-2156.214) -- 0:01:15 209500 -- (-2156.931) (-2158.580) (-2159.203) [-2158.785] * (-2157.575) (-2158.599) [-2157.484] (-2156.389) -- 0:01:15 210000 -- (-2156.582) (-2156.489) [-2156.314] (-2159.020) * [-2156.103] (-2158.712) (-2159.414) (-2156.372) -- 0:01:15 Average standard deviation of split frequencies: 0.019876 210500 -- [-2156.282] (-2156.393) (-2160.377) (-2156.990) * (-2161.249) [-2156.874] (-2163.557) (-2157.281) -- 0:01:15 211000 -- [-2156.362] (-2153.993) (-2158.023) (-2158.072) * (-2159.497) [-2154.843] (-2156.974) (-2159.035) -- 0:01:14 211500 -- [-2156.289] (-2157.030) (-2157.893) (-2157.983) * (-2158.730) (-2156.816) (-2156.726) [-2156.489] -- 0:01:14 212000 -- (-2156.772) (-2155.032) [-2158.595] (-2158.441) * [-2157.844] (-2157.300) (-2156.591) (-2159.373) -- 0:01:14 212500 -- (-2156.480) [-2155.692] (-2159.947) (-2156.389) * (-2157.703) [-2159.156] (-2157.677) (-2158.031) -- 0:01:14 213000 -- (-2156.611) [-2158.086] (-2160.564) (-2156.403) * [-2157.827] (-2159.250) (-2157.504) (-2156.328) -- 0:01:13 213500 -- [-2161.692] (-2159.888) (-2158.589) (-2155.069) * [-2157.731] (-2161.085) (-2156.803) (-2155.892) -- 0:01:13 214000 -- [-2157.173] (-2157.142) (-2155.394) (-2156.294) * (-2156.649) (-2158.377) (-2156.461) [-2155.324] -- 0:01:13 214500 -- [-2156.170] (-2157.940) (-2157.732) (-2154.631) * [-2156.315] (-2156.771) (-2158.780) (-2153.949) -- 0:01:13 215000 -- (-2153.380) (-2156.531) [-2156.943] (-2154.090) * (-2156.614) (-2156.833) (-2157.467) [-2158.548] -- 0:01:13 Average standard deviation of split frequencies: 0.019513 215500 -- (-2159.252) (-2154.343) (-2157.878) [-2155.158] * (-2156.366) [-2157.877] (-2158.303) (-2160.963) -- 0:01:12 216000 -- [-2158.864] (-2160.143) (-2157.681) (-2157.754) * [-2157.759] (-2156.191) (-2159.033) (-2163.439) -- 0:01:12 216500 -- [-2156.363] (-2163.967) (-2159.715) (-2156.040) * [-2157.861] (-2156.456) (-2157.719) (-2155.818) -- 0:01:12 217000 -- (-2159.473) (-2164.966) (-2158.615) [-2153.784] * (-2156.821) (-2156.369) (-2155.279) [-2158.093] -- 0:01:12 217500 -- [-2158.500] (-2161.199) (-2159.453) (-2157.032) * (-2161.695) (-2156.068) (-2158.368) [-2155.782] -- 0:01:11 218000 -- (-2159.779) (-2160.320) (-2160.289) [-2157.254] * [-2158.521] (-2156.089) (-2158.581) (-2156.983) -- 0:01:11 218500 -- (-2158.102) (-2159.924) [-2158.625] (-2156.735) * [-2157.281] (-2157.188) (-2158.131) (-2156.118) -- 0:01:11 219000 -- (-2156.940) (-2161.108) (-2157.932) [-2156.275] * (-2157.308) [-2157.293] (-2160.164) (-2158.583) -- 0:01:14 219500 -- (-2156.682) (-2160.749) (-2156.622) [-2156.887] * [-2157.330] (-2157.321) (-2158.232) (-2157.725) -- 0:01:14 220000 -- (-2159.445) [-2158.428] (-2158.317) (-2158.154) * [-2156.747] (-2157.796) (-2157.349) (-2158.252) -- 0:01:14 Average standard deviation of split frequencies: 0.021111 220500 -- (-2159.923) (-2156.671) (-2156.672) [-2161.110] * (-2156.528) (-2157.920) (-2159.106) [-2157.414] -- 0:01:14 221000 -- (-2157.653) (-2157.273) [-2158.029] (-2156.510) * (-2154.379) (-2156.247) (-2158.301) [-2155.128] -- 0:01:14 221500 -- [-2158.856] (-2156.830) (-2158.705) (-2157.020) * (-2156.211) [-2157.539] (-2158.390) (-2154.270) -- 0:01:13 222000 -- (-2159.191) (-2157.336) [-2156.544] (-2155.418) * (-2157.790) (-2160.130) [-2156.625] (-2159.631) -- 0:01:13 222500 -- (-2156.904) [-2157.023] (-2156.778) (-2158.406) * (-2157.627) (-2157.435) [-2156.398] (-2160.020) -- 0:01:13 223000 -- (-2157.764) (-2160.046) [-2156.980] (-2158.628) * (-2156.943) (-2158.087) [-2162.816] (-2159.594) -- 0:01:13 223500 -- (-2158.872) (-2156.841) (-2157.019) [-2158.074] * (-2158.293) (-2158.185) (-2158.830) [-2160.359] -- 0:01:12 224000 -- [-2153.531] (-2158.480) (-2158.163) (-2157.381) * (-2159.746) (-2156.096) [-2156.818] (-2160.342) -- 0:01:16 224500 -- (-2156.335) (-2157.162) [-2158.152] (-2159.377) * (-2157.039) (-2156.054) [-2157.205] (-2157.634) -- 0:01:15 225000 -- (-2157.258) (-2158.073) [-2158.239] (-2157.818) * (-2157.390) [-2155.873] (-2157.642) (-2158.044) -- 0:01:15 Average standard deviation of split frequencies: 0.019264 225500 -- [-2156.391] (-2159.284) (-2158.098) (-2160.320) * (-2154.284) (-2156.229) [-2156.311] (-2155.989) -- 0:01:15 226000 -- [-2157.682] (-2159.650) (-2157.080) (-2158.216) * (-2157.617) [-2155.365] (-2161.158) (-2154.783) -- 0:01:15 226500 -- (-2157.309) (-2163.607) [-2157.049] (-2156.121) * (-2156.665) (-2156.299) (-2159.511) [-2156.168] -- 0:01:15 227000 -- (-2160.971) (-2157.914) [-2158.018] (-2156.357) * [-2156.582] (-2157.519) (-2158.321) (-2156.189) -- 0:01:14 227500 -- [-2159.293] (-2161.087) (-2157.903) (-2157.108) * (-2156.765) (-2158.402) [-2158.130] (-2159.291) -- 0:01:14 228000 -- (-2159.149) (-2156.009) [-2156.849] (-2155.771) * (-2158.550) (-2158.291) [-2157.024] (-2156.125) -- 0:01:14 228500 -- (-2157.163) [-2157.237] (-2157.142) (-2155.506) * (-2159.692) (-2159.102) [-2155.744] (-2156.546) -- 0:01:14 229000 -- [-2158.822] (-2157.431) (-2158.014) (-2159.087) * (-2157.467) (-2161.537) (-2156.731) [-2158.609] -- 0:01:14 229500 -- (-2155.646) (-2156.749) [-2158.754] (-2156.435) * (-2156.754) [-2159.320] (-2160.521) (-2158.120) -- 0:01:13 230000 -- (-2157.008) (-2155.596) (-2159.960) [-2153.525] * (-2156.816) [-2157.206] (-2157.901) (-2157.219) -- 0:01:13 Average standard deviation of split frequencies: 0.020557 230500 -- (-2156.951) [-2159.851] (-2162.431) (-2156.806) * (-2156.816) [-2158.386] (-2160.819) (-2156.847) -- 0:01:16 231000 -- (-2156.739) (-2159.393) (-2160.586) [-2156.518] * [-2157.476] (-2158.157) (-2162.968) (-2156.658) -- 0:01:16 231500 -- (-2156.295) (-2157.726) (-2158.066) [-2154.658] * [-2158.871] (-2157.141) (-2159.408) (-2157.697) -- 0:01:16 232000 -- [-2159.150] (-2157.174) (-2163.230) (-2155.888) * [-2156.532] (-2157.553) (-2157.037) (-2159.114) -- 0:01:16 232500 -- [-2157.855] (-2161.693) (-2167.018) (-2163.304) * [-2158.888] (-2156.327) (-2159.330) (-2159.781) -- 0:01:15 233000 -- (-2157.509) (-2155.143) [-2158.719] (-2157.209) * (-2154.458) [-2159.873] (-2162.297) (-2161.517) -- 0:01:15 233500 -- (-2156.211) [-2157.451] (-2159.600) (-2157.270) * (-2157.235) (-2159.882) [-2157.390] (-2155.047) -- 0:01:15 234000 -- [-2158.441] (-2165.574) (-2157.759) (-2157.744) * [-2160.348] (-2161.172) (-2157.056) (-2159.514) -- 0:01:15 234500 -- [-2157.509] (-2158.609) (-2158.344) (-2161.120) * (-2157.390) (-2157.861) (-2157.168) [-2157.349] -- 0:01:15 235000 -- [-2158.500] (-2163.259) (-2158.171) (-2157.731) * (-2157.411) (-2153.830) [-2157.219] (-2157.184) -- 0:01:14 Average standard deviation of split frequencies: 0.020680 235500 -- (-2161.176) [-2160.106] (-2158.817) (-2158.831) * (-2157.795) [-2154.071] (-2158.221) (-2157.294) -- 0:01:14 236000 -- [-2156.566] (-2160.266) (-2158.366) (-2164.809) * [-2157.532] (-2161.782) (-2158.218) (-2155.039) -- 0:01:14 236500 -- [-2157.804] (-2161.225) (-2158.480) (-2158.995) * (-2164.336) [-2157.801] (-2157.800) (-2156.699) -- 0:01:14 237000 -- (-2156.518) (-2158.063) [-2156.246] (-2157.634) * (-2160.331) [-2159.582] (-2161.331) (-2155.884) -- 0:01:14 237500 -- [-2157.605] (-2158.642) (-2159.020) (-2158.155) * (-2157.509) (-2157.782) (-2164.287) [-2156.454] -- 0:01:13 238000 -- (-2155.944) [-2157.839] (-2159.494) (-2159.560) * (-2153.912) (-2155.884) (-2157.543) [-2155.603] -- 0:01:13 238500 -- [-2160.705] (-2159.799) (-2158.066) (-2156.582) * (-2157.523) [-2158.426] (-2158.377) (-2160.153) -- 0:01:13 239000 -- (-2158.437) [-2154.441] (-2156.798) (-2156.201) * (-2157.875) (-2158.495) (-2158.078) [-2156.022] -- 0:01:13 239500 -- [-2156.687] (-2156.713) (-2161.806) (-2155.776) * (-2158.359) [-2156.430] (-2158.060) (-2154.817) -- 0:01:13 240000 -- [-2157.981] (-2157.074) (-2154.618) (-2156.156) * (-2159.032) (-2155.076) (-2161.760) [-2155.134] -- 0:01:12 Average standard deviation of split frequencies: 0.018896 240500 -- (-2163.014) (-2157.747) (-2155.767) [-2157.332] * (-2161.987) [-2152.391] (-2158.306) (-2158.397) -- 0:01:12 241000 -- (-2158.789) [-2154.110] (-2163.422) (-2157.047) * (-2155.012) (-2153.503) [-2157.129] (-2158.510) -- 0:01:12 241500 -- (-2156.864) (-2157.647) [-2156.559] (-2156.317) * (-2158.790) [-2155.241] (-2156.740) (-2156.658) -- 0:01:15 242000 -- (-2157.412) (-2155.934) [-2159.230] (-2157.961) * (-2158.152) [-2155.427] (-2157.965) (-2154.748) -- 0:01:15 242500 -- (-2156.189) [-2154.576] (-2155.031) (-2159.089) * [-2157.653] (-2153.705) (-2155.289) (-2158.892) -- 0:01:14 243000 -- [-2156.565] (-2158.178) (-2155.018) (-2160.250) * (-2158.058) (-2160.128) [-2157.684] (-2158.128) -- 0:01:14 243500 -- [-2160.577] (-2158.278) (-2157.629) (-2156.711) * (-2155.471) (-2157.364) (-2156.579) [-2157.026] -- 0:01:14 244000 -- [-2159.795] (-2157.094) (-2157.794) (-2156.630) * (-2156.187) [-2156.776] (-2157.624) (-2157.208) -- 0:01:14 244500 -- (-2157.938) (-2157.057) [-2159.736] (-2157.374) * [-2157.335] (-2156.909) (-2157.642) (-2158.792) -- 0:01:14 245000 -- [-2156.724] (-2156.713) (-2159.125) (-2156.937) * (-2158.076) [-2155.879] (-2157.414) (-2155.523) -- 0:01:13 Average standard deviation of split frequencies: 0.018486 245500 -- (-2159.421) (-2158.817) (-2157.854) [-2156.871] * (-2158.724) (-2155.436) (-2157.490) [-2154.715] -- 0:01:13 246000 -- [-2158.658] (-2156.699) (-2157.880) (-2159.482) * [-2156.805] (-2159.927) (-2158.665) (-2156.936) -- 0:01:13 246500 -- [-2157.400] (-2158.019) (-2157.144) (-2158.827) * [-2156.887] (-2159.336) (-2155.208) (-2158.223) -- 0:01:13 247000 -- (-2157.340) (-2161.996) (-2160.918) [-2159.139] * (-2163.289) [-2157.867] (-2158.136) (-2161.616) -- 0:01:13 247500 -- [-2158.120] (-2159.337) (-2159.335) (-2161.598) * (-2157.270) (-2158.741) [-2157.251] (-2161.755) -- 0:01:12 248000 -- (-2155.457) (-2157.259) (-2156.241) [-2157.469] * (-2158.666) [-2156.163] (-2156.472) (-2161.498) -- 0:01:12 248500 -- (-2158.904) (-2160.194) (-2158.394) [-2158.795] * [-2157.639] (-2158.617) (-2157.005) (-2158.521) -- 0:01:12 249000 -- (-2159.755) (-2159.648) [-2159.743] (-2162.297) * (-2158.266) [-2154.658] (-2157.024) (-2155.386) -- 0:01:12 249500 -- (-2157.050) (-2159.567) (-2159.637) [-2158.379] * (-2157.808) [-2156.349] (-2157.064) (-2155.159) -- 0:01:12 250000 -- [-2155.946] (-2157.337) (-2159.754) (-2157.887) * (-2158.843) (-2153.929) [-2157.048] (-2156.417) -- 0:01:12 Average standard deviation of split frequencies: 0.017700 250500 -- (-2162.149) (-2161.421) [-2160.940] (-2158.198) * (-2157.013) [-2158.788] (-2159.028) (-2160.465) -- 0:01:11 251000 -- (-2155.095) (-2161.854) [-2156.719] (-2158.354) * [-2155.366] (-2158.069) (-2161.016) (-2158.465) -- 0:01:11 251500 -- (-2159.442) (-2161.441) [-2159.522] (-2157.227) * [-2157.024] (-2159.112) (-2159.543) (-2161.318) -- 0:01:11 252000 -- (-2162.623) (-2161.964) [-2158.384] (-2159.152) * (-2157.729) [-2154.802] (-2161.399) (-2157.268) -- 0:01:11 252500 -- [-2158.557] (-2160.112) (-2156.646) (-2156.376) * (-2157.188) [-2155.661] (-2160.854) (-2158.471) -- 0:01:14 253000 -- (-2157.131) (-2161.257) (-2154.243) [-2156.383] * (-2157.177) [-2157.350] (-2157.611) (-2156.074) -- 0:01:13 253500 -- (-2157.400) [-2160.716] (-2158.370) (-2157.400) * (-2158.360) (-2156.746) [-2154.402] (-2154.459) -- 0:01:13 254000 -- (-2156.498) (-2160.566) [-2157.008] (-2156.844) * (-2157.207) [-2157.631] (-2155.739) (-2158.558) -- 0:01:13 254500 -- (-2158.491) [-2157.600] (-2156.827) (-2160.607) * [-2154.792] (-2156.386) (-2157.175) (-2161.530) -- 0:01:13 255000 -- (-2159.395) [-2153.770] (-2157.621) (-2157.353) * [-2155.743] (-2154.904) (-2157.026) (-2158.130) -- 0:01:13 Average standard deviation of split frequencies: 0.016789 255500 -- [-2159.863] (-2156.930) (-2157.970) (-2159.697) * [-2156.330] (-2156.125) (-2156.865) (-2158.393) -- 0:01:12 256000 -- (-2159.519) (-2159.405) [-2157.375] (-2159.724) * (-2156.082) (-2156.687) (-2159.051) [-2156.653] -- 0:01:12 256500 -- (-2155.781) (-2157.491) (-2157.187) [-2158.757] * (-2157.066) (-2156.482) (-2158.972) [-2156.451] -- 0:01:12 257000 -- (-2159.268) (-2157.765) [-2157.542] (-2158.274) * (-2157.097) [-2155.256] (-2158.416) (-2156.618) -- 0:01:12 257500 -- [-2154.682] (-2160.406) (-2157.998) (-2159.323) * (-2156.726) [-2160.945] (-2157.547) (-2154.020) -- 0:01:12 258000 -- (-2157.465) [-2158.848] (-2155.927) (-2164.018) * (-2155.703) (-2157.013) [-2158.813] (-2155.714) -- 0:01:11 258500 -- [-2156.323] (-2157.791) (-2156.227) (-2161.472) * [-2158.439] (-2156.545) (-2157.900) (-2156.121) -- 0:01:11 259000 -- (-2158.770) (-2157.059) (-2156.476) [-2158.067] * (-2157.052) [-2159.259] (-2157.183) (-2156.077) -- 0:01:11 259500 -- (-2159.934) (-2157.344) [-2154.570] (-2157.563) * [-2156.618] (-2155.431) (-2156.860) (-2156.010) -- 0:01:11 260000 -- (-2162.260) [-2156.871] (-2156.741) (-2156.813) * (-2153.685) (-2156.708) (-2158.567) [-2160.022] -- 0:01:11 Average standard deviation of split frequencies: 0.016063 260500 -- (-2162.293) [-2155.634] (-2155.071) (-2155.752) * (-2157.761) (-2156.833) [-2161.260] (-2158.291) -- 0:01:10 261000 -- (-2157.631) (-2157.182) [-2158.704] (-2155.115) * [-2153.676] (-2156.469) (-2156.695) (-2153.833) -- 0:01:10 261500 -- (-2159.309) (-2157.381) [-2158.090] (-2157.720) * (-2161.627) (-2158.806) (-2158.788) [-2156.294] -- 0:01:10 262000 -- (-2158.904) (-2156.408) (-2159.478) [-2158.725] * (-2158.993) [-2155.936] (-2159.079) (-2156.328) -- 0:01:10 262500 -- (-2158.221) (-2157.298) [-2154.355] (-2155.534) * [-2156.582] (-2157.133) (-2158.498) (-2155.413) -- 0:01:10 263000 -- (-2158.817) [-2157.120] (-2156.779) (-2158.582) * (-2157.915) (-2159.811) [-2157.797] (-2156.803) -- 0:01:10 263500 -- (-2155.791) (-2155.380) [-2157.373] (-2156.575) * (-2156.908) [-2153.578] (-2158.229) (-2158.214) -- 0:01:12 264000 -- [-2157.915] (-2157.433) (-2156.225) (-2156.666) * [-2157.194] (-2157.669) (-2157.383) (-2158.243) -- 0:01:12 264500 -- (-2156.284) (-2158.878) (-2157.000) [-2157.832] * (-2158.098) (-2153.650) [-2157.676] (-2157.218) -- 0:01:12 265000 -- [-2157.335] (-2156.587) (-2160.770) (-2158.939) * (-2156.739) (-2164.607) (-2159.342) [-2156.600] -- 0:01:12 Average standard deviation of split frequencies: 0.014867 265500 -- (-2158.133) [-2161.859] (-2155.152) (-2155.438) * (-2156.608) [-2153.615] (-2161.262) (-2155.019) -- 0:01:11 266000 -- (-2156.077) (-2159.788) (-2159.138) [-2155.195] * (-2156.818) (-2156.899) (-2159.255) [-2155.013] -- 0:01:11 266500 -- (-2157.553) (-2160.393) (-2157.513) [-2155.650] * (-2155.902) [-2155.647] (-2157.014) (-2160.601) -- 0:01:11 267000 -- (-2158.614) (-2158.958) (-2156.855) [-2157.027] * (-2156.507) (-2156.424) [-2159.659] (-2157.946) -- 0:01:11 267500 -- (-2158.931) (-2157.534) (-2155.548) [-2160.082] * (-2163.023) (-2157.202) [-2157.100] (-2158.228) -- 0:01:11 268000 -- (-2159.271) (-2156.347) [-2153.182] (-2161.915) * (-2157.406) (-2154.687) [-2154.633] (-2158.009) -- 0:01:11 268500 -- (-2155.602) [-2155.960] (-2155.126) (-2157.702) * (-2157.544) (-2157.120) [-2157.984] (-2159.804) -- 0:01:10 269000 -- (-2155.767) (-2154.603) [-2157.095] (-2156.454) * (-2158.700) (-2158.816) [-2155.927] (-2157.975) -- 0:01:10 269500 -- [-2156.271] (-2155.504) (-2156.824) (-2159.058) * [-2156.972] (-2159.687) (-2153.637) (-2158.025) -- 0:01:10 270000 -- (-2156.969) (-2154.953) (-2158.364) [-2158.841] * (-2159.617) (-2158.602) [-2155.548] (-2157.829) -- 0:01:10 Average standard deviation of split frequencies: 0.014707 270500 -- (-2156.306) (-2156.762) [-2157.351] (-2159.162) * (-2163.465) (-2155.715) (-2153.483) [-2157.005] -- 0:01:10 271000 -- (-2159.237) (-2156.593) [-2156.198] (-2162.681) * (-2160.792) (-2155.135) [-2155.698] (-2156.942) -- 0:01:09 271500 -- [-2159.401] (-2158.158) (-2156.549) (-2157.771) * [-2157.991] (-2155.268) (-2156.800) (-2161.902) -- 0:01:09 272000 -- (-2159.311) [-2158.025] (-2158.721) (-2157.104) * (-2157.824) (-2156.206) [-2157.301] (-2156.259) -- 0:01:09 272500 -- (-2159.163) (-2157.806) (-2160.019) [-2156.670] * (-2159.018) (-2157.286) (-2156.516) [-2157.590] -- 0:01:09 273000 -- (-2160.704) [-2156.302] (-2157.133) (-2156.328) * (-2158.346) (-2160.808) (-2153.673) [-2159.078] -- 0:01:09 273500 -- (-2158.550) (-2156.951) [-2156.524] (-2155.382) * [-2157.970] (-2157.835) (-2154.747) (-2158.217) -- 0:01:11 274000 -- (-2159.692) (-2157.546) [-2158.727] (-2158.707) * (-2157.607) [-2154.110] (-2157.427) (-2159.128) -- 0:01:11 274500 -- (-2158.304) (-2157.605) [-2158.164] (-2162.264) * (-2159.721) [-2154.065] (-2158.749) (-2160.221) -- 0:01:11 275000 -- (-2158.799) (-2161.586) (-2155.702) [-2156.702] * [-2155.033] (-2157.700) (-2157.838) (-2157.628) -- 0:01:11 Average standard deviation of split frequencies: 0.013000 275500 -- (-2157.103) (-2160.274) (-2159.255) [-2160.546] * (-2160.500) (-2155.041) [-2156.811] (-2158.213) -- 0:01:11 276000 -- [-2157.329] (-2159.515) (-2158.715) (-2155.815) * (-2160.258) (-2156.172) [-2158.175] (-2161.912) -- 0:01:10 276500 -- (-2157.278) (-2161.649) [-2157.555] (-2157.147) * (-2156.459) (-2157.571) [-2158.429] (-2157.818) -- 0:01:10 277000 -- (-2156.927) (-2155.663) (-2154.229) [-2157.127] * (-2162.260) (-2157.746) [-2159.365] (-2156.878) -- 0:01:10 277500 -- (-2157.385) (-2154.343) (-2156.999) [-2157.933] * (-2160.876) [-2157.056] (-2161.366) (-2159.753) -- 0:01:10 278000 -- [-2159.777] (-2160.807) (-2158.931) (-2156.862) * (-2160.510) (-2156.444) (-2161.321) [-2154.031] -- 0:01:10 278500 -- [-2158.075] (-2158.209) (-2158.322) (-2157.325) * (-2159.327) [-2155.809] (-2159.209) (-2156.122) -- 0:01:09 279000 -- (-2156.149) [-2157.882] (-2159.330) (-2154.105) * [-2161.879] (-2158.837) (-2155.711) (-2157.094) -- 0:01:09 279500 -- (-2156.956) (-2158.801) (-2159.081) [-2157.167] * (-2158.304) (-2158.561) [-2160.245] (-2158.487) -- 0:01:09 280000 -- (-2156.625) (-2157.250) (-2159.447) [-2157.573] * (-2156.908) (-2161.225) [-2157.581] (-2156.612) -- 0:01:09 Average standard deviation of split frequencies: 0.013157 280500 -- (-2156.927) (-2156.412) (-2160.010) [-2156.960] * (-2154.830) (-2158.195) [-2156.072] (-2158.811) -- 0:01:09 281000 -- (-2157.199) [-2159.748] (-2156.286) (-2156.686) * [-2157.553] (-2157.111) (-2161.992) (-2159.383) -- 0:01:09 281500 -- [-2156.076] (-2158.793) (-2157.043) (-2155.266) * (-2156.056) (-2157.620) (-2160.191) [-2158.181] -- 0:01:08 282000 -- (-2156.692) [-2156.618] (-2156.919) (-2155.740) * (-2159.213) [-2158.069] (-2161.861) (-2159.239) -- 0:01:08 282500 -- [-2156.524] (-2156.328) (-2155.924) (-2157.740) * [-2156.501] (-2158.104) (-2157.257) (-2157.381) -- 0:01:08 283000 -- (-2158.439) [-2156.079] (-2157.210) (-2156.144) * (-2158.347) [-2157.983] (-2155.694) (-2157.035) -- 0:01:08 283500 -- (-2158.764) (-2155.802) (-2157.612) [-2156.047] * [-2158.522] (-2159.334) (-2157.347) (-2157.303) -- 0:01:08 284000 -- (-2157.681) (-2156.774) (-2160.991) [-2161.268] * [-2156.830] (-2161.179) (-2156.494) (-2157.308) -- 0:01:08 284500 -- [-2157.964] (-2158.105) (-2156.856) (-2158.445) * (-2155.695) (-2157.146) [-2157.661] (-2157.354) -- 0:01:10 285000 -- (-2158.317) (-2157.660) [-2157.863] (-2161.034) * (-2156.692) (-2158.229) (-2155.796) [-2157.545] -- 0:01:10 Average standard deviation of split frequencies: 0.011538 285500 -- (-2155.138) (-2158.423) [-2156.934] (-2160.760) * (-2157.236) (-2157.600) (-2159.520) [-2157.378] -- 0:01:10 286000 -- (-2163.562) [-2159.594] (-2158.139) (-2158.436) * [-2156.376] (-2158.346) (-2156.095) (-2156.720) -- 0:01:09 286500 -- (-2157.964) (-2154.755) [-2155.560] (-2158.639) * [-2156.596] (-2155.921) (-2158.092) (-2157.251) -- 0:01:09 287000 -- (-2158.560) [-2156.459] (-2156.862) (-2158.997) * [-2156.706] (-2157.065) (-2160.104) (-2158.714) -- 0:01:09 287500 -- (-2160.567) [-2156.931] (-2156.394) (-2156.318) * (-2157.049) (-2157.830) (-2157.795) [-2158.557] -- 0:01:09 288000 -- (-2160.372) [-2156.940] (-2155.232) (-2157.418) * (-2158.717) (-2156.438) [-2158.104] (-2155.603) -- 0:01:09 288500 -- [-2160.149] (-2158.271) (-2156.343) (-2157.162) * (-2162.214) [-2156.019] (-2157.169) (-2156.020) -- 0:01:09 289000 -- (-2159.794) (-2158.821) [-2156.301] (-2159.062) * (-2157.357) [-2156.855] (-2159.236) (-2156.451) -- 0:01:08 289500 -- [-2156.344] (-2157.283) (-2156.700) (-2161.806) * (-2157.404) (-2156.957) [-2158.792] (-2156.946) -- 0:01:08 290000 -- (-2156.558) (-2156.583) [-2156.705] (-2162.810) * (-2160.554) (-2157.047) (-2157.373) [-2154.920] -- 0:01:08 Average standard deviation of split frequencies: 0.011609 290500 -- (-2161.207) (-2157.445) [-2156.350] (-2164.105) * (-2155.328) (-2157.054) (-2157.609) [-2154.868] -- 0:01:08 291000 -- (-2161.096) (-2157.273) [-2154.167] (-2158.276) * (-2163.929) (-2157.814) (-2157.593) [-2157.739] -- 0:01:08 291500 -- (-2157.798) (-2162.064) (-2156.075) [-2157.195] * (-2157.706) (-2155.412) (-2158.239) [-2165.192] -- 0:01:08 292000 -- [-2160.268] (-2161.919) (-2158.406) (-2158.347) * [-2156.787] (-2154.124) (-2158.239) (-2161.619) -- 0:01:07 292500 -- (-2157.933) (-2158.228) (-2159.011) [-2158.612] * (-2157.676) [-2156.018] (-2161.426) (-2162.119) -- 0:01:07 293000 -- (-2159.994) (-2158.821) [-2160.890] (-2155.964) * (-2159.077) (-2158.075) (-2157.662) [-2153.280] -- 0:01:07 293500 -- (-2158.915) (-2157.985) (-2158.183) [-2156.448] * (-2157.054) (-2158.867) (-2159.545) [-2156.047] -- 0:01:07 294000 -- (-2160.345) (-2156.778) [-2155.131] (-2156.342) * (-2156.692) (-2163.617) (-2156.984) [-2157.208] -- 0:01:07 294500 -- (-2160.011) [-2161.854] (-2158.442) (-2157.888) * (-2159.820) (-2155.208) [-2159.892] (-2164.234) -- 0:01:07 295000 -- (-2159.006) (-2161.819) [-2158.894] (-2156.490) * (-2157.076) (-2156.068) [-2159.635] (-2162.569) -- 0:01:06 Average standard deviation of split frequencies: 0.011502 295500 -- [-2159.747] (-2156.745) (-2156.271) (-2157.267) * (-2158.088) (-2155.619) (-2157.222) [-2156.261] -- 0:01:09 296000 -- (-2157.400) [-2157.412] (-2156.805) (-2159.145) * (-2157.624) (-2158.699) [-2162.990] (-2160.140) -- 0:01:08 296500 -- [-2157.921] (-2157.169) (-2154.764) (-2158.635) * (-2157.537) [-2156.633] (-2159.543) (-2156.392) -- 0:01:08 297000 -- (-2157.979) (-2157.259) (-2156.676) [-2157.891] * [-2157.043] (-2158.700) (-2156.028) (-2157.179) -- 0:01:08 297500 -- (-2161.929) (-2157.976) [-2157.228] (-2156.836) * (-2157.085) (-2158.841) [-2154.996] (-2157.345) -- 0:01:08 298000 -- (-2158.875) [-2153.499] (-2157.006) (-2157.705) * (-2157.895) (-2157.299) (-2158.106) [-2157.502] -- 0:01:08 298500 -- (-2155.487) (-2159.114) [-2157.613] (-2157.178) * (-2158.759) [-2153.271] (-2157.688) (-2158.519) -- 0:01:08 299000 -- [-2157.810] (-2159.461) (-2157.255) (-2157.664) * (-2156.588) [-2157.263] (-2158.221) (-2157.187) -- 0:01:07 299500 -- (-2154.115) (-2161.924) (-2158.021) [-2157.173] * (-2157.083) [-2156.235] (-2153.322) (-2159.015) -- 0:01:07 300000 -- (-2160.286) (-2160.632) (-2156.817) [-2157.005] * (-2158.305) (-2157.356) [-2154.908] (-2156.864) -- 0:01:07 Average standard deviation of split frequencies: 0.010975 300500 -- [-2157.578] (-2159.068) (-2159.523) (-2155.293) * (-2157.582) [-2158.729] (-2157.921) (-2156.592) -- 0:01:07 301000 -- [-2154.972] (-2159.901) (-2156.236) (-2156.057) * (-2158.192) (-2158.184) [-2158.500] (-2159.106) -- 0:01:07 301500 -- [-2159.364] (-2160.008) (-2161.101) (-2160.020) * (-2164.960) [-2157.387] (-2156.303) (-2158.512) -- 0:01:07 302000 -- (-2157.298) (-2159.955) (-2159.640) [-2156.895] * (-2161.423) [-2157.066] (-2158.046) (-2157.320) -- 0:01:07 302500 -- [-2157.827] (-2157.399) (-2156.869) (-2158.149) * (-2161.853) (-2155.488) [-2157.279] (-2158.010) -- 0:01:06 303000 -- (-2156.790) (-2157.800) [-2158.020] (-2156.470) * [-2155.837] (-2155.885) (-2159.495) (-2156.242) -- 0:01:06 303500 -- (-2158.879) (-2157.137) [-2158.107] (-2157.976) * (-2156.719) (-2155.450) [-2156.452] (-2156.634) -- 0:01:06 304000 -- (-2156.779) (-2157.140) [-2159.207] (-2157.636) * (-2157.531) (-2155.399) (-2155.656) [-2156.158] -- 0:01:06 304500 -- (-2158.925) [-2157.149] (-2156.325) (-2155.690) * (-2157.504) (-2156.185) (-2157.233) [-2158.120] -- 0:01:06 305000 -- (-2158.663) (-2158.529) (-2155.420) [-2155.511] * (-2158.186) (-2155.486) (-2161.313) [-2156.879] -- 0:01:06 Average standard deviation of split frequencies: 0.011270 305500 -- (-2159.486) (-2158.387) (-2156.154) [-2156.539] * (-2157.056) (-2158.580) [-2155.876] (-2156.167) -- 0:01:05 306000 -- (-2159.589) (-2159.948) [-2160.596] (-2156.212) * (-2157.911) (-2155.454) [-2157.197] (-2158.189) -- 0:01:05 306500 -- (-2157.167) (-2160.417) [-2161.254] (-2155.220) * (-2157.870) (-2157.700) (-2156.557) [-2156.834] -- 0:01:07 307000 -- (-2158.056) [-2156.053] (-2161.113) (-2159.221) * [-2157.826] (-2153.989) (-2159.282) (-2159.000) -- 0:01:07 307500 -- (-2157.321) (-2157.522) [-2155.629] (-2158.968) * (-2157.043) [-2157.510] (-2158.780) (-2158.012) -- 0:01:07 308000 -- (-2156.515) [-2156.932] (-2159.620) (-2159.223) * [-2154.551] (-2156.782) (-2158.040) (-2157.577) -- 0:01:07 308500 -- (-2156.513) (-2159.691) (-2156.359) [-2158.457] * [-2157.068] (-2158.345) (-2157.308) (-2157.580) -- 0:01:07 309000 -- (-2156.262) (-2156.169) (-2158.091) [-2156.274] * [-2157.161] (-2159.968) (-2158.774) (-2156.787) -- 0:01:07 309500 -- (-2155.465) [-2157.493] (-2157.897) (-2157.055) * (-2157.266) [-2157.509] (-2155.526) (-2158.271) -- 0:01:06 310000 -- (-2157.375) [-2156.483] (-2157.203) (-2159.154) * (-2158.096) [-2160.034] (-2156.265) (-2157.341) -- 0:01:06 Average standard deviation of split frequencies: 0.012059 310500 -- (-2157.335) [-2156.370] (-2156.801) (-2158.545) * (-2157.614) (-2161.834) [-2156.478] (-2157.169) -- 0:01:06 311000 -- (-2157.252) (-2157.151) (-2157.318) [-2157.904] * (-2158.182) (-2160.886) (-2155.473) [-2158.467] -- 0:01:06 311500 -- (-2157.925) [-2160.338] (-2156.432) (-2156.689) * (-2157.948) (-2155.915) (-2158.921) [-2156.432] -- 0:01:06 312000 -- (-2155.903) (-2159.453) [-2159.156] (-2157.942) * (-2157.282) [-2156.664] (-2160.622) (-2158.997) -- 0:01:06 312500 -- (-2158.205) (-2156.451) (-2156.891) [-2157.216] * (-2160.832) (-2156.525) [-2157.476] (-2157.226) -- 0:01:06 313000 -- (-2158.113) (-2159.949) [-2154.207] (-2157.306) * [-2159.006] (-2155.841) (-2155.931) (-2156.780) -- 0:01:05 313500 -- (-2157.173) (-2154.317) (-2155.566) [-2158.676] * [-2156.152] (-2161.689) (-2158.264) (-2161.881) -- 0:01:05 314000 -- (-2157.939) (-2154.823) (-2157.918) [-2160.405] * (-2157.717) (-2160.644) [-2157.636] (-2157.342) -- 0:01:05 314500 -- (-2157.418) (-2157.135) [-2155.342] (-2156.702) * [-2157.851] (-2160.439) (-2154.989) (-2157.175) -- 0:01:05 315000 -- (-2156.985) [-2155.029] (-2158.216) (-2156.851) * [-2156.594] (-2156.854) (-2158.222) (-2156.894) -- 0:01:05 Average standard deviation of split frequencies: 0.011188 315500 -- (-2156.837) (-2159.505) [-2158.609] (-2158.036) * [-2156.157] (-2155.781) (-2160.158) (-2155.369) -- 0:01:05 316000 -- (-2158.013) (-2158.035) [-2157.501] (-2157.681) * (-2156.070) (-2158.135) (-2158.997) [-2154.330] -- 0:01:04 316500 -- (-2157.189) (-2156.952) [-2158.262] (-2158.480) * (-2157.085) (-2157.422) [-2158.835] (-2156.829) -- 0:01:04 317000 -- (-2158.031) (-2158.917) [-2157.707] (-2157.449) * (-2157.071) (-2156.361) (-2158.171) [-2158.104] -- 0:01:04 317500 -- (-2160.786) [-2159.836] (-2156.779) (-2158.784) * [-2158.865] (-2157.348) (-2159.177) (-2159.410) -- 0:01:06 318000 -- [-2159.227] (-2159.185) (-2157.241) (-2157.519) * (-2160.376) (-2156.821) [-2158.106] (-2156.692) -- 0:01:06 318500 -- [-2158.243] (-2157.520) (-2156.030) (-2156.683) * (-2158.341) (-2156.325) [-2154.977] (-2159.599) -- 0:01:06 319000 -- (-2158.332) [-2157.396] (-2153.961) (-2159.259) * (-2157.788) (-2161.728) (-2158.189) [-2160.167] -- 0:01:06 319500 -- [-2155.865] (-2156.966) (-2158.019) (-2158.601) * [-2156.963] (-2158.325) (-2156.327) (-2159.854) -- 0:01:06 320000 -- (-2156.907) (-2157.674) (-2157.155) [-2156.206] * (-2158.667) (-2154.894) [-2157.417] (-2159.244) -- 0:01:05 Average standard deviation of split frequencies: 0.010862 320500 -- [-2160.588] (-2157.437) (-2159.425) (-2156.989) * (-2157.408) (-2157.921) (-2157.060) [-2156.904] -- 0:01:05 321000 -- (-2159.387) [-2159.708] (-2158.281) (-2157.123) * (-2157.215) (-2155.775) [-2155.462] (-2158.380) -- 0:01:05 321500 -- (-2156.055) (-2158.261) (-2155.357) [-2160.093] * [-2157.215] (-2154.135) (-2155.696) (-2157.845) -- 0:01:05 322000 -- (-2158.441) [-2157.571] (-2156.407) (-2158.755) * (-2159.035) [-2157.645] (-2157.303) (-2156.782) -- 0:01:05 322500 -- (-2156.823) [-2158.861] (-2157.074) (-2159.103) * (-2157.992) [-2158.444] (-2154.403) (-2159.453) -- 0:01:05 323000 -- [-2157.160] (-2159.326) (-2158.170) (-2156.813) * [-2160.321] (-2159.747) (-2156.698) (-2160.325) -- 0:01:04 323500 -- [-2154.226] (-2157.313) (-2157.618) (-2157.185) * (-2161.342) (-2154.843) (-2158.041) [-2153.610] -- 0:01:04 324000 -- [-2158.717] (-2159.100) (-2157.340) (-2157.299) * (-2160.250) [-2154.817] (-2157.894) (-2156.834) -- 0:01:04 324500 -- [-2158.499] (-2159.394) (-2160.625) (-2156.799) * (-2161.123) [-2156.820] (-2158.780) (-2159.233) -- 0:01:04 325000 -- (-2157.142) (-2157.955) (-2157.276) [-2156.799] * (-2158.143) (-2154.846) (-2154.647) [-2156.545] -- 0:01:04 Average standard deviation of split frequencies: 0.010046 325500 -- [-2158.010] (-2156.556) (-2157.220) (-2156.743) * (-2160.409) (-2160.962) (-2156.215) [-2157.643] -- 0:01:04 326000 -- [-2157.475] (-2156.664) (-2156.505) (-2157.338) * [-2156.294] (-2156.721) (-2156.521) (-2157.631) -- 0:01:04 326500 -- (-2157.156) (-2157.895) (-2159.619) [-2158.935] * [-2157.142] (-2156.770) (-2156.530) (-2159.154) -- 0:01:03 327000 -- (-2153.853) (-2158.604) [-2157.983] (-2157.946) * (-2159.485) (-2154.484) (-2160.908) [-2158.242] -- 0:01:03 327500 -- (-2157.273) (-2158.516) [-2155.451] (-2158.323) * (-2163.236) [-2157.170] (-2157.001) (-2154.466) -- 0:01:03 328000 -- [-2157.294] (-2157.687) (-2157.375) (-2157.092) * (-2155.306) (-2161.339) [-2156.646] (-2156.282) -- 0:01:03 328500 -- (-2159.668) (-2157.447) [-2159.775] (-2157.967) * [-2152.874] (-2159.586) (-2157.632) (-2154.795) -- 0:01:03 329000 -- (-2157.184) (-2159.642) (-2155.121) [-2157.636] * (-2159.395) [-2155.370] (-2159.723) (-2155.051) -- 0:01:05 329500 -- (-2157.393) (-2157.798) (-2157.024) [-2158.167] * [-2158.525] (-2158.193) (-2158.751) (-2161.175) -- 0:01:05 330000 -- (-2158.400) (-2157.429) [-2158.976] (-2160.672) * (-2160.863) (-2156.701) [-2159.134] (-2159.949) -- 0:01:04 Average standard deviation of split frequencies: 0.009821 330500 -- (-2159.692) [-2157.933] (-2157.476) (-2157.812) * (-2157.626) (-2158.102) (-2158.853) [-2161.910] -- 0:01:04 331000 -- (-2159.001) (-2160.956) (-2158.252) [-2157.627] * (-2156.894) (-2159.737) [-2158.715] (-2156.588) -- 0:01:04 331500 -- (-2155.517) (-2160.201) (-2159.368) [-2154.974] * (-2157.245) (-2160.949) [-2158.987] (-2156.171) -- 0:01:04 332000 -- (-2157.181) (-2157.061) (-2157.147) [-2157.945] * (-2157.551) (-2160.110) (-2158.067) [-2157.567] -- 0:01:04 332500 -- (-2157.330) (-2157.065) [-2157.313] (-2159.102) * (-2159.954) (-2157.825) (-2156.675) [-2156.402] -- 0:01:04 333000 -- (-2156.728) (-2155.837) (-2157.417) [-2156.139] * [-2157.857] (-2156.596) (-2155.863) (-2159.358) -- 0:01:04 333500 -- [-2158.032] (-2157.243) (-2157.682) (-2156.630) * [-2157.590] (-2155.137) (-2159.507) (-2161.333) -- 0:01:03 334000 -- (-2158.481) [-2158.847] (-2156.686) (-2159.466) * [-2156.105] (-2157.589) (-2159.389) (-2154.965) -- 0:01:03 334500 -- [-2157.790] (-2155.958) (-2159.487) (-2159.635) * (-2157.657) (-2158.809) [-2157.822] (-2156.932) -- 0:01:03 335000 -- (-2158.925) [-2157.566] (-2157.506) (-2157.582) * (-2157.262) [-2160.970] (-2160.018) (-2157.043) -- 0:01:03 Average standard deviation of split frequencies: 0.008886 335500 -- (-2158.569) (-2158.321) [-2156.395] (-2157.682) * (-2155.352) [-2157.546] (-2161.245) (-2161.025) -- 0:01:03 3