--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 10:34:17 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/1res/dnaK/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/1res/dnaK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/dnaK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/dnaK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2545.61 -2549.23 2 -2545.62 -2549.69 -------------------------------------- TOTAL -2545.62 -2549.48 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/dnaK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/dnaK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/dnaK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.895997 0.089318 0.379236 1.504940 0.863534 1289.73 1377.17 1.000 r(A<->C){all} 0.166015 0.019701 0.000023 0.444440 0.127469 193.98 213.09 1.000 r(A<->G){all} 0.153015 0.017182 0.000090 0.406863 0.119000 143.99 157.90 1.000 r(A<->T){all} 0.169787 0.021707 0.000123 0.467004 0.130715 226.43 249.22 1.001 r(C<->G){all} 0.178993 0.021493 0.000057 0.470325 0.142620 180.56 263.64 1.009 r(C<->T){all} 0.169114 0.019487 0.000001 0.447578 0.133547 188.12 201.42 1.010 r(G<->T){all} 0.163076 0.019416 0.000003 0.441952 0.125749 243.53 291.29 1.000 pi(A){all} 0.225833 0.000092 0.206505 0.244540 0.225776 1400.71 1434.30 1.002 pi(C){all} 0.281419 0.000105 0.262396 0.301929 0.281469 1116.36 1277.82 1.000 pi(G){all} 0.307652 0.000108 0.287397 0.329184 0.307560 1006.20 1111.62 1.000 pi(T){all} 0.185097 0.000084 0.166874 0.202951 0.185046 1156.09 1248.95 1.001 alpha{1,2} 0.424043 0.235994 0.000129 1.396361 0.257899 817.80 1046.02 1.002 alpha{3} 0.458148 0.253756 0.000163 1.472555 0.292692 1141.62 1200.06 1.001 pinvar{all} 0.999200 0.000001 0.997364 0.999999 0.999524 1065.44 1114.40 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2384.554867 Model 2: PositiveSelection -2384.554867 Model 0: one-ratio -2384.554868 Model 7: beta -2384.555164 Model 8: beta&w>1 -2384.555956 Model 0 vs 1 2.0000006770715117E-6 Model 2 vs 1 0.0 Model 8 vs 7 0.001584000000548258
>C1 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG SNSTDDVVDAEVVDDERESK >C2 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG SNSTDDVVDAEVVDDERESK >C3 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG SNSTDDVVDAEVVDDERESK >C4 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG SNSTDDVVDAEVVDDERESK >C5 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG SNSTDDVVDAEVVDDERESK >C6 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG SNSTDDVVDAEVVDDERESK CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=620 C1 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV C2 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV C3 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV C4 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV C5 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV C6 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV ************************************************** C1 GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK C2 GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK C3 GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK C4 GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK C5 GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK C6 GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK ************************************************** C1 RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA C2 RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA C3 RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA C4 RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA C5 RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA C6 RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA ************************************************** C1 AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG C2 AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG C3 AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG C4 AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG C5 AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG C6 AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG ************************************************** C1 GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS C2 GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS C3 GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS C4 GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS C5 GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS C6 GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS ************************************************** C1 TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA C2 TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA C3 TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA C4 TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA C5 TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA C6 TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA ************************************************** C1 GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA C2 GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA C3 GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA C4 GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA C5 GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA C6 GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA ************************************************** C1 LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF C2 LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF C3 LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF C4 LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF C5 LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF C6 LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF ************************************************** C1 TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF C2 TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF C3 TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF C4 TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF C5 TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF C6 TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF ************************************************** C1 DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED C2 DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED C3 DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED C4 DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED C5 DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED C6 DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED ************************************************** C1 RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE C2 RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE C3 RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE C4 RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE C5 RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE C6 RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE ************************************************** C1 AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG C2 AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG C3 AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG C4 AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG C5 AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG C6 AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG ************************************************** C1 SNSTDDVVDAEVVDDERESK C2 SNSTDDVVDAEVVDDERESK C3 SNSTDDVVDAEVVDDERESK C4 SNSTDDVVDAEVVDDERESK C5 SNSTDDVVDAEVVDDERESK C6 SNSTDDVVDAEVVDDERESK ******************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 620 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 620 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [18600] Library Relaxation: Multi_proc [96] Relaxation Summary: [18600]--->[18600] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.592 Mb, Max= 31.241 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV C2 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV C3 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV C4 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV C5 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV C6 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV ************************************************** C1 GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK C2 GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK C3 GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK C4 GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK C5 GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK C6 GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK ************************************************** C1 RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA C2 RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA C3 RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA C4 RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA C5 RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA C6 RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA ************************************************** C1 AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG C2 AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG C3 AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG C4 AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG C5 AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG C6 AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG ************************************************** C1 GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS C2 GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS C3 GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS C4 GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS C5 GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS C6 GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS ************************************************** C1 TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA C2 TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA C3 TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA C4 TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA C5 TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA C6 TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA ************************************************** C1 GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA C2 GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA C3 GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA C4 GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA C5 GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA C6 GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA ************************************************** C1 LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF C2 LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF C3 LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF C4 LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF C5 LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF C6 LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF ************************************************** C1 TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF C2 TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF C3 TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF C4 TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF C5 TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF C6 TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF ************************************************** C1 DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED C2 DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED C3 DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED C4 DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED C5 DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED C6 DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED ************************************************** C1 RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE C2 RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE C3 RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE C4 RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE C5 RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE C6 RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE ************************************************** C1 AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG C2 AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG C3 AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG C4 AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG C5 AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG C6 AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG ************************************************** C1 SNSTDDVVDAEVVDDERESK C2 SNSTDDVVDAEVVDDERESK C3 SNSTDDVVDAEVVDDERESK C4 SNSTDDVVDAEVVDDERESK C5 SNSTDDVVDAEVVDDERESK C6 SNSTDDVVDAEVVDDERESK ******************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGCTCGTGCGGTCGGCATCGACCTCGGGACCACCAACTCCGTCGTCTC C2 ATGGCTCGTGCGGTCGGCATCGACCTCGGGACCACCAACTCCGTCGTCTC C3 ATGGCTCGTGCGGTCGGCATCGACCTCGGGACCACCAACTCCGTCGTCTC C4 ATGGCTCGTGCGGTCGGCATCGACCTCGGGACCACCAACTCCGTCGTCTC C5 ATGGCTCGTGCGGTCGGCATCGACCTCGGGACCACCAACTCCGTCGTCTC C6 ATGGCTCGTGCGGTCGGCATCGACCTCGGGACCACCAACTCCGTCGTCTC ************************************************** C1 CGTTCTGGAGGGTGGCGACCCCGTCGTCGTTGCCAACTCCGAGGGGTCGA C2 CGTTCTGGAGGGTGGCGACCCCGTCGTCGTTGCCAACTCCGAGGGGTCGA C3 CGTTCTGGAGGGTGGCGACCCCGTCGTCGTTGCCAACTCCGAGGGGTCGA C4 CGTTCTGGAGGGTGGCGACCCCGTCGTCGTTGCCAACTCCGAGGGGTCGA C5 CGTTCTGGAGGGTGGCGACCCCGTCGTCGTTGCCAACTCCGAGGGGTCGA C6 CGTTCTGGAGGGTGGCGACCCCGTCGTCGTTGCCAACTCCGAGGGGTCGA ************************************************** C1 GGACCACTCCGTCAACTGTCGCGTTCGCGCGTAACGGCGAGGTTCTCGTC C2 GGACCACTCCGTCAACTGTCGCGTTCGCGCGTAACGGCGAGGTTCTCGTC C3 GGACCACTCCGTCAACTGTCGCGTTCGCGCGTAACGGCGAGGTTCTCGTC C4 GGACCACTCCGTCAACTGTCGCGTTCGCGCGTAACGGCGAGGTTCTCGTC C5 GGACCACTCCGTCAACTGTCGCGTTCGCGCGTAACGGCGAGGTTCTCGTC C6 GGACCACTCCGTCAACTGTCGCGTTCGCGCGTAACGGCGAGGTTCTCGTC ************************************************** C1 GGCCAACCCGCCAAAAACCAGGCGGTTACTAACGTCGACCGCACCATCCG C2 GGCCAACCCGCCAAAAACCAGGCGGTTACTAACGTCGACCGCACCATCCG C3 GGCCAACCCGCCAAAAACCAGGCGGTTACTAACGTCGACCGCACCATCCG C4 GGCCAACCCGCCAAAAACCAGGCGGTTACTAACGTCGACCGCACCATCCG C5 GGCCAACCCGCCAAAAACCAGGCGGTTACTAACGTCGACCGCACCATCCG C6 GGCCAACCCGCCAAAAACCAGGCGGTTACTAACGTCGACCGCACCATCCG ************************************************** C1 GTCTGTCAAACGGCACATGGGCAGTGACTGGTCCATCGAAATCGACGGCA C2 GTCTGTCAAACGGCACATGGGCAGTGACTGGTCCATCGAAATCGACGGCA C3 GTCTGTCAAACGGCACATGGGCAGTGACTGGTCCATCGAAATCGACGGCA C4 GTCTGTCAAACGGCACATGGGCAGTGACTGGTCCATCGAAATCGACGGCA C5 GTCTGTCAAACGGCACATGGGCAGTGACTGGTCCATCGAAATCGACGGCA C6 GTCTGTCAAACGGCACATGGGCAGTGACTGGTCCATCGAAATCGACGGCA ************************************************** C1 AAAAATACACCGCGCAGGAGATCAGCGCCCGCGTTCTGATGAAGCTGAAG C2 AAAAATACACCGCGCAGGAGATCAGCGCCCGCGTTCTGATGAAGCTGAAG C3 AAAAATACACCGCGCAGGAGATCAGCGCCCGCGTTCTGATGAAGCTGAAG C4 AAAAATACACCGCGCAGGAGATCAGCGCCCGCGTTCTGATGAAGCTGAAG C5 AAAAATACACCGCGCAGGAGATCAGCGCCCGCGTTCTGATGAAGCTGAAG C6 AAAAATACACCGCGCAGGAGATCAGCGCCCGCGTTCTGATGAAGCTGAAG ************************************************** C1 AGGGACGCTGAGGCTTACCTCGGTGAGGACATCACCGATGCAGTCATCAC C2 AGGGACGCTGAGGCTTACCTCGGTGAGGACATCACCGATGCAGTCATCAC C3 AGGGACGCTGAGGCTTACCTCGGTGAGGACATCACCGATGCAGTCATCAC C4 AGGGACGCTGAGGCTTACCTCGGTGAGGACATCACCGATGCAGTCATCAC C5 AGGGACGCTGAGGCTTACCTCGGTGAGGACATCACCGATGCAGTCATCAC C6 AGGGACGCTGAGGCTTACCTCGGTGAGGACATCACCGATGCAGTCATCAC ************************************************** C1 CACACCAGCCTACTTTAACGACGCCCAGCGTCAGGCTACCAAGGAAGCCG C2 CACACCAGCCTACTTTAACGACGCCCAGCGTCAGGCTACCAAGGAAGCCG C3 CACACCAGCCTACTTTAACGACGCCCAGCGTCAGGCTACCAAGGAAGCCG C4 CACACCAGCCTACTTTAACGACGCCCAGCGTCAGGCTACCAAGGAAGCCG C5 CACACCAGCCTACTTTAACGACGCCCAGCGTCAGGCTACCAAGGAAGCCG C6 CACACCAGCCTACTTTAACGACGCCCAGCGTCAGGCTACCAAGGAAGCCG ************************************************** C1 GCCAGATCGCCGGTTTAAACGTACTGCGTATTGTCAACGAGCCGACCGCC C2 GCCAGATCGCCGGTTTAAACGTACTGCGTATTGTCAACGAGCCGACCGCC C3 GCCAGATCGCCGGTTTAAACGTACTGCGTATTGTCAACGAGCCGACCGCC C4 GCCAGATCGCCGGTTTAAACGTACTGCGTATTGTCAACGAGCCGACCGCC C5 GCCAGATCGCCGGTTTAAACGTACTGCGTATTGTCAACGAGCCGACCGCC C6 GCCAGATCGCCGGTTTAAACGTACTGCGTATTGTCAACGAGCCGACCGCC ************************************************** C1 GCCGCTCTGGCCTACGGTCTAGACAAGGGTGAGAGAGAACAAACCATCCT C2 GCCGCTCTGGCCTACGGTCTAGACAAGGGTGAGAGAGAACAAACCATCCT C3 GCCGCTCTGGCCTACGGTCTAGACAAGGGTGAGAGAGAACAAACCATCCT C4 GCCGCTCTGGCCTACGGTCTAGACAAGGGTGAGAGAGAACAAACCATCCT C5 GCCGCTCTGGCCTACGGTCTAGACAAGGGTGAGAGAGAACAAACCATCCT C6 GCCGCTCTGGCCTACGGTCTAGACAAGGGTGAGAGAGAACAAACCATCCT ************************************************** C1 GGTGTTCGATCTGGGTGGCGGCACCTTCGATGTTTCGTTGCTGGAAATCG C2 GGTGTTCGATCTGGGTGGCGGCACCTTCGATGTTTCGTTGCTGGAAATCG C3 GGTGTTCGATCTGGGTGGCGGCACCTTCGATGTTTCGTTGCTGGAAATCG C4 GGTGTTCGATCTGGGTGGCGGCACCTTCGATGTTTCGTTGCTGGAAATCG C5 GGTGTTCGATCTGGGTGGCGGCACCTTCGATGTTTCGTTGCTGGAAATCG C6 GGTGTTCGATCTGGGTGGCGGCACCTTCGATGTTTCGTTGCTGGAAATCG ************************************************** C1 GCGAGGGCGTGGTCGAAGTGCGTGCCACCAGCGGTGACAATCACCTCGGT C2 GCGAGGGCGTGGTCGAAGTGCGTGCCACCAGCGGTGACAATCACCTCGGT C3 GCGAGGGCGTGGTCGAAGTGCGTGCCACCAGCGGTGACAATCACCTCGGT C4 GCGAGGGCGTGGTCGAAGTGCGTGCCACCAGCGGTGACAATCACCTCGGT C5 GCGAGGGCGTGGTCGAAGTGCGTGCCACCAGCGGTGACAATCACCTCGGT C6 GCGAGGGCGTGGTCGAAGTGCGTGCCACCAGCGGTGACAATCACCTCGGT ************************************************** C1 GGCGACGATTGGGACGACCGTATTGTCAACTGGCTCGTCGACAAGTTCAA C2 GGCGACGATTGGGACGACCGTATTGTCAACTGGCTCGTCGACAAGTTCAA C3 GGCGACGATTGGGACGACCGTATTGTCAACTGGCTCGTCGACAAGTTCAA C4 GGCGACGATTGGGACGACCGTATTGTCAACTGGCTCGTCGACAAGTTCAA C5 GGCGACGATTGGGACGACCGTATTGTCAACTGGCTCGTCGACAAGTTCAA C6 GGCGACGATTGGGACGACCGTATTGTCAACTGGCTCGTCGACAAGTTCAA ************************************************** C1 GGGCACTAGCGGTATCGATCTGACCAAGGACAAGATGGCTATGCAGCGGC C2 GGGCACTAGCGGTATCGATCTGACCAAGGACAAGATGGCTATGCAGCGGC C3 GGGCACTAGCGGTATCGATCTGACCAAGGACAAGATGGCTATGCAGCGGC C4 GGGCACTAGCGGTATCGATCTGACCAAGGACAAGATGGCTATGCAGCGGC C5 GGGCACTAGCGGTATCGATCTGACCAAGGACAAGATGGCTATGCAGCGGC C6 GGGCACTAGCGGTATCGATCTGACCAAGGACAAGATGGCTATGCAGCGGC ************************************************** C1 TACGTGAGGCTGCCGAGAAGGCCAAGATCGAGCTCAGCTCGAGCCAAAGC C2 TACGTGAGGCTGCCGAGAAGGCCAAGATCGAGCTCAGCTCGAGCCAAAGC C3 TACGTGAGGCTGCCGAGAAGGCCAAGATCGAGCTCAGCTCGAGCCAAAGC C4 TACGTGAGGCTGCCGAGAAGGCCAAGATCGAGCTCAGCTCGAGCCAAAGC C5 TACGTGAGGCTGCCGAGAAGGCCAAGATCGAGCTCAGCTCGAGCCAAAGC C6 TACGTGAGGCTGCCGAGAAGGCCAAGATCGAGCTCAGCTCGAGCCAAAGC ************************************************** C1 ACCTCGGTTAACTTGCCCTACATTACCGTCGATTCAGACAAGAACCCGCT C2 ACCTCGGTTAACTTGCCCTACATTACCGTCGATTCAGACAAGAACCCGCT C3 ACCTCGGTTAACTTGCCCTACATTACCGTCGATTCAGACAAGAACCCGCT C4 ACCTCGGTTAACTTGCCCTACATTACCGTCGATTCAGACAAGAACCCGCT C5 ACCTCGGTTAACTTGCCCTACATTACCGTCGATTCAGACAAGAACCCGCT C6 ACCTCGGTTAACTTGCCCTACATTACCGTCGATTCAGACAAGAACCCGCT ************************************************** C1 ATTCCTTGACGAGCAGCTTATTCGCGCCGAATTCCAACGCATCACCCAGG C2 ATTCCTTGACGAGCAGCTTATTCGCGCCGAATTCCAACGCATCACCCAGG C3 ATTCCTTGACGAGCAGCTTATTCGCGCCGAATTCCAACGCATCACCCAGG C4 ATTCCTTGACGAGCAGCTTATTCGCGCCGAATTCCAACGCATCACCCAGG C5 ATTCCTTGACGAGCAGCTTATTCGCGCCGAATTCCAACGCATCACCCAGG C6 ATTCCTTGACGAGCAGCTTATTCGCGCCGAATTCCAACGCATCACCCAGG ************************************************** C1 ATTTGCTGGACCGCACCCGTCAGCCGTTCCAGTCGGTGGTCAAGGACGCC C2 ATTTGCTGGACCGCACCCGTCAGCCGTTCCAGTCGGTGGTCAAGGACGCC C3 ATTTGCTGGACCGCACCCGTCAGCCGTTCCAGTCGGTGGTCAAGGACGCC C4 ATTTGCTGGACCGCACCCGTCAGCCGTTCCAGTCGGTGGTCAAGGACGCC C5 ATTTGCTGGACCGCACCCGTCAGCCGTTCCAGTCGGTGGTCAAGGACGCC C6 ATTTGCTGGACCGCACCCGTCAGCCGTTCCAGTCGGTGGTCAAGGACGCC ************************************************** C1 GGTATTTCGGTTTCTGAGATCGATCACGTCGTGCTGGTGGGCGGTTCGAC C2 GGTATTTCGGTTTCTGAGATCGATCACGTCGTGCTGGTGGGCGGTTCGAC C3 GGTATTTCGGTTTCTGAGATCGATCACGTCGTGCTGGTGGGCGGTTCGAC C4 GGTATTTCGGTTTCTGAGATCGATCACGTCGTGCTGGTGGGCGGTTCGAC C5 GGTATTTCGGTTTCTGAGATCGATCACGTCGTGCTGGTGGGCGGTTCGAC C6 GGTATTTCGGTTTCTGAGATCGATCACGTCGTGCTGGTGGGCGGTTCGAC ************************************************** C1 CCGGATGCCTGCGGTGACCGATCTTGTCAAGGAACTCACTGGTGGCAAGG C2 CCGGATGCCTGCGGTGACCGATCTTGTCAAGGAACTCACTGGTGGCAAGG C3 CCGGATGCCTGCGGTGACCGATCTTGTCAAGGAACTCACTGGTGGCAAGG C4 CCGGATGCCTGCGGTGACCGATCTTGTCAAGGAACTCACTGGTGGCAAGG C5 CCGGATGCCTGCGGTGACCGATCTTGTCAAGGAACTCACTGGTGGCAAGG C6 CCGGATGCCTGCGGTGACCGATCTTGTCAAGGAACTCACTGGTGGCAAGG ************************************************** C1 AGCCCAATAAGGGTGTCAACCCCGATGAGGTCGTTGCTGTTGGTGCTGCG C2 AGCCCAATAAGGGTGTCAACCCCGATGAGGTCGTTGCTGTTGGTGCTGCG C3 AGCCCAATAAGGGTGTCAACCCCGATGAGGTCGTTGCTGTTGGTGCTGCG C4 AGCCCAATAAGGGTGTCAACCCCGATGAGGTCGTTGCTGTTGGTGCTGCG C5 AGCCCAATAAGGGTGTCAACCCCGATGAGGTCGTTGCTGTTGGTGCTGCG C6 AGCCCAATAAGGGTGTCAACCCCGATGAGGTCGTTGCTGTTGGTGCTGCG ************************************************** C1 TTGCAGGCCGGTGTCCTCAAGGGTGAGGTGAAAGACGTTCTTTTGCTTGA C2 TTGCAGGCCGGTGTCCTCAAGGGTGAGGTGAAAGACGTTCTTTTGCTTGA C3 TTGCAGGCCGGTGTCCTCAAGGGTGAGGTGAAAGACGTTCTTTTGCTTGA C4 TTGCAGGCCGGTGTCCTCAAGGGTGAGGTGAAAGACGTTCTTTTGCTTGA C5 TTGCAGGCCGGTGTCCTCAAGGGTGAGGTGAAAGACGTTCTTTTGCTTGA C6 TTGCAGGCCGGTGTCCTCAAGGGTGAGGTGAAAGACGTTCTTTTGCTTGA ************************************************** C1 TGTTACACCACTGAGCTTGGGTATCGAGACCAAGGGTGGCGTGATGACCA C2 TGTTACACCACTGAGCTTGGGTATCGAGACCAAGGGTGGCGTGATGACCA C3 TGTTACACCACTGAGCTTGGGTATCGAGACCAAGGGTGGCGTGATGACCA C4 TGTTACACCACTGAGCTTGGGTATCGAGACCAAGGGTGGCGTGATGACCA C5 TGTTACACCACTGAGCTTGGGTATCGAGACCAAGGGTGGCGTGATGACCA C6 TGTTACACCACTGAGCTTGGGTATCGAGACCAAGGGTGGCGTGATGACCA ************************************************** C1 AGCTCATCGAGCGCAATACCACGATCCCCACCAAGCGCTCAGAGACCTTC C2 AGCTCATCGAGCGCAATACCACGATCCCCACCAAGCGCTCAGAGACCTTC C3 AGCTCATCGAGCGCAATACCACGATCCCCACCAAGCGCTCAGAGACCTTC C4 AGCTCATCGAGCGCAATACCACGATCCCCACCAAGCGCTCAGAGACCTTC C5 AGCTCATCGAGCGCAATACCACGATCCCCACCAAGCGCTCAGAGACCTTC C6 AGCTCATCGAGCGCAATACCACGATCCCCACCAAGCGCTCAGAGACCTTC ************************************************** C1 ACTACTGCCGACGACAATCAGCCGTCGGTGCAGATCCAAGTCTACCAGGG C2 ACTACTGCCGACGACAATCAGCCGTCGGTGCAGATCCAAGTCTACCAGGG C3 ACTACTGCCGACGACAATCAGCCGTCGGTGCAGATCCAAGTCTACCAGGG C4 ACTACTGCCGACGACAATCAGCCGTCGGTGCAGATCCAAGTCTACCAGGG C5 ACTACTGCCGACGACAATCAGCCGTCGGTGCAGATCCAAGTCTACCAGGG C6 ACTACTGCCGACGACAATCAGCCGTCGGTGCAGATCCAAGTCTACCAGGG ************************************************** C1 TGAGCGCGAGATAGCTTCGCACAATAAGCTTCTCGGCTCTTTCGAGCTGA C2 TGAGCGCGAGATAGCTTCGCACAATAAGCTTCTCGGCTCTTTCGAGCTGA C3 TGAGCGCGAGATAGCTTCGCACAATAAGCTTCTCGGCTCTTTCGAGCTGA C4 TGAGCGCGAGATAGCTTCGCACAATAAGCTTCTCGGCTCTTTCGAGCTGA C5 TGAGCGCGAGATAGCTTCGCACAATAAGCTTCTCGGCTCTTTCGAGCTGA C6 TGAGCGCGAGATAGCTTCGCACAATAAGCTTCTCGGCTCTTTCGAGCTGA ************************************************** C1 CCGGTATTCCACCGGCTCCGCGCGGTGTCCCGCAGATCGAGGTCACTTTC C2 CCGGTATTCCACCGGCTCCGCGCGGTGTCCCGCAGATCGAGGTCACTTTC C3 CCGGTATTCCACCGGCTCCGCGCGGTGTCCCGCAGATCGAGGTCACTTTC C4 CCGGTATTCCACCGGCTCCGCGCGGTGTCCCGCAGATCGAGGTCACTTTC C5 CCGGTATTCCACCGGCTCCGCGCGGTGTCCCGCAGATCGAGGTCACTTTC C6 CCGGTATTCCACCGGCTCCGCGCGGTGTCCCGCAGATCGAGGTCACTTTC ************************************************** C1 GACATCGACGCCAACGGCATAGTTCACGTCACTGCCAAGGACAAGGGCAC C2 GACATCGACGCCAACGGCATAGTTCACGTCACTGCCAAGGACAAGGGCAC C3 GACATCGACGCCAACGGCATAGTTCACGTCACTGCCAAGGACAAGGGCAC C4 GACATCGACGCCAACGGCATAGTTCACGTCACTGCCAAGGACAAGGGCAC C5 GACATCGACGCCAACGGCATAGTTCACGTCACTGCCAAGGACAAGGGCAC C6 GACATCGACGCCAACGGCATAGTTCACGTCACTGCCAAGGACAAGGGCAC ************************************************** C1 TGGCAAGGAGAATACGATCAAAATCCAGGAAGGCTCCGGGCTGTCCAAGG C2 TGGCAAGGAGAATACGATCAAAATCCAGGAAGGCTCCGGGCTGTCCAAGG C3 TGGCAAGGAGAATACGATCAAAATCCAGGAAGGCTCCGGGCTGTCCAAGG C4 TGGCAAGGAGAATACGATCAAAATCCAGGAAGGCTCCGGGCTGTCCAAGG C5 TGGCAAGGAGAATACGATCAAAATCCAGGAAGGCTCCGGGCTGTCCAAGG C6 TGGCAAGGAGAATACGATCAAAATCCAGGAAGGCTCCGGGCTGTCCAAGG ************************************************** C1 AAGAGATCGATCGGATGGTCAAGGATGCTGAGGCGCACGCTGAGGAGGAC C2 AAGAGATCGATCGGATGGTCAAGGATGCTGAGGCGCACGCTGAGGAGGAC C3 AAGAGATCGATCGGATGGTCAAGGATGCTGAGGCGCACGCTGAGGAGGAC C4 AAGAGATCGATCGGATGGTCAAGGATGCTGAGGCGCACGCTGAGGAGGAC C5 AAGAGATCGATCGGATGGTCAAGGATGCTGAGGCGCACGCTGAGGAGGAC C6 AAGAGATCGATCGGATGGTCAAGGATGCTGAGGCGCACGCTGAGGAGGAC ************************************************** C1 CGCAAGCGTCGCGAGGAGGCCGACGTCCGCAACCAGGCTGAGACGCTCGT C2 CGCAAGCGTCGCGAGGAGGCCGACGTCCGCAACCAGGCTGAGACGCTCGT C3 CGCAAGCGTCGCGAGGAGGCCGACGTCCGCAACCAGGCTGAGACGCTCGT C4 CGCAAGCGTCGCGAGGAGGCCGACGTCCGCAACCAGGCTGAGACGCTCGT C5 CGCAAGCGTCGCGAGGAGGCCGACGTCCGCAACCAGGCTGAGACGCTCGT C6 CGCAAGCGTCGCGAGGAGGCCGACGTCCGCAACCAGGCTGAGACGCTCGT ************************************************** C1 GTACCAGACGGAGAAATTCGTCAAGGAACAACGGGAAACCGAGAATGGTT C2 GTACCAGACGGAGAAATTCGTCAAGGAACAACGGGAAACCGAGAATGGTT C3 GTACCAGACGGAGAAATTCGTCAAGGAACAACGGGAAACCGAGAATGGTT C4 GTACCAGACGGAGAAATTCGTCAAGGAACAACGGGAAACCGAGAATGGTT C5 GTACCAGACGGAGAAATTCGTCAAGGAACAACGGGAAACCGAGAATGGTT C6 GTACCAGACGGAGAAATTCGTCAAGGAACAACGGGAAACCGAGAATGGTT ************************************************** C1 CGAGGGTGCCTGAGGATACCCTCAACAAGGTGGAAGCCGCTGTGGCAGAA C2 CGAGGGTGCCTGAGGATACCCTCAACAAGGTGGAAGCCGCTGTGGCAGAA C3 CGAGGGTGCCTGAGGATACCCTCAACAAGGTGGAAGCCGCTGTGGCAGAA C4 CGAGGGTGCCTGAGGATACCCTCAACAAGGTGGAAGCCGCTGTGGCAGAA C5 CGAGGGTGCCTGAGGATACCCTCAACAAGGTGGAAGCCGCTGTGGCAGAA C6 CGAGGGTGCCTGAGGATACCCTCAACAAGGTGGAAGCCGCTGTGGCAGAA ************************************************** C1 GCTAAGACGGCGCTTGGCGGTACCGACATTTCCGCGATAAAGTCGGCAAT C2 GCTAAGACGGCGCTTGGCGGTACCGACATTTCCGCGATAAAGTCGGCAAT C3 GCTAAGACGGCGCTTGGCGGTACCGACATTTCCGCGATAAAGTCGGCAAT C4 GCTAAGACGGCGCTTGGCGGTACCGACATTTCCGCGATAAAGTCGGCAAT C5 GCTAAGACGGCGCTTGGCGGTACCGACATTTCCGCGATAAAGTCGGCAAT C6 GCTAAGACGGCGCTTGGCGGTACCGACATTTCCGCGATAAAGTCGGCAAT ************************************************** C1 GGAGAAGCTGGGTCAGGACTCCCAGGCACTGGGGCAGGCGATCTATGAGG C2 GGAGAAGCTGGGTCAGGACTCCCAGGCACTGGGGCAGGCGATCTATGAGG C3 GGAGAAGCTGGGTCAGGACTCCCAGGCACTGGGGCAGGCGATCTATGAGG C4 GGAGAAGCTGGGTCAGGACTCCCAGGCACTGGGGCAGGCGATCTATGAGG C5 GGAGAAGCTGGGTCAGGACTCCCAGGCACTGGGGCAGGCGATCTATGAGG C6 GGAGAAGCTGGGTCAGGACTCCCAGGCACTGGGGCAGGCGATCTATGAGG ************************************************** C1 CCACCCAGGCTGCGTCGAAGGTGGGCGGCGAGGCTTCCGCGCCTGGTGGC C2 CCACCCAGGCTGCGTCGAAGGTGGGCGGCGAGGCTTCCGCGCCTGGTGGC C3 CCACCCAGGCTGCGTCGAAGGTGGGCGGCGAGGCTTCCGCGCCTGGTGGC C4 CCACCCAGGCTGCGTCGAAGGTGGGCGGCGAGGCTTCCGCGCCTGGTGGC C5 CCACCCAGGCTGCGTCGAAGGTGGGCGGCGAGGCTTCCGCGCCTGGTGGC C6 CCACCCAGGCTGCGTCGAAGGTGGGCGGCGAGGCTTCCGCGCCTGGTGGC ************************************************** C1 TCGAACTCTACTGACGATGTGGTTGACGCGGAGGTGGTCGACGACGAACG C2 TCGAACTCTACTGACGATGTGGTTGACGCGGAGGTGGTCGACGACGAACG C3 TCGAACTCTACTGACGATGTGGTTGACGCGGAGGTGGTCGACGACGAACG C4 TCGAACTCTACTGACGATGTGGTTGACGCGGAGGTGGTCGACGACGAACG C5 TCGAACTCTACTGACGATGTGGTTGACGCGGAGGTGGTCGACGACGAACG C6 TCGAACTCTACTGACGATGTGGTTGACGCGGAGGTGGTCGACGACGAACG ************************************************** C1 GGAGTCCAAG C2 GGAGTCCAAG C3 GGAGTCCAAG C4 GGAGTCCAAG C5 GGAGTCCAAG C6 GGAGTCCAAG ********** >C1 ATGGCTCGTGCGGTCGGCATCGACCTCGGGACCACCAACTCCGTCGTCTC CGTTCTGGAGGGTGGCGACCCCGTCGTCGTTGCCAACTCCGAGGGGTCGA GGACCACTCCGTCAACTGTCGCGTTCGCGCGTAACGGCGAGGTTCTCGTC GGCCAACCCGCCAAAAACCAGGCGGTTACTAACGTCGACCGCACCATCCG GTCTGTCAAACGGCACATGGGCAGTGACTGGTCCATCGAAATCGACGGCA AAAAATACACCGCGCAGGAGATCAGCGCCCGCGTTCTGATGAAGCTGAAG AGGGACGCTGAGGCTTACCTCGGTGAGGACATCACCGATGCAGTCATCAC CACACCAGCCTACTTTAACGACGCCCAGCGTCAGGCTACCAAGGAAGCCG GCCAGATCGCCGGTTTAAACGTACTGCGTATTGTCAACGAGCCGACCGCC GCCGCTCTGGCCTACGGTCTAGACAAGGGTGAGAGAGAACAAACCATCCT GGTGTTCGATCTGGGTGGCGGCACCTTCGATGTTTCGTTGCTGGAAATCG GCGAGGGCGTGGTCGAAGTGCGTGCCACCAGCGGTGACAATCACCTCGGT GGCGACGATTGGGACGACCGTATTGTCAACTGGCTCGTCGACAAGTTCAA GGGCACTAGCGGTATCGATCTGACCAAGGACAAGATGGCTATGCAGCGGC TACGTGAGGCTGCCGAGAAGGCCAAGATCGAGCTCAGCTCGAGCCAAAGC ACCTCGGTTAACTTGCCCTACATTACCGTCGATTCAGACAAGAACCCGCT ATTCCTTGACGAGCAGCTTATTCGCGCCGAATTCCAACGCATCACCCAGG ATTTGCTGGACCGCACCCGTCAGCCGTTCCAGTCGGTGGTCAAGGACGCC GGTATTTCGGTTTCTGAGATCGATCACGTCGTGCTGGTGGGCGGTTCGAC CCGGATGCCTGCGGTGACCGATCTTGTCAAGGAACTCACTGGTGGCAAGG AGCCCAATAAGGGTGTCAACCCCGATGAGGTCGTTGCTGTTGGTGCTGCG TTGCAGGCCGGTGTCCTCAAGGGTGAGGTGAAAGACGTTCTTTTGCTTGA TGTTACACCACTGAGCTTGGGTATCGAGACCAAGGGTGGCGTGATGACCA AGCTCATCGAGCGCAATACCACGATCCCCACCAAGCGCTCAGAGACCTTC ACTACTGCCGACGACAATCAGCCGTCGGTGCAGATCCAAGTCTACCAGGG TGAGCGCGAGATAGCTTCGCACAATAAGCTTCTCGGCTCTTTCGAGCTGA CCGGTATTCCACCGGCTCCGCGCGGTGTCCCGCAGATCGAGGTCACTTTC GACATCGACGCCAACGGCATAGTTCACGTCACTGCCAAGGACAAGGGCAC TGGCAAGGAGAATACGATCAAAATCCAGGAAGGCTCCGGGCTGTCCAAGG AAGAGATCGATCGGATGGTCAAGGATGCTGAGGCGCACGCTGAGGAGGAC CGCAAGCGTCGCGAGGAGGCCGACGTCCGCAACCAGGCTGAGACGCTCGT GTACCAGACGGAGAAATTCGTCAAGGAACAACGGGAAACCGAGAATGGTT CGAGGGTGCCTGAGGATACCCTCAACAAGGTGGAAGCCGCTGTGGCAGAA GCTAAGACGGCGCTTGGCGGTACCGACATTTCCGCGATAAAGTCGGCAAT GGAGAAGCTGGGTCAGGACTCCCAGGCACTGGGGCAGGCGATCTATGAGG CCACCCAGGCTGCGTCGAAGGTGGGCGGCGAGGCTTCCGCGCCTGGTGGC TCGAACTCTACTGACGATGTGGTTGACGCGGAGGTGGTCGACGACGAACG GGAGTCCAAG >C2 ATGGCTCGTGCGGTCGGCATCGACCTCGGGACCACCAACTCCGTCGTCTC CGTTCTGGAGGGTGGCGACCCCGTCGTCGTTGCCAACTCCGAGGGGTCGA GGACCACTCCGTCAACTGTCGCGTTCGCGCGTAACGGCGAGGTTCTCGTC GGCCAACCCGCCAAAAACCAGGCGGTTACTAACGTCGACCGCACCATCCG GTCTGTCAAACGGCACATGGGCAGTGACTGGTCCATCGAAATCGACGGCA AAAAATACACCGCGCAGGAGATCAGCGCCCGCGTTCTGATGAAGCTGAAG AGGGACGCTGAGGCTTACCTCGGTGAGGACATCACCGATGCAGTCATCAC CACACCAGCCTACTTTAACGACGCCCAGCGTCAGGCTACCAAGGAAGCCG GCCAGATCGCCGGTTTAAACGTACTGCGTATTGTCAACGAGCCGACCGCC GCCGCTCTGGCCTACGGTCTAGACAAGGGTGAGAGAGAACAAACCATCCT GGTGTTCGATCTGGGTGGCGGCACCTTCGATGTTTCGTTGCTGGAAATCG GCGAGGGCGTGGTCGAAGTGCGTGCCACCAGCGGTGACAATCACCTCGGT GGCGACGATTGGGACGACCGTATTGTCAACTGGCTCGTCGACAAGTTCAA GGGCACTAGCGGTATCGATCTGACCAAGGACAAGATGGCTATGCAGCGGC TACGTGAGGCTGCCGAGAAGGCCAAGATCGAGCTCAGCTCGAGCCAAAGC ACCTCGGTTAACTTGCCCTACATTACCGTCGATTCAGACAAGAACCCGCT ATTCCTTGACGAGCAGCTTATTCGCGCCGAATTCCAACGCATCACCCAGG ATTTGCTGGACCGCACCCGTCAGCCGTTCCAGTCGGTGGTCAAGGACGCC GGTATTTCGGTTTCTGAGATCGATCACGTCGTGCTGGTGGGCGGTTCGAC CCGGATGCCTGCGGTGACCGATCTTGTCAAGGAACTCACTGGTGGCAAGG AGCCCAATAAGGGTGTCAACCCCGATGAGGTCGTTGCTGTTGGTGCTGCG TTGCAGGCCGGTGTCCTCAAGGGTGAGGTGAAAGACGTTCTTTTGCTTGA TGTTACACCACTGAGCTTGGGTATCGAGACCAAGGGTGGCGTGATGACCA AGCTCATCGAGCGCAATACCACGATCCCCACCAAGCGCTCAGAGACCTTC ACTACTGCCGACGACAATCAGCCGTCGGTGCAGATCCAAGTCTACCAGGG TGAGCGCGAGATAGCTTCGCACAATAAGCTTCTCGGCTCTTTCGAGCTGA CCGGTATTCCACCGGCTCCGCGCGGTGTCCCGCAGATCGAGGTCACTTTC GACATCGACGCCAACGGCATAGTTCACGTCACTGCCAAGGACAAGGGCAC TGGCAAGGAGAATACGATCAAAATCCAGGAAGGCTCCGGGCTGTCCAAGG AAGAGATCGATCGGATGGTCAAGGATGCTGAGGCGCACGCTGAGGAGGAC CGCAAGCGTCGCGAGGAGGCCGACGTCCGCAACCAGGCTGAGACGCTCGT GTACCAGACGGAGAAATTCGTCAAGGAACAACGGGAAACCGAGAATGGTT CGAGGGTGCCTGAGGATACCCTCAACAAGGTGGAAGCCGCTGTGGCAGAA GCTAAGACGGCGCTTGGCGGTACCGACATTTCCGCGATAAAGTCGGCAAT GGAGAAGCTGGGTCAGGACTCCCAGGCACTGGGGCAGGCGATCTATGAGG CCACCCAGGCTGCGTCGAAGGTGGGCGGCGAGGCTTCCGCGCCTGGTGGC TCGAACTCTACTGACGATGTGGTTGACGCGGAGGTGGTCGACGACGAACG GGAGTCCAAG >C3 ATGGCTCGTGCGGTCGGCATCGACCTCGGGACCACCAACTCCGTCGTCTC CGTTCTGGAGGGTGGCGACCCCGTCGTCGTTGCCAACTCCGAGGGGTCGA GGACCACTCCGTCAACTGTCGCGTTCGCGCGTAACGGCGAGGTTCTCGTC GGCCAACCCGCCAAAAACCAGGCGGTTACTAACGTCGACCGCACCATCCG GTCTGTCAAACGGCACATGGGCAGTGACTGGTCCATCGAAATCGACGGCA AAAAATACACCGCGCAGGAGATCAGCGCCCGCGTTCTGATGAAGCTGAAG AGGGACGCTGAGGCTTACCTCGGTGAGGACATCACCGATGCAGTCATCAC CACACCAGCCTACTTTAACGACGCCCAGCGTCAGGCTACCAAGGAAGCCG GCCAGATCGCCGGTTTAAACGTACTGCGTATTGTCAACGAGCCGACCGCC GCCGCTCTGGCCTACGGTCTAGACAAGGGTGAGAGAGAACAAACCATCCT GGTGTTCGATCTGGGTGGCGGCACCTTCGATGTTTCGTTGCTGGAAATCG GCGAGGGCGTGGTCGAAGTGCGTGCCACCAGCGGTGACAATCACCTCGGT GGCGACGATTGGGACGACCGTATTGTCAACTGGCTCGTCGACAAGTTCAA GGGCACTAGCGGTATCGATCTGACCAAGGACAAGATGGCTATGCAGCGGC TACGTGAGGCTGCCGAGAAGGCCAAGATCGAGCTCAGCTCGAGCCAAAGC ACCTCGGTTAACTTGCCCTACATTACCGTCGATTCAGACAAGAACCCGCT ATTCCTTGACGAGCAGCTTATTCGCGCCGAATTCCAACGCATCACCCAGG ATTTGCTGGACCGCACCCGTCAGCCGTTCCAGTCGGTGGTCAAGGACGCC GGTATTTCGGTTTCTGAGATCGATCACGTCGTGCTGGTGGGCGGTTCGAC CCGGATGCCTGCGGTGACCGATCTTGTCAAGGAACTCACTGGTGGCAAGG AGCCCAATAAGGGTGTCAACCCCGATGAGGTCGTTGCTGTTGGTGCTGCG TTGCAGGCCGGTGTCCTCAAGGGTGAGGTGAAAGACGTTCTTTTGCTTGA TGTTACACCACTGAGCTTGGGTATCGAGACCAAGGGTGGCGTGATGACCA AGCTCATCGAGCGCAATACCACGATCCCCACCAAGCGCTCAGAGACCTTC ACTACTGCCGACGACAATCAGCCGTCGGTGCAGATCCAAGTCTACCAGGG TGAGCGCGAGATAGCTTCGCACAATAAGCTTCTCGGCTCTTTCGAGCTGA CCGGTATTCCACCGGCTCCGCGCGGTGTCCCGCAGATCGAGGTCACTTTC GACATCGACGCCAACGGCATAGTTCACGTCACTGCCAAGGACAAGGGCAC TGGCAAGGAGAATACGATCAAAATCCAGGAAGGCTCCGGGCTGTCCAAGG AAGAGATCGATCGGATGGTCAAGGATGCTGAGGCGCACGCTGAGGAGGAC CGCAAGCGTCGCGAGGAGGCCGACGTCCGCAACCAGGCTGAGACGCTCGT GTACCAGACGGAGAAATTCGTCAAGGAACAACGGGAAACCGAGAATGGTT CGAGGGTGCCTGAGGATACCCTCAACAAGGTGGAAGCCGCTGTGGCAGAA GCTAAGACGGCGCTTGGCGGTACCGACATTTCCGCGATAAAGTCGGCAAT GGAGAAGCTGGGTCAGGACTCCCAGGCACTGGGGCAGGCGATCTATGAGG CCACCCAGGCTGCGTCGAAGGTGGGCGGCGAGGCTTCCGCGCCTGGTGGC TCGAACTCTACTGACGATGTGGTTGACGCGGAGGTGGTCGACGACGAACG GGAGTCCAAG >C4 ATGGCTCGTGCGGTCGGCATCGACCTCGGGACCACCAACTCCGTCGTCTC CGTTCTGGAGGGTGGCGACCCCGTCGTCGTTGCCAACTCCGAGGGGTCGA GGACCACTCCGTCAACTGTCGCGTTCGCGCGTAACGGCGAGGTTCTCGTC GGCCAACCCGCCAAAAACCAGGCGGTTACTAACGTCGACCGCACCATCCG GTCTGTCAAACGGCACATGGGCAGTGACTGGTCCATCGAAATCGACGGCA AAAAATACACCGCGCAGGAGATCAGCGCCCGCGTTCTGATGAAGCTGAAG AGGGACGCTGAGGCTTACCTCGGTGAGGACATCACCGATGCAGTCATCAC CACACCAGCCTACTTTAACGACGCCCAGCGTCAGGCTACCAAGGAAGCCG GCCAGATCGCCGGTTTAAACGTACTGCGTATTGTCAACGAGCCGACCGCC GCCGCTCTGGCCTACGGTCTAGACAAGGGTGAGAGAGAACAAACCATCCT GGTGTTCGATCTGGGTGGCGGCACCTTCGATGTTTCGTTGCTGGAAATCG GCGAGGGCGTGGTCGAAGTGCGTGCCACCAGCGGTGACAATCACCTCGGT GGCGACGATTGGGACGACCGTATTGTCAACTGGCTCGTCGACAAGTTCAA GGGCACTAGCGGTATCGATCTGACCAAGGACAAGATGGCTATGCAGCGGC TACGTGAGGCTGCCGAGAAGGCCAAGATCGAGCTCAGCTCGAGCCAAAGC ACCTCGGTTAACTTGCCCTACATTACCGTCGATTCAGACAAGAACCCGCT ATTCCTTGACGAGCAGCTTATTCGCGCCGAATTCCAACGCATCACCCAGG ATTTGCTGGACCGCACCCGTCAGCCGTTCCAGTCGGTGGTCAAGGACGCC GGTATTTCGGTTTCTGAGATCGATCACGTCGTGCTGGTGGGCGGTTCGAC CCGGATGCCTGCGGTGACCGATCTTGTCAAGGAACTCACTGGTGGCAAGG AGCCCAATAAGGGTGTCAACCCCGATGAGGTCGTTGCTGTTGGTGCTGCG TTGCAGGCCGGTGTCCTCAAGGGTGAGGTGAAAGACGTTCTTTTGCTTGA TGTTACACCACTGAGCTTGGGTATCGAGACCAAGGGTGGCGTGATGACCA AGCTCATCGAGCGCAATACCACGATCCCCACCAAGCGCTCAGAGACCTTC ACTACTGCCGACGACAATCAGCCGTCGGTGCAGATCCAAGTCTACCAGGG TGAGCGCGAGATAGCTTCGCACAATAAGCTTCTCGGCTCTTTCGAGCTGA CCGGTATTCCACCGGCTCCGCGCGGTGTCCCGCAGATCGAGGTCACTTTC GACATCGACGCCAACGGCATAGTTCACGTCACTGCCAAGGACAAGGGCAC TGGCAAGGAGAATACGATCAAAATCCAGGAAGGCTCCGGGCTGTCCAAGG AAGAGATCGATCGGATGGTCAAGGATGCTGAGGCGCACGCTGAGGAGGAC CGCAAGCGTCGCGAGGAGGCCGACGTCCGCAACCAGGCTGAGACGCTCGT GTACCAGACGGAGAAATTCGTCAAGGAACAACGGGAAACCGAGAATGGTT CGAGGGTGCCTGAGGATACCCTCAACAAGGTGGAAGCCGCTGTGGCAGAA GCTAAGACGGCGCTTGGCGGTACCGACATTTCCGCGATAAAGTCGGCAAT GGAGAAGCTGGGTCAGGACTCCCAGGCACTGGGGCAGGCGATCTATGAGG CCACCCAGGCTGCGTCGAAGGTGGGCGGCGAGGCTTCCGCGCCTGGTGGC TCGAACTCTACTGACGATGTGGTTGACGCGGAGGTGGTCGACGACGAACG GGAGTCCAAG >C5 ATGGCTCGTGCGGTCGGCATCGACCTCGGGACCACCAACTCCGTCGTCTC CGTTCTGGAGGGTGGCGACCCCGTCGTCGTTGCCAACTCCGAGGGGTCGA GGACCACTCCGTCAACTGTCGCGTTCGCGCGTAACGGCGAGGTTCTCGTC GGCCAACCCGCCAAAAACCAGGCGGTTACTAACGTCGACCGCACCATCCG GTCTGTCAAACGGCACATGGGCAGTGACTGGTCCATCGAAATCGACGGCA AAAAATACACCGCGCAGGAGATCAGCGCCCGCGTTCTGATGAAGCTGAAG AGGGACGCTGAGGCTTACCTCGGTGAGGACATCACCGATGCAGTCATCAC CACACCAGCCTACTTTAACGACGCCCAGCGTCAGGCTACCAAGGAAGCCG GCCAGATCGCCGGTTTAAACGTACTGCGTATTGTCAACGAGCCGACCGCC GCCGCTCTGGCCTACGGTCTAGACAAGGGTGAGAGAGAACAAACCATCCT GGTGTTCGATCTGGGTGGCGGCACCTTCGATGTTTCGTTGCTGGAAATCG GCGAGGGCGTGGTCGAAGTGCGTGCCACCAGCGGTGACAATCACCTCGGT GGCGACGATTGGGACGACCGTATTGTCAACTGGCTCGTCGACAAGTTCAA GGGCACTAGCGGTATCGATCTGACCAAGGACAAGATGGCTATGCAGCGGC TACGTGAGGCTGCCGAGAAGGCCAAGATCGAGCTCAGCTCGAGCCAAAGC ACCTCGGTTAACTTGCCCTACATTACCGTCGATTCAGACAAGAACCCGCT ATTCCTTGACGAGCAGCTTATTCGCGCCGAATTCCAACGCATCACCCAGG ATTTGCTGGACCGCACCCGTCAGCCGTTCCAGTCGGTGGTCAAGGACGCC GGTATTTCGGTTTCTGAGATCGATCACGTCGTGCTGGTGGGCGGTTCGAC CCGGATGCCTGCGGTGACCGATCTTGTCAAGGAACTCACTGGTGGCAAGG AGCCCAATAAGGGTGTCAACCCCGATGAGGTCGTTGCTGTTGGTGCTGCG TTGCAGGCCGGTGTCCTCAAGGGTGAGGTGAAAGACGTTCTTTTGCTTGA TGTTACACCACTGAGCTTGGGTATCGAGACCAAGGGTGGCGTGATGACCA AGCTCATCGAGCGCAATACCACGATCCCCACCAAGCGCTCAGAGACCTTC ACTACTGCCGACGACAATCAGCCGTCGGTGCAGATCCAAGTCTACCAGGG TGAGCGCGAGATAGCTTCGCACAATAAGCTTCTCGGCTCTTTCGAGCTGA CCGGTATTCCACCGGCTCCGCGCGGTGTCCCGCAGATCGAGGTCACTTTC GACATCGACGCCAACGGCATAGTTCACGTCACTGCCAAGGACAAGGGCAC TGGCAAGGAGAATACGATCAAAATCCAGGAAGGCTCCGGGCTGTCCAAGG AAGAGATCGATCGGATGGTCAAGGATGCTGAGGCGCACGCTGAGGAGGAC CGCAAGCGTCGCGAGGAGGCCGACGTCCGCAACCAGGCTGAGACGCTCGT GTACCAGACGGAGAAATTCGTCAAGGAACAACGGGAAACCGAGAATGGTT CGAGGGTGCCTGAGGATACCCTCAACAAGGTGGAAGCCGCTGTGGCAGAA GCTAAGACGGCGCTTGGCGGTACCGACATTTCCGCGATAAAGTCGGCAAT GGAGAAGCTGGGTCAGGACTCCCAGGCACTGGGGCAGGCGATCTATGAGG CCACCCAGGCTGCGTCGAAGGTGGGCGGCGAGGCTTCCGCGCCTGGTGGC TCGAACTCTACTGACGATGTGGTTGACGCGGAGGTGGTCGACGACGAACG GGAGTCCAAG >C6 ATGGCTCGTGCGGTCGGCATCGACCTCGGGACCACCAACTCCGTCGTCTC CGTTCTGGAGGGTGGCGACCCCGTCGTCGTTGCCAACTCCGAGGGGTCGA GGACCACTCCGTCAACTGTCGCGTTCGCGCGTAACGGCGAGGTTCTCGTC GGCCAACCCGCCAAAAACCAGGCGGTTACTAACGTCGACCGCACCATCCG GTCTGTCAAACGGCACATGGGCAGTGACTGGTCCATCGAAATCGACGGCA AAAAATACACCGCGCAGGAGATCAGCGCCCGCGTTCTGATGAAGCTGAAG AGGGACGCTGAGGCTTACCTCGGTGAGGACATCACCGATGCAGTCATCAC CACACCAGCCTACTTTAACGACGCCCAGCGTCAGGCTACCAAGGAAGCCG GCCAGATCGCCGGTTTAAACGTACTGCGTATTGTCAACGAGCCGACCGCC GCCGCTCTGGCCTACGGTCTAGACAAGGGTGAGAGAGAACAAACCATCCT GGTGTTCGATCTGGGTGGCGGCACCTTCGATGTTTCGTTGCTGGAAATCG GCGAGGGCGTGGTCGAAGTGCGTGCCACCAGCGGTGACAATCACCTCGGT GGCGACGATTGGGACGACCGTATTGTCAACTGGCTCGTCGACAAGTTCAA GGGCACTAGCGGTATCGATCTGACCAAGGACAAGATGGCTATGCAGCGGC TACGTGAGGCTGCCGAGAAGGCCAAGATCGAGCTCAGCTCGAGCCAAAGC ACCTCGGTTAACTTGCCCTACATTACCGTCGATTCAGACAAGAACCCGCT ATTCCTTGACGAGCAGCTTATTCGCGCCGAATTCCAACGCATCACCCAGG ATTTGCTGGACCGCACCCGTCAGCCGTTCCAGTCGGTGGTCAAGGACGCC GGTATTTCGGTTTCTGAGATCGATCACGTCGTGCTGGTGGGCGGTTCGAC CCGGATGCCTGCGGTGACCGATCTTGTCAAGGAACTCACTGGTGGCAAGG AGCCCAATAAGGGTGTCAACCCCGATGAGGTCGTTGCTGTTGGTGCTGCG TTGCAGGCCGGTGTCCTCAAGGGTGAGGTGAAAGACGTTCTTTTGCTTGA TGTTACACCACTGAGCTTGGGTATCGAGACCAAGGGTGGCGTGATGACCA AGCTCATCGAGCGCAATACCACGATCCCCACCAAGCGCTCAGAGACCTTC ACTACTGCCGACGACAATCAGCCGTCGGTGCAGATCCAAGTCTACCAGGG TGAGCGCGAGATAGCTTCGCACAATAAGCTTCTCGGCTCTTTCGAGCTGA CCGGTATTCCACCGGCTCCGCGCGGTGTCCCGCAGATCGAGGTCACTTTC GACATCGACGCCAACGGCATAGTTCACGTCACTGCCAAGGACAAGGGCAC TGGCAAGGAGAATACGATCAAAATCCAGGAAGGCTCCGGGCTGTCCAAGG AAGAGATCGATCGGATGGTCAAGGATGCTGAGGCGCACGCTGAGGAGGAC CGCAAGCGTCGCGAGGAGGCCGACGTCCGCAACCAGGCTGAGACGCTCGT GTACCAGACGGAGAAATTCGTCAAGGAACAACGGGAAACCGAGAATGGTT CGAGGGTGCCTGAGGATACCCTCAACAAGGTGGAAGCCGCTGTGGCAGAA GCTAAGACGGCGCTTGGCGGTACCGACATTTCCGCGATAAAGTCGGCAAT GGAGAAGCTGGGTCAGGACTCCCAGGCACTGGGGCAGGCGATCTATGAGG CCACCCAGGCTGCGTCGAAGGTGGGCGGCGAGGCTTCCGCGCCTGGTGGC TCGAACTCTACTGACGATGTGGTTGACGCGGAGGTGGTCGACGACGAACG GGAGTCCAAG >C1 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG SNSTDDVVDAEVVDDERESK >C2 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG SNSTDDVVDAEVVDDERESK >C3 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG SNSTDDVVDAEVVDDERESK >C4 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG SNSTDDVVDAEVVDDERESK >C5 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG SNSTDDVVDAEVVDDERESK >C6 MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSTVAFARNGEVLV GQPAKNQAVTNVDRTIRSVKRHMGSDWSIEIDGKKYTAQEISARVLMKLK RDAEAYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA AALAYGLDKGEREQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS TSVNLPYITVDSDKNPLFLDEQLIRAEFQRITQDLLDRTRQPFQSVVKDA GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEED RKRREEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAE AKTALGGTDISAIKSAMEKLGQDSQALGQAIYEATQAASKVGGEASAPGG SNSTDDVVDAEVVDDERESK MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/1res/dnaK/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1860 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579775575 Setting output file names to "/data/1res/dnaK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 987047619 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9838846411 Seed = 1207615215 Swapseed = 1579775575 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -4162.768539 -- -24.965149 Chain 2 -- -4162.768539 -- -24.965149 Chain 3 -- -4162.768935 -- -24.965149 Chain 4 -- -4162.769174 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -4162.768539 -- -24.965149 Chain 2 -- -4162.768539 -- -24.965149 Chain 3 -- -4162.769174 -- -24.965149 Chain 4 -- -4162.768935 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-4162.769] (-4162.769) (-4162.769) (-4162.769) * [-4162.769] (-4162.769) (-4162.769) (-4162.769) 500 -- (-2562.183) [-2572.267] (-2557.274) (-2568.603) * (-2572.757) (-2554.391) (-2605.714) [-2553.985] -- 0:00:00 1000 -- (-2555.185) (-2555.487) (-2560.501) [-2556.775] * (-2556.711) (-2553.616) [-2556.826] (-2556.789) -- 0:00:00 1500 -- [-2554.960] (-2551.546) (-2555.182) (-2555.745) * [-2551.818] (-2557.589) (-2556.519) (-2555.084) -- 0:00:00 2000 -- (-2556.958) (-2559.454) [-2559.428] (-2558.333) * (-2554.596) [-2556.996] (-2553.338) (-2559.744) -- 0:00:00 2500 -- (-2562.943) [-2552.099] (-2561.716) (-2549.834) * (-2562.740) [-2553.717] (-2560.636) (-2559.010) -- 0:00:00 3000 -- (-2561.331) (-2551.398) [-2558.153] (-2555.402) * (-2550.882) (-2551.349) [-2551.674] (-2551.666) -- 0:00:00 3500 -- (-2561.915) (-2557.467) [-2558.059] (-2554.004) * (-2557.277) (-2553.759) [-2556.281] (-2552.415) -- 0:00:00 4000 -- (-2561.758) (-2551.433) (-2554.739) [-2554.332] * (-2557.650) [-2553.238] (-2561.076) (-2555.860) -- 0:00:00 4500 -- [-2553.877] (-2556.492) (-2559.885) (-2565.405) * (-2555.518) (-2557.541) (-2563.183) [-2552.955] -- 0:00:00 5000 -- [-2561.601] (-2568.349) (-2553.155) (-2557.026) * (-2553.650) [-2550.312] (-2552.213) (-2556.047) -- 0:00:00 Average standard deviation of split frequencies: 0.054656 5500 -- [-2557.687] (-2559.082) (-2558.942) (-2553.431) * (-2556.176) (-2555.055) (-2559.546) [-2552.753] -- 0:03:00 6000 -- [-2558.067] (-2554.277) (-2554.113) (-2552.184) * (-2560.774) (-2550.864) [-2549.437] (-2555.026) -- 0:02:45 6500 -- (-2557.169) [-2554.079] (-2556.392) (-2559.551) * [-2554.372] (-2553.399) (-2562.710) (-2558.094) -- 0:02:32 7000 -- (-2555.272) [-2548.700] (-2552.293) (-2557.040) * (-2556.670) (-2558.158) [-2561.350] (-2557.985) -- 0:02:21 7500 -- (-2559.532) (-2558.362) (-2553.738) [-2557.887] * [-2552.558] (-2567.636) (-2558.834) (-2553.904) -- 0:02:12 8000 -- (-2554.691) [-2552.918] (-2550.676) (-2566.841) * (-2554.999) (-2554.251) [-2556.750] (-2564.229) -- 0:02:04 8500 -- (-2563.061) [-2550.195] (-2555.067) (-2550.523) * [-2557.299] (-2555.359) (-2554.358) (-2554.511) -- 0:01:56 9000 -- (-2553.684) [-2554.996] (-2554.644) (-2549.262) * [-2554.296] (-2549.230) (-2568.569) (-2555.484) -- 0:01:50 9500 -- (-2563.340) (-2557.290) (-2551.180) [-2546.442] * [-2552.579] (-2559.661) (-2561.131) (-2561.797) -- 0:01:44 10000 -- (-2562.504) (-2552.767) (-2558.158) [-2546.078] * [-2554.966] (-2559.059) (-2558.392) (-2554.309) -- 0:01:39 Average standard deviation of split frequencies: 0.079970 10500 -- (-2554.790) (-2556.772) (-2556.447) [-2544.881] * (-2560.300) [-2556.845] (-2555.167) (-2549.349) -- 0:01:34 11000 -- (-2550.527) (-2556.969) [-2559.319] (-2547.627) * [-2557.089] (-2555.954) (-2553.716) (-2547.231) -- 0:01:29 11500 -- (-2559.510) [-2554.767] (-2559.865) (-2546.152) * (-2549.132) (-2560.817) [-2554.212] (-2549.474) -- 0:01:25 12000 -- (-2556.766) [-2558.295] (-2555.825) (-2549.139) * (-2555.222) [-2552.858] (-2558.918) (-2548.446) -- 0:01:22 12500 -- (-2558.466) [-2557.974] (-2566.372) (-2548.101) * (-2559.770) (-2552.692) [-2552.911] (-2550.304) -- 0:01:19 13000 -- [-2551.278] (-2553.118) (-2552.161) (-2550.176) * [-2547.527] (-2550.873) (-2555.514) (-2548.543) -- 0:01:15 13500 -- (-2554.121) [-2553.676] (-2555.969) (-2547.934) * [-2552.671] (-2552.284) (-2555.021) (-2545.098) -- 0:01:13 14000 -- (-2555.896) (-2557.638) [-2554.217] (-2550.582) * (-2556.463) [-2553.571] (-2554.814) (-2545.871) -- 0:01:10 14500 -- (-2555.381) (-2556.466) [-2551.329] (-2548.758) * [-2560.218] (-2553.993) (-2550.038) (-2545.857) -- 0:01:07 15000 -- [-2550.752] (-2561.739) (-2553.688) (-2547.058) * [-2555.137] (-2558.903) (-2556.210) (-2545.869) -- 0:01:05 Average standard deviation of split frequencies: 0.068746 15500 -- (-2554.531) [-2552.391] (-2557.571) (-2546.475) * (-2552.296) (-2553.875) (-2554.182) [-2545.869] -- 0:01:03 16000 -- [-2556.251] (-2552.569) (-2564.353) (-2545.691) * (-2556.801) (-2562.869) (-2557.519) [-2547.910] -- 0:01:01 16500 -- (-2549.762) (-2555.401) [-2555.431] (-2553.594) * (-2555.816) (-2562.985) (-2552.573) [-2547.686] -- 0:00:59 17000 -- [-2555.209] (-2556.480) (-2553.612) (-2551.409) * [-2555.501] (-2555.826) (-2561.496) (-2546.116) -- 0:00:57 17500 -- (-2558.271) [-2554.326] (-2554.333) (-2550.554) * (-2548.530) (-2559.180) [-2553.451] (-2546.310) -- 0:00:56 18000 -- (-2556.672) (-2565.104) (-2558.043) [-2549.608] * (-2563.510) [-2555.858] (-2561.362) (-2549.004) -- 0:00:54 18500 -- [-2559.246] (-2561.565) (-2557.673) (-2545.684) * [-2551.701] (-2555.043) (-2558.003) (-2546.086) -- 0:01:46 19000 -- (-2561.082) (-2556.063) (-2554.437) [-2547.040] * (-2558.615) (-2562.151) (-2562.899) [-2545.610] -- 0:01:43 19500 -- [-2560.769] (-2555.908) (-2553.482) (-2546.529) * (-2550.524) (-2551.835) [-2554.259] (-2545.619) -- 0:01:40 20000 -- (-2563.798) [-2549.347] (-2552.338) (-2550.006) * (-2552.992) (-2559.715) [-2557.949] (-2546.281) -- 0:01:38 Average standard deviation of split frequencies: 0.052823 20500 -- [-2557.964] (-2553.806) (-2551.627) (-2550.476) * (-2556.584) (-2553.286) (-2554.367) [-2546.295] -- 0:01:35 21000 -- [-2553.302] (-2559.600) (-2554.767) (-2551.463) * (-2556.325) (-2559.647) (-2553.295) [-2545.398] -- 0:01:33 21500 -- (-2559.556) (-2561.350) (-2558.107) [-2554.040] * (-2552.199) (-2554.777) (-2554.402) [-2545.432] -- 0:01:31 22000 -- (-2556.872) (-2555.881) (-2552.315) [-2547.856] * (-2556.809) (-2559.568) (-2552.280) [-2545.710] -- 0:01:28 22500 -- (-2556.346) [-2556.015] (-2550.209) (-2550.153) * (-2556.491) (-2559.119) [-2549.813] (-2548.102) -- 0:01:26 23000 -- [-2549.182] (-2563.006) (-2552.117) (-2549.757) * (-2566.525) (-2562.107) (-2553.818) [-2545.604] -- 0:01:24 23500 -- (-2563.158) (-2559.394) (-2560.501) [-2544.996] * (-2547.749) [-2559.480] (-2557.656) (-2545.858) -- 0:01:23 24000 -- (-2551.870) (-2553.874) [-2556.389] (-2545.010) * (-2566.218) (-2555.888) [-2557.372] (-2544.813) -- 0:01:21 24500 -- (-2559.052) [-2553.034] (-2550.685) (-2547.829) * (-2547.028) (-2561.327) (-2558.497) [-2547.259] -- 0:01:19 25000 -- (-2554.807) (-2552.986) [-2552.199] (-2547.949) * (-2545.865) (-2555.542) [-2562.005] (-2547.041) -- 0:01:18 Average standard deviation of split frequencies: 0.042568 25500 -- (-2552.807) (-2556.540) [-2557.481] (-2546.258) * (-2547.266) [-2553.984] (-2557.280) (-2546.776) -- 0:01:16 26000 -- (-2550.936) [-2551.985] (-2555.334) (-2546.919) * [-2548.123] (-2553.915) (-2557.910) (-2545.856) -- 0:01:14 26500 -- (-2558.759) [-2553.643] (-2555.653) (-2546.105) * (-2549.953) (-2558.846) (-2549.317) [-2545.117] -- 0:01:13 27000 -- [-2561.899] (-2554.911) (-2552.409) (-2546.357) * [-2551.053] (-2566.988) (-2551.325) (-2545.421) -- 0:01:12 27500 -- (-2553.696) (-2558.584) [-2550.250] (-2545.027) * (-2547.424) (-2557.604) (-2558.741) [-2544.836] -- 0:01:10 28000 -- (-2552.889) (-2553.110) (-2557.259) [-2544.752] * (-2547.414) (-2557.980) (-2551.041) [-2546.356] -- 0:01:09 28500 -- [-2557.270] (-2549.048) (-2555.085) (-2546.762) * (-2547.592) [-2554.775] (-2554.693) (-2545.584) -- 0:01:08 29000 -- (-2555.268) [-2547.555] (-2569.924) (-2546.908) * [-2545.548] (-2558.641) (-2564.042) (-2548.632) -- 0:01:06 29500 -- (-2556.030) [-2549.684] (-2551.937) (-2548.853) * (-2545.822) (-2557.487) (-2553.685) [-2548.575] -- 0:01:05 30000 -- [-2556.592] (-2552.482) (-2557.457) (-2545.221) * (-2546.288) (-2553.934) [-2551.689] (-2547.057) -- 0:01:04 Average standard deviation of split frequencies: 0.038796 30500 -- [-2556.653] (-2545.039) (-2555.790) (-2545.992) * (-2545.855) (-2557.276) [-2555.161] (-2546.444) -- 0:01:03 31000 -- [-2550.117] (-2545.506) (-2559.660) (-2546.663) * (-2546.465) (-2551.370) [-2557.472] (-2545.251) -- 0:01:33 31500 -- (-2556.542) (-2546.699) (-2553.290) [-2548.745] * [-2546.698] (-2549.015) (-2559.795) (-2545.464) -- 0:01:32 32000 -- (-2553.275) [-2553.445] (-2568.732) (-2550.835) * (-2546.600) [-2553.166] (-2555.352) (-2546.353) -- 0:01:30 32500 -- (-2560.679) (-2545.650) [-2556.047] (-2544.395) * (-2544.248) (-2551.555) [-2552.140] (-2545.497) -- 0:01:29 33000 -- (-2556.260) (-2546.698) (-2556.259) [-2545.267] * (-2544.926) [-2558.193] (-2558.361) (-2547.129) -- 0:01:27 33500 -- (-2556.891) (-2547.963) [-2554.307] (-2545.238) * (-2544.843) (-2564.005) [-2553.864] (-2547.505) -- 0:01:26 34000 -- (-2551.189) (-2546.718) [-2555.170] (-2547.450) * [-2547.479] (-2550.944) (-2555.462) (-2548.173) -- 0:01:25 34500 -- (-2550.222) (-2544.379) (-2553.965) [-2548.389] * [-2545.746] (-2550.940) (-2552.356) (-2545.992) -- 0:01:23 35000 -- [-2549.701] (-2544.116) (-2556.245) (-2547.632) * [-2545.849] (-2555.107) (-2559.032) (-2545.846) -- 0:01:22 Average standard deviation of split frequencies: 0.034701 35500 -- (-2548.842) [-2545.506] (-2557.349) (-2550.036) * (-2545.103) [-2552.617] (-2561.858) (-2549.180) -- 0:01:21 36000 -- (-2548.694) (-2545.699) [-2559.908] (-2550.470) * (-2545.855) (-2561.868) [-2555.996] (-2550.672) -- 0:01:20 36500 -- (-2547.866) (-2544.834) [-2551.616] (-2551.026) * [-2547.056] (-2559.678) (-2554.010) (-2548.658) -- 0:01:19 37000 -- [-2548.789] (-2544.834) (-2561.203) (-2550.589) * [-2548.448] (-2564.592) (-2554.223) (-2545.760) -- 0:01:18 37500 -- (-2549.620) (-2544.909) (-2552.283) [-2550.365] * (-2549.743) (-2562.365) (-2559.029) [-2544.946] -- 0:01:17 38000 -- (-2548.310) (-2546.864) [-2548.715] (-2551.094) * (-2547.633) [-2557.460] (-2554.867) (-2544.540) -- 0:01:15 38500 -- (-2545.966) (-2546.530) [-2552.186] (-2546.391) * (-2546.429) [-2555.834] (-2551.267) (-2544.524) -- 0:01:14 39000 -- (-2546.116) [-2546.993] (-2556.245) (-2546.000) * [-2545.842] (-2557.280) (-2558.638) (-2544.418) -- 0:01:13 39500 -- (-2552.471) (-2546.555) (-2556.528) [-2546.910] * [-2546.694] (-2556.756) (-2560.081) (-2544.924) -- 0:01:12 40000 -- (-2552.325) [-2548.893] (-2558.462) (-2546.443) * (-2546.264) [-2551.698] (-2551.992) (-2544.244) -- 0:01:12 Average standard deviation of split frequencies: 0.042097 40500 -- (-2552.187) (-2546.806) (-2556.454) [-2547.373] * (-2547.020) (-2554.179) [-2554.538] (-2544.244) -- 0:01:11 41000 -- [-2547.749] (-2548.711) (-2552.137) (-2545.802) * [-2547.242] (-2554.894) (-2557.619) (-2545.333) -- 0:01:10 41500 -- (-2547.919) (-2546.855) (-2557.058) [-2546.050] * (-2548.176) (-2561.043) [-2551.496] (-2545.065) -- 0:01:09 42000 -- (-2548.602) (-2545.961) (-2554.582) [-2545.692] * (-2547.915) (-2551.857) (-2554.984) [-2545.053] -- 0:01:08 42500 -- (-2545.468) (-2546.080) [-2565.043] (-2545.193) * (-2547.550) (-2556.622) (-2558.603) [-2544.593] -- 0:01:07 43000 -- (-2546.033) (-2548.153) [-2558.114] (-2546.509) * [-2547.112] (-2559.727) (-2558.943) (-2544.688) -- 0:01:06 43500 -- (-2546.102) (-2546.762) [-2554.424] (-2547.942) * (-2545.030) [-2553.078] (-2552.939) (-2548.879) -- 0:01:05 44000 -- (-2546.100) [-2546.166] (-2551.189) (-2546.394) * (-2550.629) (-2560.591) [-2557.364] (-2546.426) -- 0:01:05 44500 -- [-2545.796] (-2545.935) (-2561.421) (-2545.639) * (-2550.138) (-2561.987) (-2557.893) [-2545.190] -- 0:01:04 45000 -- (-2548.984) (-2546.071) (-2563.539) [-2545.262] * (-2546.314) (-2554.247) [-2554.597] (-2547.229) -- 0:01:03 Average standard deviation of split frequencies: 0.033306 45500 -- (-2546.576) (-2546.730) (-2554.805) [-2544.807] * (-2547.157) (-2553.314) (-2555.973) [-2545.631] -- 0:01:23 46000 -- (-2546.339) [-2546.735] (-2555.020) (-2544.926) * [-2544.914] (-2555.287) (-2560.866) (-2545.631) -- 0:01:22 46500 -- (-2546.181) (-2546.735) (-2550.076) [-2548.091] * (-2545.393) (-2552.309) [-2549.482] (-2545.484) -- 0:01:22 47000 -- [-2546.601] (-2546.735) (-2554.679) (-2546.652) * (-2546.159) (-2554.063) (-2559.094) [-2545.515] -- 0:01:21 47500 -- (-2545.710) [-2545.830] (-2554.432) (-2546.799) * (-2546.566) [-2552.613] (-2554.386) (-2547.955) -- 0:01:20 48000 -- (-2548.516) (-2546.554) (-2561.030) [-2549.080] * (-2546.770) [-2550.844] (-2556.906) (-2550.769) -- 0:01:19 48500 -- (-2548.516) (-2546.407) (-2554.734) [-2547.593] * [-2544.180] (-2556.027) (-2558.874) (-2547.019) -- 0:01:18 49000 -- (-2549.003) (-2545.867) (-2561.504) [-2548.058] * [-2546.469] (-2552.971) (-2558.270) (-2547.299) -- 0:01:17 49500 -- (-2546.316) [-2547.839] (-2557.529) (-2550.120) * (-2547.710) (-2559.441) [-2550.349] (-2544.266) -- 0:01:16 50000 -- (-2546.246) [-2548.350] (-2553.091) (-2550.108) * [-2545.082] (-2558.536) (-2554.335) (-2544.939) -- 0:01:16 Average standard deviation of split frequencies: 0.038858 50500 -- (-2546.595) (-2546.032) (-2564.484) [-2547.809] * [-2545.223] (-2554.781) (-2554.626) (-2545.162) -- 0:01:15 51000 -- [-2546.433] (-2545.734) (-2558.771) (-2546.692) * (-2547.988) [-2557.218] (-2552.471) (-2546.108) -- 0:01:14 51500 -- (-2545.134) (-2547.266) [-2558.861] (-2544.827) * (-2545.190) (-2551.272) (-2555.000) [-2544.638] -- 0:01:13 52000 -- (-2544.580) [-2549.079] (-2550.771) (-2545.756) * (-2545.189) (-2558.232) (-2554.270) [-2544.526] -- 0:01:12 52500 -- (-2544.586) [-2548.093] (-2556.907) (-2545.470) * (-2545.166) (-2557.117) (-2550.133) [-2546.324] -- 0:01:12 53000 -- [-2545.074] (-2546.614) (-2554.324) (-2545.187) * (-2545.166) [-2553.351] (-2558.865) (-2546.585) -- 0:01:11 53500 -- (-2545.262) (-2551.938) (-2558.915) [-2544.408] * (-2545.309) (-2558.402) [-2550.984] (-2547.527) -- 0:01:10 54000 -- (-2545.267) (-2552.080) (-2554.259) [-2544.119] * (-2548.339) (-2564.030) (-2552.001) [-2547.658] -- 0:01:10 54500 -- [-2545.815] (-2552.428) (-2551.506) (-2544.375) * (-2547.629) (-2563.117) [-2559.916] (-2547.540) -- 0:01:09 55000 -- (-2547.166) (-2550.492) [-2550.974] (-2544.937) * (-2545.978) (-2560.228) [-2552.852] (-2547.810) -- 0:01:08 Average standard deviation of split frequencies: 0.033672 55500 -- (-2546.494) (-2548.019) [-2562.179] (-2544.973) * [-2550.133] (-2560.194) (-2557.909) (-2546.438) -- 0:01:08 56000 -- (-2547.483) (-2548.666) [-2553.265] (-2544.189) * (-2544.434) [-2556.832] (-2552.972) (-2546.670) -- 0:01:07 56500 -- [-2545.900] (-2547.799) (-2554.947) (-2544.836) * (-2544.729) (-2554.695) [-2553.922] (-2544.321) -- 0:01:06 57000 -- (-2550.707) (-2545.851) (-2554.282) [-2545.387] * (-2547.344) (-2558.152) (-2553.302) [-2545.558] -- 0:01:06 57500 -- (-2545.604) [-2544.931] (-2551.380) (-2549.290) * (-2544.972) (-2555.952) [-2553.165] (-2545.549) -- 0:01:05 58000 -- (-2545.483) [-2544.782] (-2561.054) (-2544.791) * (-2544.126) (-2553.755) [-2555.078] (-2548.454) -- 0:01:04 58500 -- (-2545.483) [-2544.555] (-2553.670) (-2545.290) * [-2543.995] (-2555.463) (-2557.461) (-2548.252) -- 0:01:04 59000 -- [-2546.204] (-2544.565) (-2563.031) (-2550.592) * [-2544.314] (-2559.730) (-2560.187) (-2546.077) -- 0:01:03 59500 -- (-2545.464) [-2544.833] (-2550.319) (-2545.204) * (-2544.317) (-2560.964) [-2553.036] (-2545.906) -- 0:01:03 60000 -- (-2545.101) (-2546.114) [-2554.507] (-2548.862) * (-2544.317) (-2564.534) (-2557.961) [-2547.658] -- 0:01:02 Average standard deviation of split frequencies: 0.037216 60500 -- (-2546.421) [-2545.709] (-2554.506) (-2553.312) * (-2545.853) (-2560.899) (-2556.068) [-2548.770] -- 0:01:17 61000 -- (-2546.262) [-2546.141] (-2550.609) (-2552.237) * [-2544.093] (-2554.498) (-2550.786) (-2547.175) -- 0:01:16 61500 -- (-2545.651) (-2547.235) (-2555.448) [-2548.810] * (-2544.706) (-2551.467) [-2547.366] (-2546.104) -- 0:01:16 62000 -- [-2546.882] (-2544.825) (-2557.961) (-2548.443) * (-2544.706) (-2550.499) (-2545.345) [-2547.510] -- 0:01:15 62500 -- (-2545.702) (-2547.059) [-2549.433] (-2545.923) * [-2545.686] (-2551.345) (-2544.636) (-2545.478) -- 0:01:15 63000 -- [-2546.895] (-2548.398) (-2553.171) (-2547.550) * (-2544.970) (-2556.621) [-2547.835] (-2545.962) -- 0:01:14 63500 -- (-2550.903) (-2548.336) (-2560.497) [-2549.946] * (-2549.341) (-2555.375) (-2547.166) [-2547.112] -- 0:01:13 64000 -- (-2544.565) (-2545.449) (-2552.009) [-2551.397] * [-2545.728] (-2557.216) (-2547.728) (-2545.639) -- 0:01:13 64500 -- [-2545.697] (-2544.546) (-2559.899) (-2551.330) * (-2547.845) (-2556.248) [-2545.322] (-2545.030) -- 0:01:12 65000 -- [-2545.343] (-2545.660) (-2557.452) (-2545.918) * (-2545.377) (-2551.726) (-2548.482) [-2544.890] -- 0:01:11 Average standard deviation of split frequencies: 0.031577 65500 -- (-2546.562) [-2544.439] (-2556.545) (-2548.818) * [-2545.118] (-2569.423) (-2546.302) (-2547.159) -- 0:01:11 66000 -- [-2546.776] (-2545.071) (-2551.993) (-2548.956) * (-2545.643) (-2555.802) (-2544.744) [-2545.212] -- 0:01:10 66500 -- [-2544.618] (-2546.199) (-2546.759) (-2553.076) * (-2546.126) [-2552.578] (-2545.798) (-2545.043) -- 0:01:10 67000 -- (-2544.615) [-2545.720] (-2547.543) (-2550.077) * [-2546.299] (-2554.374) (-2545.994) (-2554.304) -- 0:01:09 67500 -- [-2544.803] (-2546.363) (-2547.757) (-2546.380) * (-2545.312) [-2553.541] (-2546.238) (-2546.036) -- 0:01:09 68000 -- (-2544.812) (-2545.989) (-2546.206) [-2545.787] * [-2545.296] (-2553.732) (-2545.866) (-2546.513) -- 0:01:08 68500 -- [-2545.369] (-2548.905) (-2546.253) (-2549.489) * (-2545.080) [-2553.604] (-2545.522) (-2545.320) -- 0:01:07 69000 -- (-2547.538) (-2545.285) (-2546.420) [-2548.912] * (-2548.061) (-2552.040) (-2547.121) [-2545.387] -- 0:01:07 69500 -- (-2544.436) (-2546.278) (-2545.075) [-2545.637] * (-2544.806) (-2558.788) [-2545.970] (-2544.950) -- 0:01:06 70000 -- [-2544.423] (-2550.430) (-2544.883) (-2545.090) * (-2545.341) (-2560.910) (-2546.010) [-2548.502] -- 0:01:06 Average standard deviation of split frequencies: 0.027795 70500 -- (-2545.415) (-2549.175) [-2545.784] (-2547.081) * (-2545.159) (-2551.712) (-2546.211) [-2545.192] -- 0:01:05 71000 -- (-2544.563) (-2546.780) (-2547.785) [-2545.795] * (-2545.091) (-2555.179) [-2548.185] (-2545.706) -- 0:01:05 71500 -- (-2546.929) [-2546.694] (-2545.870) (-2545.621) * (-2544.928) (-2556.245) [-2544.831] (-2545.063) -- 0:01:04 72000 -- [-2545.020] (-2546.378) (-2546.567) (-2546.578) * (-2544.333) (-2557.937) (-2545.885) [-2547.097] -- 0:01:04 72500 -- (-2545.628) (-2547.584) [-2545.197] (-2546.643) * (-2544.840) [-2552.609] (-2544.824) (-2548.386) -- 0:01:03 73000 -- (-2547.787) (-2549.931) [-2545.197] (-2545.717) * (-2544.856) (-2558.391) [-2545.229] (-2547.076) -- 0:01:03 73500 -- (-2547.804) (-2550.604) [-2544.868] (-2546.903) * (-2545.212) [-2554.277] (-2547.607) (-2548.321) -- 0:01:03 74000 -- [-2544.859] (-2550.270) (-2544.158) (-2549.095) * [-2545.159] (-2555.339) (-2547.607) (-2551.139) -- 0:01:02 74500 -- [-2544.809] (-2545.458) (-2548.633) (-2546.593) * [-2545.174] (-2561.421) (-2547.794) (-2551.519) -- 0:01:02 75000 -- (-2545.475) [-2545.020] (-2546.011) (-2544.358) * [-2545.764] (-2559.508) (-2545.837) (-2546.388) -- 0:01:14 Average standard deviation of split frequencies: 0.025500 75500 -- (-2544.529) (-2544.445) [-2544.670] (-2544.776) * (-2549.221) (-2562.625) [-2545.702] (-2545.891) -- 0:01:13 76000 -- (-2545.543) (-2544.594) (-2544.663) [-2545.003] * (-2545.765) (-2555.596) [-2545.702] (-2547.234) -- 0:01:12 76500 -- (-2544.540) (-2544.251) (-2546.027) [-2544.893] * (-2545.343) (-2567.024) [-2545.702] (-2547.211) -- 0:01:12 77000 -- (-2544.863) [-2544.477] (-2544.365) (-2544.848) * (-2544.789) (-2560.038) [-2553.927] (-2546.837) -- 0:01:11 77500 -- (-2544.710) (-2546.544) [-2544.935] (-2544.974) * (-2544.976) (-2551.711) [-2544.445] (-2547.824) -- 0:01:11 78000 -- (-2544.734) [-2546.546] (-2545.812) (-2545.338) * [-2544.808] (-2554.553) (-2547.690) (-2549.802) -- 0:01:10 78500 -- (-2547.877) [-2544.674] (-2544.438) (-2547.002) * (-2546.229) (-2552.231) [-2545.663] (-2547.895) -- 0:01:10 79000 -- (-2549.945) [-2544.663] (-2545.244) (-2547.182) * (-2545.294) (-2552.855) [-2548.923] (-2547.588) -- 0:01:09 79500 -- (-2546.408) (-2546.592) (-2544.953) [-2547.031] * (-2544.629) (-2553.203) [-2545.426] (-2548.307) -- 0:01:09 80000 -- (-2548.932) (-2549.139) [-2545.483] (-2549.630) * (-2545.294) [-2551.304] (-2545.426) (-2549.621) -- 0:01:09 Average standard deviation of split frequencies: 0.023051 80500 -- [-2549.733] (-2549.141) (-2546.214) (-2551.441) * (-2544.477) [-2556.255] (-2547.357) (-2549.749) -- 0:01:08 81000 -- (-2550.899) (-2548.695) [-2547.272] (-2549.083) * (-2549.713) (-2553.463) (-2547.357) [-2548.654] -- 0:01:08 81500 -- (-2548.522) (-2548.205) [-2545.431] (-2548.676) * [-2548.597] (-2560.934) (-2549.834) (-2553.152) -- 0:01:07 82000 -- (-2547.877) (-2547.337) [-2545.428] (-2549.541) * (-2547.891) (-2553.417) (-2548.267) [-2548.261] -- 0:01:07 82500 -- (-2546.595) (-2547.702) [-2551.637] (-2548.848) * (-2545.943) [-2554.675] (-2546.684) (-2548.427) -- 0:01:06 83000 -- (-2546.260) (-2550.414) [-2549.689] (-2548.751) * (-2545.845) (-2546.262) [-2546.052] (-2547.521) -- 0:01:06 83500 -- (-2547.619) [-2548.647] (-2545.064) (-2549.355) * (-2545.684) [-2546.296] (-2546.776) (-2550.696) -- 0:01:05 84000 -- [-2547.160] (-2548.390) (-2545.746) (-2549.333) * (-2546.826) (-2548.318) [-2547.243] (-2545.401) -- 0:01:05 84500 -- (-2547.775) [-2546.529] (-2545.578) (-2549.378) * [-2547.263] (-2547.010) (-2545.478) (-2545.549) -- 0:01:05 85000 -- (-2546.800) (-2546.390) [-2545.741] (-2546.522) * (-2546.296) [-2546.122] (-2547.170) (-2545.897) -- 0:01:04 Average standard deviation of split frequencies: 0.020708 85500 -- [-2547.542] (-2547.659) (-2546.321) (-2547.570) * (-2544.743) [-2544.554] (-2545.929) (-2545.897) -- 0:01:04 86000 -- [-2545.742] (-2546.192) (-2545.424) (-2546.381) * (-2544.734) [-2544.556] (-2549.577) (-2547.001) -- 0:01:03 86500 -- (-2545.814) (-2546.055) [-2545.697] (-2546.449) * (-2545.472) (-2544.553) [-2550.379] (-2547.097) -- 0:01:03 87000 -- (-2545.128) [-2547.353] (-2544.794) (-2545.650) * [-2547.837] (-2546.320) (-2548.795) (-2547.923) -- 0:01:02 87500 -- (-2544.466) (-2545.930) [-2548.498] (-2546.492) * (-2547.186) [-2547.080] (-2546.133) (-2546.992) -- 0:01:02 88000 -- [-2544.751] (-2546.085) (-2549.331) (-2548.746) * (-2546.705) (-2547.313) (-2546.139) [-2549.464] -- 0:01:02 88500 -- [-2544.847] (-2548.481) (-2549.079) (-2550.313) * (-2546.337) (-2548.646) (-2544.657) [-2549.115] -- 0:01:01 89000 -- (-2546.099) [-2550.067] (-2547.410) (-2547.638) * (-2545.607) (-2548.886) (-2544.783) [-2548.373] -- 0:01:01 89500 -- (-2545.970) (-2547.756) (-2544.663) [-2545.609] * (-2545.059) (-2548.869) [-2545.343] (-2550.513) -- 0:01:01 90000 -- (-2548.285) [-2547.487] (-2545.310) (-2544.285) * (-2544.520) (-2546.667) [-2544.902] (-2548.671) -- 0:01:10 Average standard deviation of split frequencies: 0.018962 90500 -- [-2545.245] (-2547.345) (-2545.227) (-2544.883) * [-2544.302] (-2545.840) (-2544.922) (-2546.716) -- 0:01:10 91000 -- (-2546.582) (-2547.346) (-2544.903) [-2545.341] * [-2544.370] (-2546.602) (-2544.731) (-2546.201) -- 0:01:09 91500 -- (-2544.382) (-2545.937) [-2544.434] (-2544.826) * (-2545.785) [-2547.863] (-2545.022) (-2546.209) -- 0:01:09 92000 -- (-2544.386) (-2545.241) [-2544.630] (-2544.791) * [-2545.109] (-2546.216) (-2546.536) (-2547.435) -- 0:01:09 92500 -- (-2544.400) (-2550.654) [-2544.836] (-2544.677) * (-2545.602) (-2545.856) (-2550.398) [-2549.983] -- 0:01:08 93000 -- (-2545.610) (-2549.745) [-2545.639] (-2544.372) * (-2544.462) [-2546.306] (-2548.112) (-2548.415) -- 0:01:08 93500 -- (-2545.650) (-2544.619) (-2547.270) [-2544.372] * [-2547.239] (-2545.581) (-2546.582) (-2545.014) -- 0:01:07 94000 -- (-2547.867) (-2545.933) (-2547.165) [-2544.753] * [-2545.419] (-2544.789) (-2546.466) (-2544.876) -- 0:01:07 94500 -- (-2547.242) [-2546.150] (-2544.462) (-2544.540) * (-2545.527) [-2547.443] (-2545.046) (-2546.135) -- 0:01:07 95000 -- (-2546.919) (-2545.264) [-2544.608] (-2544.576) * (-2549.041) [-2545.228] (-2548.359) (-2546.772) -- 0:01:06 Average standard deviation of split frequencies: 0.019096 95500 -- (-2544.942) (-2544.723) [-2544.463] (-2544.589) * (-2547.335) (-2545.629) [-2544.719] (-2544.913) -- 0:01:06 96000 -- [-2544.186] (-2544.451) (-2544.450) (-2547.330) * [-2547.426] (-2544.477) (-2544.716) (-2545.013) -- 0:01:05 96500 -- (-2545.919) (-2544.623) [-2544.437] (-2547.421) * [-2548.287] (-2546.000) (-2544.422) (-2545.060) -- 0:01:05 97000 -- [-2545.930] (-2545.175) (-2545.394) (-2550.154) * (-2550.399) (-2545.029) [-2544.422] (-2545.048) -- 0:01:05 97500 -- (-2546.107) (-2548.765) (-2546.249) [-2546.761] * (-2548.278) (-2546.293) [-2544.701] (-2545.767) -- 0:01:04 98000 -- (-2544.656) [-2546.094] (-2544.654) (-2545.422) * (-2547.226) (-2552.243) (-2544.689) [-2546.646] -- 0:01:04 98500 -- [-2546.778] (-2546.188) (-2545.161) (-2545.628) * (-2548.076) [-2545.398] (-2546.702) (-2546.050) -- 0:01:04 99000 -- (-2544.599) (-2544.814) [-2546.898] (-2545.263) * [-2545.834] (-2544.753) (-2547.855) (-2545.443) -- 0:01:03 99500 -- (-2544.369) (-2545.078) [-2550.622] (-2545.940) * [-2545.956] (-2545.217) (-2546.429) (-2545.717) -- 0:01:03 100000 -- (-2549.789) [-2545.074] (-2547.581) (-2546.147) * (-2548.158) (-2550.411) (-2544.751) [-2548.074] -- 0:01:02 Average standard deviation of split frequencies: 0.017499 100500 -- [-2548.164] (-2545.051) (-2547.603) (-2545.538) * (-2548.587) (-2548.268) (-2544.626) [-2545.219] -- 0:01:02 101000 -- (-2544.859) [-2550.718] (-2547.390) (-2546.615) * (-2547.711) (-2546.470) (-2548.306) [-2545.776] -- 0:01:02 101500 -- (-2546.555) (-2548.808) (-2548.031) [-2546.635] * (-2547.116) [-2545.452] (-2544.957) (-2546.333) -- 0:01:01 102000 -- (-2545.765) [-2545.832] (-2547.468) (-2549.984) * (-2545.612) (-2545.839) [-2544.512] (-2546.279) -- 0:01:01 102500 -- (-2548.312) (-2548.515) [-2544.717] (-2548.625) * (-2546.852) [-2545.585] (-2544.323) (-2545.903) -- 0:01:01 103000 -- (-2546.923) (-2548.729) [-2547.079] (-2551.129) * (-2548.705) (-2545.671) [-2544.354] (-2549.199) -- 0:01:00 103500 -- (-2546.911) (-2546.805) (-2547.515) [-2547.161] * (-2549.250) (-2547.098) (-2545.040) [-2545.021] -- 0:01:00 104000 -- (-2546.727) (-2547.173) (-2547.986) [-2545.970] * [-2548.161] (-2545.480) (-2544.486) (-2547.034) -- 0:01:00 104500 -- (-2545.708) [-2545.055] (-2545.546) (-2550.176) * (-2546.996) [-2546.296] (-2545.960) (-2547.033) -- 0:01:08 105000 -- (-2546.473) [-2544.596] (-2545.725) (-2550.022) * (-2549.610) [-2546.429] (-2544.983) (-2547.709) -- 0:01:08 Average standard deviation of split frequencies: 0.016677 105500 -- (-2545.959) [-2544.596] (-2550.006) (-2551.218) * (-2548.409) (-2547.358) (-2545.618) [-2546.448] -- 0:01:07 106000 -- (-2546.183) [-2544.535] (-2549.516) (-2549.118) * (-2546.505) (-2547.314) (-2547.998) [-2548.424] -- 0:01:07 106500 -- (-2546.050) (-2548.085) [-2550.676] (-2547.916) * [-2547.104] (-2547.848) (-2548.000) (-2548.224) -- 0:01:07 107000 -- (-2546.707) [-2546.464] (-2546.786) (-2549.950) * (-2547.360) [-2547.537] (-2547.660) (-2551.145) -- 0:01:06 107500 -- (-2547.840) (-2546.135) [-2546.782] (-2545.331) * (-2545.992) (-2547.383) [-2546.859] (-2549.036) -- 0:01:06 108000 -- (-2547.017) (-2547.435) (-2546.689) [-2545.334] * (-2545.423) (-2546.393) (-2552.108) [-2547.432] -- 0:01:06 108500 -- (-2546.353) (-2549.002) (-2546.198) [-2545.335] * (-2547.499) (-2544.998) (-2548.074) [-2548.324] -- 0:01:05 109000 -- [-2546.272] (-2547.288) (-2547.621) (-2545.123) * (-2545.041) [-2546.054] (-2547.188) (-2549.311) -- 0:01:05 109500 -- (-2547.047) [-2549.681] (-2547.054) (-2547.240) * (-2547.116) (-2546.536) [-2545.314] (-2545.391) -- 0:01:05 110000 -- (-2546.360) [-2546.884] (-2546.367) (-2545.475) * (-2548.169) [-2545.587] (-2548.958) (-2544.447) -- 0:01:04 Average standard deviation of split frequencies: 0.017444 110500 -- (-2548.423) [-2549.712] (-2548.419) (-2549.424) * (-2547.153) [-2545.508] (-2547.825) (-2547.757) -- 0:01:04 111000 -- [-2549.863] (-2547.705) (-2546.419) (-2544.632) * (-2546.558) [-2546.337] (-2548.617) (-2546.873) -- 0:01:04 111500 -- (-2548.565) (-2547.406) (-2548.083) [-2544.632] * (-2547.367) [-2549.416] (-2548.235) (-2546.978) -- 0:01:03 112000 -- [-2548.112] (-2546.061) (-2546.507) (-2544.604) * (-2546.660) [-2547.201] (-2548.419) (-2546.746) -- 0:01:03 112500 -- (-2545.092) [-2545.075] (-2546.805) (-2545.454) * (-2544.256) (-2548.108) (-2549.144) [-2546.824] -- 0:01:03 113000 -- (-2545.240) (-2545.898) [-2546.189] (-2548.062) * (-2545.181) [-2546.252] (-2548.295) (-2545.288) -- 0:01:02 113500 -- (-2545.475) [-2548.839] (-2548.330) (-2547.334) * (-2548.513) [-2545.522] (-2547.703) (-2548.318) -- 0:01:02 114000 -- (-2545.376) (-2547.322) [-2545.312] (-2546.088) * (-2547.765) [-2546.785] (-2548.395) (-2546.079) -- 0:01:02 114500 -- (-2545.441) (-2547.254) [-2545.505] (-2546.067) * (-2552.870) (-2547.819) (-2544.743) [-2546.127] -- 0:01:01 115000 -- [-2545.043] (-2549.019) (-2547.841) (-2549.710) * (-2549.854) [-2547.433] (-2544.468) (-2546.510) -- 0:01:01 Average standard deviation of split frequencies: 0.019100 115500 -- (-2545.210) (-2549.575) [-2546.213] (-2548.506) * [-2550.340] (-2547.601) (-2545.310) (-2547.687) -- 0:01:01 116000 -- (-2547.173) [-2545.976] (-2547.431) (-2546.147) * (-2547.048) (-2550.927) [-2544.833] (-2546.152) -- 0:01:00 116500 -- (-2544.616) (-2544.415) (-2546.890) [-2545.814] * [-2546.728] (-2551.200) (-2545.061) (-2544.563) -- 0:01:00 117000 -- [-2544.163] (-2544.862) (-2545.127) (-2545.485) * (-2544.921) (-2550.839) [-2545.528] (-2546.621) -- 0:01:00 117500 -- (-2548.014) (-2549.587) (-2549.274) [-2547.682] * [-2545.065] (-2547.729) (-2544.738) (-2546.621) -- 0:01:00 118000 -- (-2545.731) [-2546.206] (-2547.002) (-2546.406) * (-2545.318) (-2545.789) [-2544.783] (-2547.282) -- 0:00:59 118500 -- (-2545.590) [-2546.269] (-2545.628) (-2548.921) * (-2549.554) (-2546.705) (-2544.793) [-2548.132] -- 0:00:59 119000 -- (-2547.389) [-2547.459] (-2547.368) (-2549.284) * (-2546.386) [-2547.653] (-2544.513) (-2545.280) -- 0:01:06 119500 -- (-2548.125) (-2546.264) [-2546.637] (-2548.333) * (-2544.991) [-2544.455] (-2544.863) (-2545.280) -- 0:01:06 120000 -- (-2546.325) (-2546.566) [-2546.651] (-2545.263) * (-2545.217) (-2547.325) [-2545.256] (-2545.280) -- 0:01:06 Average standard deviation of split frequencies: 0.019739 120500 -- (-2549.698) (-2546.116) (-2549.551) [-2545.279] * (-2545.107) (-2546.289) [-2545.878] (-2545.074) -- 0:01:05 121000 -- (-2547.460) (-2546.116) [-2546.302] (-2545.380) * (-2545.540) (-2546.536) [-2546.261] (-2545.070) -- 0:01:05 121500 -- [-2547.224] (-2546.239) (-2545.903) (-2545.850) * (-2545.801) (-2545.708) (-2547.170) [-2545.439] -- 0:01:05 122000 -- (-2547.810) (-2546.031) [-2545.866] (-2549.679) * [-2546.037] (-2544.524) (-2547.142) (-2545.606) -- 0:01:04 122500 -- (-2549.477) (-2545.318) [-2545.775] (-2546.339) * (-2547.805) [-2544.792] (-2547.894) (-2544.880) -- 0:01:04 123000 -- [-2547.476] (-2548.630) (-2545.705) (-2547.544) * (-2549.864) (-2546.110) [-2547.930] (-2547.932) -- 0:01:04 123500 -- [-2547.838] (-2544.942) (-2548.726) (-2545.847) * (-2549.272) (-2546.135) (-2548.208) [-2548.689] -- 0:01:03 124000 -- (-2547.925) (-2545.635) (-2547.276) [-2545.319] * [-2551.690] (-2544.554) (-2545.472) (-2545.542) -- 0:01:03 124500 -- (-2547.646) [-2545.250] (-2545.964) (-2545.757) * (-2552.469) [-2549.246] (-2546.403) (-2545.214) -- 0:01:03 125000 -- (-2548.928) (-2545.148) (-2548.237) [-2545.880] * (-2549.027) [-2545.322] (-2544.711) (-2545.404) -- 0:01:03 Average standard deviation of split frequencies: 0.019775 125500 -- (-2545.273) [-2545.577] (-2552.247) (-2546.018) * (-2547.990) [-2548.409] (-2545.893) (-2545.684) -- 0:01:02 126000 -- (-2545.175) [-2545.080] (-2545.629) (-2545.520) * [-2546.972] (-2546.386) (-2545.687) (-2548.511) -- 0:01:02 126500 -- (-2545.360) (-2546.871) [-2545.249] (-2545.782) * (-2550.833) [-2545.650] (-2544.863) (-2547.538) -- 0:01:02 127000 -- (-2544.819) (-2545.713) (-2544.937) [-2546.878] * [-2545.545] (-2548.292) (-2545.626) (-2546.500) -- 0:01:01 127500 -- [-2544.219] (-2547.229) (-2545.645) (-2550.448) * (-2546.165) (-2548.309) [-2550.820] (-2545.581) -- 0:01:01 128000 -- (-2545.116) (-2544.356) [-2544.888] (-2545.520) * (-2547.131) [-2548.852] (-2546.123) (-2546.430) -- 0:01:01 128500 -- (-2546.988) (-2546.948) (-2544.457) [-2545.225] * (-2548.043) [-2549.541] (-2544.345) (-2545.341) -- 0:01:01 129000 -- (-2546.797) [-2545.394] (-2546.311) (-2546.841) * [-2546.707] (-2546.884) (-2544.913) (-2546.517) -- 0:01:00 129500 -- (-2545.588) (-2546.917) [-2544.259] (-2546.841) * (-2545.136) [-2546.222] (-2544.814) (-2545.052) -- 0:01:00 130000 -- (-2550.020) [-2546.643] (-2544.932) (-2544.505) * (-2545.436) (-2550.046) [-2543.991] (-2544.912) -- 0:01:00 Average standard deviation of split frequencies: 0.017279 130500 -- [-2548.553] (-2547.442) (-2544.785) (-2545.483) * (-2546.901) (-2548.550) [-2544.765] (-2544.652) -- 0:00:59 131000 -- (-2550.042) (-2547.005) [-2544.723] (-2545.628) * (-2546.060) (-2548.159) [-2545.236] (-2547.554) -- 0:00:59 131500 -- (-2549.855) (-2548.868) (-2544.456) [-2545.676] * (-2545.557) (-2550.874) (-2544.311) [-2547.513] -- 0:00:59 132000 -- [-2546.442] (-2544.890) (-2547.745) (-2546.331) * (-2547.386) (-2551.959) (-2544.311) [-2545.529] -- 0:00:59 132500 -- (-2546.001) (-2544.247) [-2546.169] (-2545.449) * (-2548.557) [-2545.740] (-2544.244) (-2547.558) -- 0:00:58 133000 -- (-2546.695) (-2544.848) [-2544.577] (-2545.286) * (-2547.882) [-2548.472] (-2544.063) (-2546.949) -- 0:00:58 133500 -- (-2546.546) (-2546.154) [-2545.212] (-2548.757) * (-2546.285) (-2548.472) (-2546.007) [-2546.594] -- 0:00:58 134000 -- [-2547.059] (-2546.467) (-2549.616) (-2550.887) * (-2546.662) [-2547.995] (-2546.483) (-2544.995) -- 0:01:04 134500 -- [-2546.832] (-2545.863) (-2550.781) (-2552.212) * [-2544.936] (-2552.468) (-2545.038) (-2547.031) -- 0:01:04 135000 -- [-2546.820] (-2545.903) (-2548.188) (-2552.574) * (-2544.679) [-2546.850] (-2545.135) (-2547.580) -- 0:01:04 Average standard deviation of split frequencies: 0.015598 135500 -- (-2545.332) (-2546.172) [-2547.056] (-2545.968) * (-2546.175) [-2548.196] (-2546.995) (-2549.560) -- 0:01:03 136000 -- (-2544.975) (-2546.875) [-2546.608] (-2545.968) * (-2546.277) (-2549.029) (-2546.946) [-2544.168] -- 0:01:03 136500 -- (-2544.921) [-2546.201] (-2545.603) (-2546.713) * [-2546.996] (-2547.560) (-2546.141) (-2544.352) -- 0:01:03 137000 -- (-2544.648) (-2547.435) [-2544.785] (-2546.578) * (-2546.252) (-2547.219) (-2546.174) [-2544.051] -- 0:01:02 137500 -- (-2549.370) (-2545.953) [-2544.430] (-2547.175) * (-2544.333) [-2547.100] (-2547.797) (-2543.983) -- 0:01:02 138000 -- (-2549.777) [-2547.828] (-2544.824) (-2546.053) * (-2543.990) (-2546.702) (-2545.817) [-2547.459] -- 0:01:02 138500 -- (-2546.309) (-2550.095) [-2545.305] (-2546.730) * (-2544.606) [-2548.034] (-2547.059) (-2545.782) -- 0:01:02 139000 -- (-2546.033) (-2548.493) (-2547.424) [-2550.408] * (-2545.348) (-2546.516) (-2547.472) [-2546.359] -- 0:01:01 139500 -- [-2544.813] (-2548.749) (-2547.773) (-2549.612) * [-2547.388] (-2545.925) (-2545.843) (-2547.761) -- 0:01:01 140000 -- (-2546.778) (-2549.511) [-2549.212] (-2545.973) * (-2545.071) [-2546.145] (-2545.838) (-2546.968) -- 0:01:01 Average standard deviation of split frequencies: 0.015453 140500 -- [-2546.782] (-2550.076) (-2546.877) (-2545.308) * (-2544.789) [-2545.113] (-2544.970) (-2546.339) -- 0:01:01 141000 -- (-2546.358) (-2547.881) [-2546.880] (-2546.015) * (-2545.008) [-2547.978] (-2544.395) (-2546.628) -- 0:01:00 141500 -- (-2546.424) (-2548.386) (-2544.849) [-2545.894] * (-2546.615) [-2545.359] (-2544.654) (-2545.895) -- 0:01:00 142000 -- (-2546.477) [-2548.242] (-2544.824) (-2546.227) * (-2546.615) (-2544.823) (-2544.676) [-2548.172] -- 0:01:00 142500 -- (-2547.909) (-2546.400) [-2544.812] (-2546.191) * (-2547.175) (-2545.342) (-2546.012) [-2546.482] -- 0:01:00 143000 -- (-2545.421) (-2546.916) (-2544.813) [-2546.192] * (-2545.971) (-2544.787) [-2547.383] (-2545.189) -- 0:00:59 143500 -- [-2546.210] (-2546.452) (-2544.557) (-2547.009) * (-2545.758) (-2545.417) [-2547.382] (-2545.614) -- 0:00:59 144000 -- (-2545.558) (-2549.067) (-2548.026) [-2544.885] * (-2545.051) [-2547.674] (-2545.948) (-2545.615) -- 0:00:59 144500 -- [-2546.158] (-2550.707) (-2548.457) (-2544.963) * (-2545.028) [-2546.152] (-2545.948) (-2546.218) -- 0:00:59 145000 -- (-2545.389) (-2548.563) [-2547.140] (-2545.092) * (-2545.556) (-2547.578) [-2548.229] (-2545.345) -- 0:00:58 Average standard deviation of split frequencies: 0.015124 145500 -- (-2547.237) (-2550.660) [-2545.536] (-2545.123) * (-2545.471) [-2544.192] (-2544.450) (-2545.320) -- 0:00:58 146000 -- [-2547.687] (-2547.689) (-2546.625) (-2544.882) * [-2546.234] (-2548.469) (-2546.318) (-2544.973) -- 0:00:58 146500 -- (-2546.484) [-2545.049] (-2547.722) (-2545.944) * (-2545.404) (-2544.814) [-2546.936] (-2545.856) -- 0:00:58 147000 -- (-2546.364) [-2545.776] (-2544.649) (-2546.938) * [-2547.332] (-2544.317) (-2549.025) (-2546.401) -- 0:00:58 147500 -- (-2548.025) (-2545.939) [-2545.876] (-2545.615) * [-2549.257] (-2544.317) (-2547.930) (-2544.630) -- 0:00:57 148000 -- (-2544.988) (-2545.025) [-2548.535] (-2545.594) * [-2546.478] (-2545.034) (-2544.195) (-2545.483) -- 0:00:57 148500 -- (-2545.133) (-2545.185) [-2548.997] (-2545.429) * (-2546.690) (-2547.849) [-2546.085] (-2546.555) -- 0:01:03 149000 -- (-2546.188) (-2544.712) (-2549.792) [-2546.559] * (-2545.284) [-2545.441] (-2547.339) (-2546.550) -- 0:01:02 149500 -- (-2548.643) (-2546.018) [-2546.652] (-2546.622) * (-2548.418) (-2546.029) [-2544.510] (-2547.828) -- 0:01:02 150000 -- (-2548.665) (-2546.424) [-2545.947] (-2551.142) * (-2547.030) (-2546.211) [-2544.752] (-2547.506) -- 0:01:02 Average standard deviation of split frequencies: 0.013668 150500 -- (-2548.852) (-2545.835) [-2545.824] (-2548.890) * (-2547.452) (-2544.656) [-2544.716] (-2546.805) -- 0:01:02 151000 -- (-2548.186) (-2545.518) [-2545.836] (-2550.767) * (-2546.327) [-2545.377] (-2544.741) (-2548.507) -- 0:01:01 151500 -- (-2546.561) (-2547.282) [-2547.207] (-2551.161) * (-2547.155) (-2546.817) [-2544.816] (-2548.356) -- 0:01:01 152000 -- [-2545.772] (-2545.933) (-2547.479) (-2553.577) * [-2546.797] (-2545.358) (-2545.637) (-2550.690) -- 0:01:01 152500 -- (-2544.671) [-2545.282] (-2547.495) (-2551.032) * (-2547.902) [-2545.302] (-2547.478) (-2547.583) -- 0:01:01 153000 -- [-2546.344] (-2545.954) (-2548.778) (-2549.014) * (-2548.151) (-2545.868) [-2546.008] (-2547.323) -- 0:01:00 153500 -- (-2549.289) (-2544.823) [-2547.702] (-2552.820) * [-2547.176] (-2545.714) (-2545.759) (-2546.235) -- 0:01:00 154000 -- (-2548.264) [-2544.467] (-2545.640) (-2549.865) * (-2546.010) (-2544.389) (-2544.411) [-2546.887] -- 0:01:00 154500 -- (-2549.186) (-2548.251) (-2546.905) [-2548.187] * (-2546.927) (-2545.666) (-2545.178) [-2544.596] -- 0:01:00 155000 -- (-2549.175) (-2545.022) [-2545.124] (-2547.238) * (-2546.109) (-2545.011) [-2545.178] (-2544.828) -- 0:00:59 Average standard deviation of split frequencies: 0.014605 155500 -- (-2548.067) [-2544.000] (-2546.662) (-2546.888) * (-2546.727) [-2545.938] (-2545.822) (-2544.167) -- 0:00:59 156000 -- (-2546.623) (-2544.000) (-2545.641) [-2548.754] * (-2548.872) (-2547.878) (-2546.261) [-2545.339] -- 0:00:59 156500 -- (-2547.198) [-2544.000] (-2548.134) (-2548.480) * (-2547.778) (-2544.831) [-2549.483] (-2546.075) -- 0:00:59 157000 -- (-2546.629) (-2544.316) (-2547.565) [-2544.547] * (-2547.171) (-2544.327) (-2546.824) [-2545.046] -- 0:00:59 157500 -- (-2545.769) (-2544.722) [-2547.746] (-2548.320) * [-2546.783] (-2545.371) (-2547.649) (-2548.620) -- 0:00:58 158000 -- (-2549.771) (-2545.331) [-2547.714] (-2548.897) * [-2545.082] (-2545.371) (-2544.981) (-2548.854) -- 0:00:58 158500 -- (-2549.306) (-2546.107) (-2552.584) [-2547.639] * (-2544.434) (-2547.461) [-2551.114] (-2548.408) -- 0:00:58 159000 -- (-2550.306) (-2545.649) [-2550.591] (-2545.256) * (-2546.438) [-2544.204] (-2546.810) (-2545.836) -- 0:00:58 159500 -- (-2547.675) (-2546.049) [-2548.199] (-2544.280) * (-2546.536) [-2545.861] (-2547.682) (-2546.306) -- 0:00:57 160000 -- [-2548.147] (-2545.606) (-2545.124) (-2544.290) * (-2545.262) (-2547.244) [-2545.339] (-2546.950) -- 0:00:57 Average standard deviation of split frequencies: 0.013635 160500 -- (-2547.102) (-2545.606) [-2546.090] (-2547.357) * [-2547.679] (-2545.813) (-2545.691) (-2544.184) -- 0:00:57 161000 -- (-2545.844) [-2546.547] (-2545.933) (-2551.869) * (-2546.577) (-2545.221) (-2550.018) [-2544.184] -- 0:00:57 161500 -- (-2544.705) [-2545.159] (-2544.965) (-2545.649) * (-2545.053) (-2545.759) [-2549.959] (-2544.184) -- 0:00:57 162000 -- (-2544.668) (-2547.268) [-2544.834] (-2547.064) * [-2544.687] (-2546.029) (-2546.294) (-2545.022) -- 0:00:56 162500 -- (-2545.417) (-2546.422) [-2546.690] (-2547.699) * (-2544.557) (-2547.977) (-2545.642) [-2545.616] -- 0:00:56 163000 -- (-2545.135) [-2546.336] (-2545.956) (-2549.338) * (-2547.522) (-2546.543) [-2545.759] (-2544.928) -- 0:00:56 163500 -- (-2547.494) (-2548.867) [-2546.396] (-2548.223) * [-2544.857] (-2548.652) (-2548.187) (-2545.603) -- 0:01:01 164000 -- [-2545.226] (-2546.831) (-2545.205) (-2550.549) * [-2547.044] (-2547.139) (-2547.559) (-2544.097) -- 0:01:01 164500 -- (-2547.082) (-2546.620) (-2545.936) [-2545.512] * (-2547.514) (-2547.576) [-2547.454] (-2551.501) -- 0:01:00 165000 -- [-2544.443] (-2544.474) (-2546.862) (-2548.712) * [-2548.333] (-2549.203) (-2546.289) (-2550.026) -- 0:01:00 Average standard deviation of split frequencies: 0.013568 165500 -- (-2544.443) [-2545.139] (-2546.180) (-2547.544) * [-2545.126] (-2549.877) (-2549.028) (-2552.131) -- 0:01:00 166000 -- (-2545.526) (-2548.213) (-2545.526) [-2547.274] * [-2546.048] (-2549.759) (-2548.124) (-2553.952) -- 0:01:00 166500 -- [-2547.308] (-2550.083) (-2546.742) (-2545.535) * (-2548.548) (-2548.403) [-2549.675] (-2546.712) -- 0:01:00 167000 -- (-2546.638) (-2547.450) [-2545.580] (-2546.081) * (-2547.853) (-2546.658) [-2545.592] (-2552.563) -- 0:00:59 167500 -- (-2548.412) (-2544.733) [-2545.399] (-2547.815) * (-2546.549) (-2547.286) [-2544.319] (-2545.430) -- 0:00:59 168000 -- (-2547.297) (-2545.094) [-2549.212] (-2548.742) * (-2546.854) [-2546.964] (-2544.525) (-2546.988) -- 0:00:59 168500 -- (-2548.398) (-2545.076) (-2546.131) [-2546.174] * (-2547.696) [-2545.247] (-2544.581) (-2548.918) -- 0:00:59 169000 -- (-2545.342) [-2545.778] (-2545.535) (-2546.892) * (-2546.784) (-2545.327) [-2544.401] (-2548.032) -- 0:00:59 169500 -- [-2545.427] (-2549.214) (-2548.139) (-2550.348) * (-2546.922) (-2545.327) (-2548.111) [-2547.977] -- 0:00:58 170000 -- (-2547.428) [-2545.513] (-2548.126) (-2551.941) * (-2546.482) [-2545.143] (-2548.708) (-2546.370) -- 0:00:58 Average standard deviation of split frequencies: 0.012602 170500 -- (-2547.182) [-2545.613] (-2546.786) (-2547.626) * (-2549.831) (-2548.261) [-2545.670] (-2547.483) -- 0:00:58 171000 -- (-2546.676) [-2547.604] (-2550.422) (-2547.634) * (-2547.744) (-2547.907) [-2545.279] (-2546.200) -- 0:00:58 171500 -- [-2545.262] (-2551.291) (-2551.970) (-2547.228) * (-2546.631) (-2547.196) [-2545.822] (-2545.567) -- 0:00:57 172000 -- (-2546.616) (-2551.181) (-2549.813) [-2547.829] * (-2546.756) (-2545.274) (-2544.723) [-2545.682] -- 0:00:57 172500 -- (-2545.938) (-2547.822) (-2546.982) [-2547.558] * (-2552.027) (-2545.004) [-2544.737] (-2545.440) -- 0:00:57 173000 -- (-2549.950) (-2547.898) (-2546.321) [-2548.800] * (-2545.387) [-2546.048] (-2548.970) (-2546.836) -- 0:00:57 173500 -- (-2547.339) (-2546.993) [-2546.271] (-2548.095) * (-2548.064) (-2545.850) (-2548.029) [-2548.390] -- 0:00:57 174000 -- [-2546.402] (-2545.603) (-2553.010) (-2547.631) * (-2544.994) [-2546.135] (-2547.216) (-2550.055) -- 0:00:56 174500 -- (-2548.845) (-2547.364) [-2550.844] (-2545.246) * (-2546.542) (-2546.121) [-2546.419] (-2545.671) -- 0:00:56 175000 -- (-2547.524) (-2544.495) [-2546.371] (-2545.215) * (-2548.818) [-2545.766] (-2549.113) (-2549.583) -- 0:00:56 Average standard deviation of split frequencies: 0.014968 175500 -- (-2546.822) (-2548.421) [-2544.945] (-2544.842) * (-2546.414) [-2545.380] (-2547.205) (-2548.640) -- 0:00:56 176000 -- [-2546.895] (-2545.775) (-2547.242) (-2545.711) * (-2545.036) (-2544.701) [-2545.032] (-2549.030) -- 0:00:56 176500 -- (-2551.314) (-2546.306) [-2544.607] (-2546.067) * (-2547.986) (-2545.253) (-2547.057) [-2548.620] -- 0:00:55 177000 -- (-2549.042) (-2546.839) [-2544.428] (-2545.345) * (-2547.616) (-2547.431) (-2547.242) [-2549.558] -- 0:00:55 177500 -- (-2549.014) (-2550.731) [-2544.777] (-2545.654) * (-2545.175) (-2550.102) [-2546.034] (-2546.953) -- 0:00:55 178000 -- (-2548.978) (-2548.971) (-2544.786) [-2545.780] * (-2545.534) (-2546.489) [-2545.499] (-2544.810) -- 0:01:00 178500 -- (-2548.378) (-2546.684) [-2544.549] (-2545.172) * (-2546.786) (-2545.480) (-2545.356) [-2544.946] -- 0:00:59 179000 -- (-2546.082) (-2548.426) (-2544.308) [-2546.186] * (-2546.421) (-2544.416) [-2544.774] (-2545.567) -- 0:00:59 179500 -- (-2548.435) (-2550.337) [-2544.235] (-2544.439) * (-2546.562) [-2544.748] (-2549.037) (-2547.894) -- 0:00:59 180000 -- (-2548.188) (-2547.155) [-2544.271] (-2546.500) * [-2545.928] (-2545.400) (-2547.041) (-2545.217) -- 0:00:59 Average standard deviation of split frequencies: 0.015042 180500 -- (-2544.725) (-2549.323) [-2544.174] (-2546.968) * [-2545.832] (-2547.719) (-2554.187) (-2544.735) -- 0:00:59 181000 -- (-2544.829) (-2549.986) (-2548.708) [-2546.691] * (-2547.270) (-2545.081) (-2553.516) [-2545.054] -- 0:00:58 181500 -- (-2544.449) (-2550.615) [-2547.454] (-2546.258) * (-2546.774) [-2545.385] (-2544.440) (-2544.301) -- 0:00:58 182000 -- [-2544.227] (-2550.783) (-2551.611) (-2545.370) * (-2548.952) (-2550.012) [-2546.858] (-2547.319) -- 0:00:58 182500 -- (-2544.227) [-2545.203] (-2550.932) (-2544.963) * (-2545.545) [-2548.463] (-2549.696) (-2545.718) -- 0:00:58 183000 -- (-2544.228) (-2545.482) (-2549.481) [-2547.225] * (-2547.469) [-2548.127] (-2550.029) (-2545.485) -- 0:00:58 183500 -- [-2545.874] (-2546.313) (-2545.176) (-2547.047) * (-2546.160) [-2548.109] (-2550.330) (-2544.667) -- 0:00:57 184000 -- (-2544.261) (-2544.729) [-2548.853] (-2547.084) * [-2545.140] (-2547.118) (-2545.391) (-2544.984) -- 0:00:57 184500 -- (-2544.261) [-2544.706] (-2548.291) (-2548.128) * (-2548.698) [-2545.752] (-2545.456) (-2546.913) -- 0:00:57 185000 -- (-2544.239) (-2544.493) [-2547.603] (-2549.149) * [-2547.993] (-2546.038) (-2545.460) (-2544.102) -- 0:00:57 Average standard deviation of split frequencies: 0.013567 185500 -- (-2544.239) (-2547.062) [-2547.727] (-2550.653) * (-2546.122) (-2546.553) (-2547.101) [-2544.438] -- 0:00:57 186000 -- (-2545.377) (-2547.192) [-2547.472] (-2548.590) * [-2549.671] (-2548.613) (-2544.996) (-2548.433) -- 0:00:56 186500 -- (-2546.263) (-2549.103) (-2545.487) [-2546.086] * (-2551.002) [-2547.290] (-2545.853) (-2547.533) -- 0:00:56 187000 -- (-2548.027) [-2546.064] (-2545.790) (-2544.623) * [-2549.440] (-2545.872) (-2546.502) (-2545.696) -- 0:00:56 187500 -- (-2546.834) (-2546.875) [-2545.716] (-2545.158) * (-2546.432) (-2545.687) (-2549.824) [-2545.291] -- 0:00:56 188000 -- (-2546.903) [-2546.279] (-2546.157) (-2545.876) * (-2546.246) (-2548.447) [-2546.134] (-2547.228) -- 0:00:56 188500 -- (-2549.346) [-2548.684] (-2546.615) (-2545.876) * [-2545.098] (-2546.319) (-2545.137) (-2545.784) -- 0:00:55 189000 -- (-2548.880) (-2545.025) (-2544.294) [-2545.157] * [-2545.786] (-2547.562) (-2545.187) (-2548.796) -- 0:00:55 189500 -- (-2547.309) (-2544.362) (-2545.758) [-2544.355] * (-2545.697) [-2545.707] (-2545.866) (-2546.237) -- 0:00:55 190000 -- [-2547.411] (-2547.057) (-2545.758) (-2544.443) * (-2547.048) (-2546.311) [-2546.039] (-2547.663) -- 0:00:55 Average standard deviation of split frequencies: 0.012671 190500 -- (-2548.404) (-2545.188) (-2545.443) [-2544.814] * (-2548.321) (-2546.172) (-2545.488) [-2547.478] -- 0:00:55 191000 -- (-2547.949) (-2544.624) (-2546.359) [-2544.688] * (-2547.071) (-2547.198) [-2545.313] (-2545.408) -- 0:00:55 191500 -- (-2547.829) (-2544.902) [-2545.375] (-2544.562) * (-2546.039) (-2551.267) (-2545.332) [-2545.564] -- 0:00:54 192000 -- (-2547.931) [-2545.767] (-2544.557) (-2547.293) * [-2549.310] (-2549.648) (-2546.276) (-2545.966) -- 0:00:54 192500 -- (-2547.668) (-2544.991) [-2544.288] (-2546.696) * [-2546.565] (-2549.559) (-2544.357) (-2548.183) -- 0:00:58 193000 -- [-2545.968] (-2545.517) (-2544.288) (-2547.128) * (-2546.585) [-2544.969] (-2547.670) (-2546.065) -- 0:00:58 193500 -- (-2546.676) (-2546.352) [-2544.366] (-2546.701) * (-2547.112) (-2545.040) (-2546.137) [-2545.291] -- 0:00:58 194000 -- [-2547.872] (-2544.924) (-2545.350) (-2547.431) * [-2544.767] (-2544.353) (-2546.240) (-2551.276) -- 0:00:58 194500 -- [-2546.667] (-2545.991) (-2545.455) (-2545.602) * (-2546.599) (-2549.414) [-2546.152] (-2547.449) -- 0:00:57 195000 -- [-2545.729] (-2545.496) (-2550.161) (-2545.289) * [-2546.990] (-2549.518) (-2544.165) (-2547.087) -- 0:00:57 Average standard deviation of split frequencies: 0.011124 195500 -- (-2545.339) (-2548.176) [-2544.484] (-2546.923) * (-2546.529) (-2546.537) [-2544.359] (-2547.229) -- 0:00:57 196000 -- (-2545.483) [-2548.326] (-2544.484) (-2548.408) * (-2548.180) (-2545.530) (-2544.259) [-2544.656] -- 0:00:57 196500 -- (-2545.259) (-2548.270) (-2545.655) [-2548.465] * (-2545.176) (-2545.806) (-2545.169) [-2546.054] -- 0:00:57 197000 -- (-2550.616) (-2545.551) [-2544.815] (-2548.021) * [-2546.508] (-2548.462) (-2550.749) (-2546.050) -- 0:00:57 197500 -- (-2549.475) [-2544.329] (-2548.346) (-2544.701) * (-2547.383) (-2548.901) [-2550.749] (-2545.501) -- 0:00:56 198000 -- (-2548.060) (-2544.882) (-2548.268) [-2546.319] * (-2548.569) (-2547.854) [-2545.298] (-2545.919) -- 0:00:56 198500 -- (-2547.479) [-2549.247] (-2548.773) (-2546.661) * (-2547.625) (-2552.845) [-2544.713] (-2548.827) -- 0:00:56 199000 -- (-2545.666) [-2547.616] (-2555.338) (-2547.246) * (-2547.483) [-2550.476] (-2544.714) (-2550.252) -- 0:00:56 199500 -- (-2547.431) [-2546.979] (-2551.569) (-2546.681) * (-2545.752) (-2553.334) [-2544.714] (-2547.795) -- 0:00:56 200000 -- (-2547.335) (-2549.002) (-2552.354) [-2546.090] * [-2545.075] (-2547.733) (-2546.434) (-2548.636) -- 0:00:55 Average standard deviation of split frequencies: 0.013051 200500 -- (-2548.461) (-2549.010) (-2548.224) [-2546.858] * (-2544.745) [-2547.937] (-2544.781) (-2549.992) -- 0:00:55 201000 -- (-2545.306) (-2546.117) (-2549.131) [-2545.217] * [-2544.855] (-2548.389) (-2547.126) (-2548.507) -- 0:00:55 201500 -- (-2549.827) (-2547.133) [-2545.711] (-2544.158) * (-2545.864) (-2547.228) [-2545.060] (-2552.304) -- 0:00:55 202000 -- [-2548.149] (-2548.382) (-2550.297) (-2544.166) * (-2546.545) (-2545.225) (-2544.978) [-2547.876] -- 0:00:55 202500 -- (-2546.438) (-2548.308) [-2549.412] (-2544.593) * (-2545.206) (-2546.829) [-2545.273] (-2548.997) -- 0:00:55 203000 -- (-2545.488) [-2549.676] (-2549.052) (-2544.647) * (-2545.206) (-2544.721) [-2545.548] (-2549.487) -- 0:00:54 203500 -- (-2545.657) [-2546.098] (-2545.526) (-2546.431) * [-2547.575] (-2547.407) (-2545.910) (-2549.039) -- 0:00:54 204000 -- [-2544.940] (-2545.603) (-2547.486) (-2546.529) * (-2545.617) [-2547.859] (-2545.289) (-2547.349) -- 0:00:54 204500 -- [-2544.796] (-2546.612) (-2547.530) (-2546.192) * (-2546.523) [-2546.222] (-2546.614) (-2549.419) -- 0:00:54 205000 -- (-2545.348) [-2547.745] (-2546.905) (-2545.197) * (-2548.162) [-2546.164] (-2545.901) (-2546.908) -- 0:00:54 Average standard deviation of split frequencies: 0.012205 205500 -- (-2544.319) [-2547.324] (-2546.962) (-2545.197) * (-2548.025) (-2547.072) (-2544.946) [-2547.097] -- 0:00:54 206000 -- [-2544.320] (-2545.810) (-2547.013) (-2546.398) * (-2547.565) (-2545.014) [-2544.141] (-2545.025) -- 0:00:53 206500 -- (-2544.320) (-2548.965) (-2547.282) [-2545.535] * [-2548.616] (-2545.381) (-2544.252) (-2545.663) -- 0:00:53 207000 -- (-2551.525) (-2552.090) (-2546.572) [-2544.742] * (-2548.907) (-2545.888) (-2545.146) [-2547.543] -- 0:00:53 207500 -- (-2550.344) [-2550.149] (-2550.770) (-2544.522) * (-2546.986) (-2544.765) [-2545.631] (-2548.975) -- 0:00:57 208000 -- (-2546.069) (-2546.913) (-2550.545) [-2544.536] * (-2546.985) (-2544.603) [-2546.350] (-2544.575) -- 0:00:57 208500 -- (-2546.179) (-2546.434) [-2551.415] (-2544.649) * [-2544.860] (-2544.676) (-2547.309) (-2547.613) -- 0:00:56 209000 -- (-2546.179) (-2544.310) (-2555.512) [-2545.349] * [-2546.251] (-2549.296) (-2544.514) (-2546.563) -- 0:00:56 209500 -- (-2545.956) (-2544.198) [-2550.585] (-2547.305) * (-2548.505) [-2545.433] (-2543.962) (-2546.179) -- 0:00:56 210000 -- [-2546.812] (-2545.291) (-2547.097) (-2551.704) * [-2547.564] (-2544.376) (-2546.972) (-2545.045) -- 0:00:56 Average standard deviation of split frequencies: 0.015042 210500 -- (-2546.545) (-2545.103) [-2546.824] (-2546.561) * [-2547.563] (-2545.609) (-2546.015) (-2544.886) -- 0:00:56 211000 -- (-2547.087) [-2546.289] (-2546.947) (-2547.221) * (-2546.738) [-2545.466] (-2548.355) (-2544.975) -- 0:00:56 211500 -- [-2546.531] (-2545.728) (-2544.401) (-2545.441) * [-2544.375] (-2546.590) (-2545.927) (-2545.479) -- 0:00:55 212000 -- (-2545.961) [-2544.107] (-2544.886) (-2549.260) * (-2545.149) [-2546.590] (-2547.623) (-2547.138) -- 0:00:55 212500 -- (-2548.455) [-2544.107] (-2545.348) (-2546.836) * (-2545.320) (-2549.482) (-2546.551) [-2546.005] -- 0:00:55 213000 -- (-2548.241) (-2544.236) [-2545.434] (-2548.687) * (-2544.613) (-2547.809) [-2546.103] (-2544.682) -- 0:00:55 213500 -- (-2546.202) [-2545.428] (-2546.121) (-2551.888) * (-2545.144) (-2544.963) [-2546.701] (-2547.711) -- 0:00:55 214000 -- [-2546.735] (-2545.557) (-2547.464) (-2549.347) * (-2545.403) (-2547.265) (-2548.222) [-2548.146] -- 0:00:55 214500 -- [-2546.306] (-2544.915) (-2548.081) (-2545.710) * (-2545.216) [-2544.985] (-2546.523) (-2546.206) -- 0:00:54 215000 -- (-2544.889) (-2545.775) [-2547.414] (-2545.187) * (-2546.385) [-2544.631] (-2547.626) (-2546.308) -- 0:00:54 Average standard deviation of split frequencies: 0.015405 215500 -- (-2544.620) [-2544.563] (-2544.875) (-2547.957) * (-2546.062) (-2549.869) [-2545.030] (-2549.346) -- 0:00:54 216000 -- (-2546.501) (-2546.953) (-2547.474) [-2547.956] * (-2545.871) (-2546.264) [-2547.298] (-2547.838) -- 0:00:54 216500 -- (-2545.744) [-2548.041] (-2550.849) (-2547.400) * (-2546.113) (-2546.134) (-2546.471) [-2546.933] -- 0:00:54 217000 -- [-2545.318] (-2549.814) (-2550.119) (-2547.437) * (-2544.909) (-2549.606) [-2545.432] (-2547.728) -- 0:00:54 217500 -- (-2545.234) [-2545.049] (-2549.479) (-2546.133) * [-2545.414] (-2545.683) (-2546.070) (-2544.986) -- 0:00:53 218000 -- (-2544.882) [-2546.812] (-2546.514) (-2549.155) * (-2545.470) (-2544.291) (-2547.244) [-2545.185] -- 0:00:53 218500 -- (-2546.672) [-2546.739] (-2548.704) (-2546.491) * (-2547.739) (-2547.171) (-2549.017) [-2545.328] -- 0:00:53 219000 -- (-2548.203) (-2545.125) [-2544.800] (-2548.728) * [-2546.379] (-2545.329) (-2548.923) (-2548.645) -- 0:00:53 219500 -- [-2545.311] (-2545.637) (-2544.506) (-2548.972) * [-2546.289] (-2544.427) (-2550.424) (-2547.346) -- 0:00:53 220000 -- (-2545.107) [-2547.510] (-2544.576) (-2547.879) * [-2545.325] (-2547.032) (-2545.509) (-2545.879) -- 0:00:53 Average standard deviation of split frequencies: 0.015331 220500 -- [-2545.057] (-2548.556) (-2545.597) (-2547.998) * (-2545.486) (-2545.153) (-2545.491) [-2547.603] -- 0:00:53 221000 -- (-2544.962) [-2545.836] (-2550.075) (-2548.539) * (-2545.129) (-2544.615) [-2545.565] (-2545.521) -- 0:00:52 221500 -- (-2544.873) [-2544.824] (-2545.269) (-2549.126) * (-2545.121) (-2544.615) [-2547.582] (-2544.060) -- 0:00:52 222000 -- [-2544.628] (-2547.353) (-2544.806) (-2544.178) * (-2544.549) [-2546.134] (-2545.149) (-2545.518) -- 0:00:56 222500 -- [-2544.620] (-2545.116) (-2544.497) (-2547.372) * (-2551.035) (-2545.098) [-2545.288] (-2547.311) -- 0:00:55 223000 -- (-2545.080) (-2545.086) (-2544.926) [-2545.389] * (-2546.220) (-2546.391) (-2545.316) [-2544.463] -- 0:00:55 223500 -- (-2545.272) (-2547.637) [-2549.696] (-2545.394) * (-2546.246) (-2544.711) [-2544.784] (-2544.882) -- 0:00:55 224000 -- (-2544.092) [-2546.070] (-2548.223) (-2544.311) * (-2546.504) [-2544.978] (-2545.834) (-2546.607) -- 0:00:55 224500 -- (-2545.305) [-2546.339] (-2545.871) (-2546.971) * [-2548.730] (-2544.979) (-2547.757) (-2547.322) -- 0:00:55 225000 -- (-2545.291) (-2544.821) (-2546.115) [-2545.484] * [-2547.557] (-2546.556) (-2546.775) (-2548.291) -- 0:00:55 Average standard deviation of split frequencies: 0.016073 225500 -- [-2544.738] (-2544.995) (-2545.825) (-2544.859) * [-2545.100] (-2546.641) (-2547.259) (-2548.288) -- 0:00:54 226000 -- [-2544.150] (-2543.971) (-2545.575) (-2545.400) * [-2545.633] (-2546.735) (-2547.515) (-2549.662) -- 0:00:54 226500 -- [-2544.536] (-2545.977) (-2545.581) (-2545.489) * [-2547.540] (-2545.529) (-2545.219) (-2548.266) -- 0:00:54 227000 -- [-2545.188] (-2546.333) (-2547.568) (-2544.108) * (-2544.830) [-2544.609] (-2546.741) (-2548.630) -- 0:00:54 227500 -- [-2545.422] (-2558.516) (-2550.566) (-2546.657) * [-2545.255] (-2545.581) (-2546.484) (-2546.357) -- 0:00:54 228000 -- [-2545.597] (-2553.657) (-2544.604) (-2548.682) * [-2546.711] (-2549.558) (-2548.214) (-2545.336) -- 0:00:54 228500 -- (-2544.513) (-2550.015) [-2546.169] (-2548.363) * (-2550.311) (-2548.794) (-2548.008) [-2550.490] -- 0:00:54 229000 -- (-2547.092) (-2546.713) (-2544.299) [-2545.467] * (-2548.589) (-2547.254) (-2544.232) [-2548.676] -- 0:00:53 229500 -- (-2549.952) (-2546.875) [-2544.518] (-2546.487) * (-2550.693) (-2548.967) [-2544.659] (-2547.715) -- 0:00:53 230000 -- (-2548.730) (-2547.742) (-2545.583) [-2544.742] * (-2553.409) (-2549.345) (-2550.345) [-2545.175] -- 0:00:53 Average standard deviation of split frequencies: 0.015508 230500 -- (-2549.506) [-2547.515] (-2545.583) (-2545.178) * (-2552.535) (-2548.378) (-2546.272) [-2544.745] -- 0:00:53 231000 -- (-2545.437) (-2554.839) (-2545.025) [-2545.661] * (-2547.056) (-2547.082) (-2549.351) [-2544.604] -- 0:00:53 231500 -- (-2546.977) (-2546.949) [-2548.506] (-2545.661) * (-2548.487) (-2546.873) [-2547.356] (-2544.817) -- 0:00:53 232000 -- (-2546.032) (-2547.073) (-2544.704) [-2545.242] * (-2545.795) (-2548.070) (-2545.074) [-2545.421] -- 0:00:52 232500 -- (-2545.850) (-2548.580) (-2545.541) [-2548.552] * (-2545.563) [-2545.153] (-2545.196) (-2545.001) -- 0:00:52 233000 -- [-2545.010] (-2546.984) (-2545.396) (-2546.674) * (-2545.026) (-2547.000) (-2548.570) [-2545.727] -- 0:00:52 233500 -- (-2546.280) (-2545.957) (-2545.403) [-2546.605] * (-2546.509) [-2545.748] (-2546.533) (-2544.917) -- 0:00:52 234000 -- (-2545.836) (-2545.249) (-2547.995) [-2546.605] * [-2545.754] (-2546.511) (-2546.449) (-2544.886) -- 0:00:52 234500 -- (-2546.369) (-2544.276) [-2549.423] (-2548.239) * (-2544.417) (-2546.882) [-2549.748] (-2546.515) -- 0:00:52 235000 -- [-2546.268] (-2546.681) (-2547.515) (-2549.412) * [-2544.315] (-2545.711) (-2550.240) (-2545.046) -- 0:00:52 Average standard deviation of split frequencies: 0.014981 235500 -- (-2546.923) (-2548.775) [-2546.079] (-2547.270) * (-2544.567) [-2550.266] (-2547.989) (-2549.228) -- 0:00:51 236000 -- [-2544.670] (-2548.861) (-2546.395) (-2547.445) * [-2546.743] (-2545.686) (-2546.376) (-2545.011) -- 0:00:51 236500 -- (-2544.670) [-2548.921] (-2546.996) (-2547.599) * [-2545.250] (-2546.885) (-2547.512) (-2544.874) -- 0:00:51 237000 -- [-2548.341] (-2547.994) (-2545.841) (-2548.869) * (-2545.582) (-2546.757) [-2547.189] (-2545.131) -- 0:00:54 237500 -- (-2547.612) [-2544.517] (-2547.050) (-2547.556) * [-2545.278] (-2545.452) (-2548.544) (-2551.417) -- 0:00:54 238000 -- [-2545.690] (-2546.187) (-2546.910) (-2547.353) * [-2546.295] (-2545.420) (-2549.634) (-2546.829) -- 0:00:54 238500 -- (-2546.497) (-2545.603) (-2545.793) [-2545.898] * (-2547.012) [-2545.764] (-2548.258) (-2546.146) -- 0:00:54 239000 -- (-2547.382) (-2545.525) (-2546.880) [-2545.176] * (-2546.082) [-2545.915] (-2546.097) (-2546.130) -- 0:00:54 239500 -- (-2546.056) [-2551.180] (-2546.285) (-2548.185) * (-2545.658) (-2545.923) [-2546.978] (-2546.287) -- 0:00:53 240000 -- (-2546.051) (-2547.716) [-2546.288] (-2548.275) * [-2544.630] (-2545.803) (-2545.889) (-2550.468) -- 0:00:53 Average standard deviation of split frequencies: 0.015452 240500 -- (-2548.041) [-2547.522] (-2548.306) (-2547.329) * (-2544.559) [-2546.060] (-2544.864) (-2550.021) -- 0:00:53 241000 -- (-2547.578) (-2546.840) (-2547.568) [-2545.883] * (-2544.946) (-2547.400) (-2545.260) [-2547.411] -- 0:00:53 241500 -- [-2547.024] (-2546.547) (-2546.044) (-2545.832) * (-2545.488) [-2547.963] (-2545.419) (-2546.882) -- 0:00:53 242000 -- (-2547.682) [-2546.497] (-2545.942) (-2545.666) * (-2545.541) [-2546.085] (-2547.546) (-2546.126) -- 0:00:53 242500 -- (-2545.962) (-2545.116) (-2545.801) [-2545.326] * (-2544.609) [-2544.540] (-2544.532) (-2551.283) -- 0:00:53 243000 -- (-2545.569) (-2545.821) (-2546.533) [-2546.246] * (-2544.886) (-2544.750) [-2545.226] (-2550.474) -- 0:00:52 243500 -- [-2544.635] (-2549.157) (-2544.991) (-2547.289) * [-2546.130] (-2546.238) (-2545.364) (-2551.266) -- 0:00:52 244000 -- [-2547.423] (-2550.382) (-2545.546) (-2547.396) * (-2545.142) [-2545.613] (-2544.788) (-2545.697) -- 0:00:52 244500 -- (-2544.602) (-2545.720) (-2547.182) [-2545.031] * (-2544.946) [-2546.483] (-2546.035) (-2547.381) -- 0:00:52 245000 -- (-2544.922) (-2547.268) [-2549.605] (-2545.031) * (-2545.038) [-2545.714] (-2547.653) (-2545.003) -- 0:00:52 Average standard deviation of split frequencies: 0.013840 245500 -- (-2544.838) [-2547.300] (-2552.334) (-2547.376) * (-2545.553) [-2546.251] (-2549.340) (-2546.164) -- 0:00:52 246000 -- (-2550.725) (-2546.732) (-2545.754) [-2547.336] * [-2546.136] (-2545.778) (-2547.071) (-2547.941) -- 0:00:52 246500 -- (-2547.562) [-2546.312] (-2547.798) (-2546.334) * (-2545.272) (-2546.862) [-2546.170] (-2546.488) -- 0:00:51 247000 -- [-2545.232] (-2544.347) (-2545.079) (-2545.352) * (-2545.270) (-2546.691) (-2549.679) [-2544.877] -- 0:00:51 247500 -- (-2544.814) (-2545.240) [-2547.955] (-2544.326) * (-2545.148) [-2545.528] (-2547.683) (-2547.503) -- 0:00:51 248000 -- [-2547.146] (-2544.738) (-2544.959) (-2544.371) * (-2546.420) (-2545.565) (-2549.390) [-2545.272] -- 0:00:51 248500 -- (-2546.772) (-2547.278) [-2545.196] (-2545.135) * (-2545.807) (-2549.329) [-2547.150] (-2545.177) -- 0:00:51 249000 -- [-2547.729] (-2546.887) (-2544.360) (-2544.885) * (-2548.073) (-2546.785) [-2546.132] (-2545.554) -- 0:00:51 249500 -- (-2549.951) [-2545.848] (-2544.215) (-2544.594) * [-2545.907] (-2546.652) (-2547.040) (-2545.010) -- 0:00:51 250000 -- (-2547.786) (-2548.617) (-2544.215) [-2546.761] * [-2544.434] (-2548.291) (-2546.494) (-2544.697) -- 0:00:51 Average standard deviation of split frequencies: 0.013896 250500 -- (-2549.315) (-2550.524) [-2545.346] (-2546.598) * (-2545.249) [-2546.330] (-2545.765) (-2545.431) -- 0:00:50 251000 -- (-2547.811) [-2551.388] (-2545.266) (-2548.728) * (-2545.245) (-2546.529) [-2546.383] (-2546.709) -- 0:00:50 251500 -- (-2545.264) (-2554.005) [-2544.612] (-2549.389) * (-2545.833) [-2546.695] (-2546.829) (-2548.238) -- 0:00:53 252000 -- [-2545.581] (-2554.286) (-2544.131) (-2545.258) * (-2549.349) (-2545.609) [-2547.428] (-2546.902) -- 0:00:53 252500 -- (-2547.640) (-2545.612) [-2545.798] (-2548.574) * [-2544.404] (-2548.734) (-2545.921) (-2549.665) -- 0:00:53 253000 -- (-2547.581) (-2545.358) [-2547.812] (-2551.644) * (-2544.275) (-2549.057) [-2547.331]