--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 10:37:51 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/efp/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -772.07 -776.85
2 -771.98 -775.03
--------------------------------------
TOTAL -772.03 -776.31
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888668 0.090100 0.317611 1.473466 0.853784 1456.07 1478.53 1.000
r(A<->C){all} 0.167957 0.019420 0.000036 0.450100 0.131533 184.38 293.45 1.000
r(A<->G){all} 0.154876 0.017861 0.000038 0.427707 0.117871 225.84 250.03 1.001
r(A<->T){all} 0.167281 0.020221 0.000005 0.451999 0.130182 217.11 288.24 1.000
r(C<->G){all} 0.163303 0.020077 0.000036 0.456347 0.124657 259.92 262.98 1.000
r(C<->T){all} 0.170107 0.020117 0.000006 0.459217 0.134360 241.46 266.79 1.003
r(G<->T){all} 0.176477 0.020387 0.000055 0.461141 0.141827 301.37 337.96 1.000
pi(A){all} 0.213873 0.000305 0.179248 0.247491 0.213323 1387.11 1421.23 1.000
pi(C){all} 0.265178 0.000345 0.228314 0.301784 0.264802 991.33 1246.16 1.000
pi(G){all} 0.310156 0.000391 0.272678 0.350496 0.309840 1333.61 1361.10 1.000
pi(T){all} 0.210792 0.000294 0.178225 0.244682 0.210259 1299.50 1360.55 1.000
alpha{1,2} 0.416892 0.231304 0.000146 1.363616 0.254704 1230.62 1355.07 1.000
alpha{3} 0.442476 0.235897 0.000236 1.446649 0.274803 1318.49 1335.55 1.000
pinvar{all} 0.997171 0.000012 0.990828 1.000000 0.998298 1352.90 1373.25 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -731.289887
Model 2: PositiveSelection -731.289846
Model 0: one-ratio -731.289846
Model 7: beta -731.289933
Model 8: beta&w>1 -731.289846
Model 0 vs 1 8.200000002034358E-5
Model 2 vs 1 8.200000002034358E-5
Model 8 vs 7 1.7400000001543958E-4
>C1
VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
>C2
VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
>C3
VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
>C4
VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
>C5
VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
>C6
VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=187
C1 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
C2 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
C3 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
C4 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
C5 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
C6 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
**************************************************
C1 DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
C2 DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
C3 DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
C4 DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
C5 DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
C6 DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
**************************************************
C1 TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
C2 TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
C3 TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
C4 TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
C5 TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
C6 TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
**************************************************
C1 PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
C2 PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
C3 PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
C4 PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
C5 PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
C6 PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
*************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5610]--->[5610]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.477 Mb, Max= 30.728 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
C2 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
C3 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
C4 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
C5 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
C6 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
**************************************************
C1 DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
C2 DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
C3 DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
C4 DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
C5 DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
C6 DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
**************************************************
C1 TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
C2 TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
C3 TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
C4 TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
C5 TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
C6 TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
**************************************************
C1 PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
C2 PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
C3 PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
C4 PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
C5 PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
C6 PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
*************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG
C2 GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG
C3 GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG
C4 GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG
C5 GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG
C6 GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG
**************************************************
C1 ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC
C2 ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC
C3 ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC
C4 ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC
C5 ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC
C6 ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC
**************************************************
C1 CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC
C2 CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC
C3 CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC
C4 CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC
C5 CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC
C6 CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC
**************************************************
C1 GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG
C2 GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG
C3 GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG
C4 GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG
C5 GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG
C6 GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG
**************************************************
C1 GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG
C2 GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG
C3 GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG
C4 GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG
C5 GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG
C6 GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG
**************************************************
C1 ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT
C2 ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT
C3 ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT
C4 ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT
C5 ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT
C6 ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT
**************************************************
C1 ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA
C2 ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA
C3 ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA
C4 ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA
C5 ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA
C6 ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA
**************************************************
C1 CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA
C2 CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA
C3 CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA
C4 CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA
C5 CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA
C6 CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA
**************************************************
C1 CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG
C2 CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG
C3 CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG
C4 CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG
C5 CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG
C6 CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG
**************************************************
C1 CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA
C2 CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA
C3 CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA
C4 CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA
C5 CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA
C6 CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA
**************************************************
C1 TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC
C2 TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC
C3 TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC
C4 TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC
C5 TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC
C6 TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC
**************************************************
C1 GTGTGAACGTC
C2 GTGTGAACGTC
C3 GTGTGAACGTC
C4 GTGTGAACGTC
C5 GTGTGAACGTC
C6 GTGTGAACGTC
***********
>C1
GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG
ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC
CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC
GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG
GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG
ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT
ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA
CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA
CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG
CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA
TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC
GTGTGAACGTC
>C2
GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG
ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC
CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC
GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG
GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG
ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT
ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA
CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA
CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG
CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA
TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC
GTGTGAACGTC
>C3
GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG
ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC
CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC
GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG
GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG
ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT
ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA
CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA
CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG
CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA
TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC
GTGTGAACGTC
>C4
GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG
ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC
CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC
GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG
GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG
ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT
ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA
CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA
CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG
CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA
TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC
GTGTGAACGTC
>C5
GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG
ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC
CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC
GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG
GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG
ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT
ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA
CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA
CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG
CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA
TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC
GTGTGAACGTC
>C6
GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG
ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC
CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC
GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG
GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG
ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT
ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA
CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA
CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG
CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA
TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC
GTGTGAACGTC
>C1
VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
>C2
VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
>C3
VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
>C4
VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
>C5
VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
>C6
VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 561 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579775793
Setting output file names to "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 633047504
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9508928428
Seed = 2118105555
Swapseed = 1579775793
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1255.544894 -- -24.965149
Chain 2 -- -1255.544703 -- -24.965149
Chain 3 -- -1255.544894 -- -24.965149
Chain 4 -- -1255.544703 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1255.544822 -- -24.965149
Chain 2 -- -1255.544822 -- -24.965149
Chain 3 -- -1255.544894 -- -24.965149
Chain 4 -- -1255.544822 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1255.545] (-1255.545) (-1255.545) (-1255.545) * [-1255.545] (-1255.545) (-1255.545) (-1255.545)
500 -- (-784.031) (-781.052) [-781.499] (-779.208) * (-784.217) [-788.464] (-788.244) (-789.724) -- 0:00:00
1000 -- (-783.045) (-782.215) (-782.268) [-788.169] * (-776.322) (-786.233) [-780.651] (-782.865) -- 0:00:00
1500 -- (-784.598) [-784.706] (-778.210) (-794.741) * (-779.406) [-777.861] (-782.986) (-787.277) -- 0:00:00
2000 -- (-792.148) (-783.518) [-778.596] (-791.078) * (-781.163) (-786.748) [-780.975] (-784.299) -- 0:00:00
2500 -- (-785.557) (-779.907) (-781.593) [-783.494] * [-779.133] (-782.875) (-785.296) (-784.508) -- 0:00:00
3000 -- [-776.500] (-783.157) (-781.871) (-786.531) * (-780.854) (-783.933) [-781.296] (-783.679) -- 0:00:00
3500 -- [-780.301] (-777.852) (-781.116) (-782.600) * [-781.388] (-780.699) (-779.246) (-777.669) -- 0:00:00
4000 -- (-784.257) (-775.682) (-780.206) [-784.411] * (-775.372) (-780.466) [-781.084] (-780.102) -- 0:00:00
4500 -- (-782.677) [-781.161] (-788.836) (-781.233) * [-777.065] (-780.682) (-782.409) (-780.462) -- 0:00:00
5000 -- [-780.348] (-780.614) (-778.118) (-778.047) * (-786.623) (-779.935) [-780.427] (-784.591) -- 0:00:00
Average standard deviation of split frequencies: 0.089791
5500 -- (-779.403) (-785.370) [-777.683] (-776.556) * (-779.255) (-776.088) [-781.026] (-782.399) -- 0:00:00
6000 -- (-781.899) (-786.077) [-781.799] (-783.773) * (-785.264) (-783.392) (-782.159) [-780.703] -- 0:00:00
6500 -- (-784.621) [-779.316] (-780.588) (-782.152) * (-786.043) (-782.978) [-779.070] (-783.003) -- 0:00:00
7000 -- (-782.681) (-776.224) (-780.477) [-779.231] * [-781.507] (-783.315) (-792.143) (-778.474) -- 0:02:21
7500 -- (-780.718) (-773.901) [-784.934] (-782.657) * [-775.896] (-778.747) (-792.907) (-778.475) -- 0:02:12
8000 -- (-780.315) (-771.357) [-782.827] (-781.113) * [-781.756] (-781.532) (-785.647) (-788.474) -- 0:02:04
8500 -- (-780.666) [-771.458] (-788.481) (-781.116) * (-787.224) [-781.714] (-772.296) (-781.139) -- 0:01:56
9000 -- (-781.206) (-772.063) (-785.722) [-778.255] * (-781.916) (-788.516) [-774.376] (-781.819) -- 0:01:50
9500 -- (-785.479) (-772.441) [-786.615] (-783.232) * (-777.817) [-778.848] (-774.059) (-776.134) -- 0:01:44
10000 -- (-783.010) [-771.667] (-784.600) (-784.677) * (-779.232) (-779.481) [-774.466] (-785.785) -- 0:01:39
Average standard deviation of split frequencies: 0.088388
10500 -- (-786.462) (-773.016) [-777.234] (-783.446) * (-781.517) [-785.878] (-774.028) (-782.650) -- 0:01:34
11000 -- (-784.396) (-773.215) (-788.701) [-779.954] * (-784.391) [-780.354] (-774.917) (-774.987) -- 0:01:29
11500 -- (-788.559) [-772.124] (-785.667) (-781.016) * (-788.713) (-779.682) [-772.111] (-781.335) -- 0:01:25
12000 -- (-778.523) (-772.455) [-777.779] (-779.486) * [-787.812] (-779.796) (-773.067) (-783.455) -- 0:01:22
12500 -- (-779.658) [-772.483] (-782.890) (-788.696) * [-786.641] (-792.946) (-772.586) (-779.962) -- 0:01:19
13000 -- (-779.570) [-773.634] (-782.041) (-779.431) * (-783.590) (-784.427) [-774.107] (-782.612) -- 0:01:15
13500 -- [-783.479] (-774.401) (-775.432) (-780.739) * (-787.417) [-779.666] (-774.752) (-783.415) -- 0:01:13
14000 -- (-784.080) [-771.620] (-789.503) (-783.371) * [-788.140] (-786.076) (-775.182) (-781.457) -- 0:01:10
14500 -- (-788.113) (-772.353) [-775.465] (-784.949) * (-776.252) (-780.821) (-773.743) [-778.322] -- 0:01:07
15000 -- (-787.181) (-771.363) [-778.009] (-780.946) * (-782.722) (-780.165) [-774.267] (-787.724) -- 0:01:05
Average standard deviation of split frequencies: 0.064538
15500 -- (-779.656) [-772.366] (-785.944) (-784.740) * (-781.458) [-779.937] (-772.910) (-785.427) -- 0:01:03
16000 -- (-784.944) [-774.380] (-787.287) (-790.516) * (-776.300) [-781.324] (-773.965) (-792.679) -- 0:01:01
16500 -- (-782.362) [-775.498] (-778.904) (-781.831) * [-779.242] (-772.556) (-772.514) (-778.691) -- 0:00:59
17000 -- (-790.589) [-772.865] (-777.274) (-778.855) * [-782.953] (-773.405) (-771.494) (-779.786) -- 0:00:57
17500 -- (-786.407) (-772.528) (-782.513) [-776.050] * [-774.459] (-775.675) (-774.426) (-779.525) -- 0:00:56
18000 -- [-778.117] (-777.888) (-784.841) (-779.793) * (-781.769) [-777.006] (-771.972) (-784.592) -- 0:00:54
18500 -- (-780.840) (-774.087) (-770.987) [-777.986] * (-781.916) (-776.288) [-771.768] (-781.134) -- 0:00:53
19000 -- (-782.180) (-775.624) (-771.480) [-784.081] * (-791.322) (-771.703) [-772.729] (-782.969) -- 0:00:51
19500 -- (-778.707) [-775.193] (-772.545) (-779.774) * (-786.345) (-772.945) (-772.597) [-783.409] -- 0:00:50
20000 -- [-782.702] (-771.987) (-770.975) (-786.659) * (-777.476) [-771.891] (-771.924) (-791.008) -- 0:00:49
Average standard deviation of split frequencies: 0.036227
20500 -- (-785.358) (-772.898) (-774.024) [-783.278] * [-776.757] (-770.720) (-772.119) (-786.353) -- 0:00:47
21000 -- (-778.990) (-773.974) (-771.802) [-779.224] * (-778.910) [-771.412] (-776.242) (-785.478) -- 0:00:46
21500 -- (-782.425) (-771.560) [-775.745] (-784.586) * [-779.327] (-772.423) (-772.258) (-783.747) -- 0:00:45
22000 -- (-785.328) (-773.641) [-770.747] (-781.180) * [-781.175] (-771.515) (-773.859) (-778.741) -- 0:00:44
22500 -- (-779.228) (-774.543) [-772.508] (-782.433) * [-779.067] (-773.807) (-777.719) (-786.606) -- 0:00:43
23000 -- (-786.150) [-774.066] (-775.151) (-778.930) * (-783.234) [-774.958] (-772.663) (-784.538) -- 0:01:24
23500 -- (-780.805) (-773.080) [-771.667] (-778.367) * (-778.008) (-771.375) (-773.169) [-781.541] -- 0:01:23
24000 -- [-785.123] (-773.534) (-773.928) (-783.574) * (-784.063) [-773.402] (-771.818) (-783.796) -- 0:01:21
24500 -- (-780.769) (-776.160) [-771.157] (-786.944) * (-784.901) (-776.751) (-771.885) [-780.897] -- 0:01:19
25000 -- (-791.596) [-774.414] (-772.593) (-779.441) * (-782.797) (-775.981) (-773.555) [-779.603] -- 0:01:18
Average standard deviation of split frequencies: 0.032808
25500 -- (-783.865) (-774.198) [-774.929] (-783.544) * (-783.651) (-771.141) [-770.769] (-782.152) -- 0:01:16
26000 -- (-785.603) [-773.526] (-772.446) (-787.898) * [-780.322] (-772.039) (-774.526) (-781.384) -- 0:01:14
26500 -- (-788.407) (-771.935) (-773.887) [-784.713] * (-780.356) (-775.306) (-776.935) [-780.557] -- 0:01:13
27000 -- [-781.917] (-773.403) (-774.782) (-781.641) * [-778.047] (-776.272) (-772.550) (-780.399) -- 0:01:12
27500 -- (-799.887) (-774.018) (-776.471) [-779.413] * (-781.280) (-774.288) [-773.268] (-776.023) -- 0:01:10
28000 -- (-784.868) [-772.378] (-776.063) (-785.851) * (-778.585) (-771.961) (-774.302) [-783.270] -- 0:01:09
28500 -- (-787.906) [-772.896] (-775.175) (-779.102) * [-782.832] (-772.609) (-774.747) (-782.046) -- 0:01:08
29000 -- (-776.441) (-775.344) [-771.182] (-777.416) * (-780.889) (-771.832) (-771.761) [-776.074] -- 0:01:06
29500 -- (-779.524) (-774.741) [-771.722] (-788.575) * (-780.659) (-774.556) (-770.819) [-782.254] -- 0:01:05
30000 -- (-782.223) [-774.986] (-771.110) (-780.096) * (-780.103) (-773.965) (-770.718) [-781.545] -- 0:01:04
Average standard deviation of split frequencies: 0.030744
30500 -- [-785.812] (-772.464) (-777.047) (-780.549) * (-779.292) [-771.597] (-771.463) (-780.624) -- 0:01:03
31000 -- (-781.296) [-774.246] (-775.749) (-783.516) * (-773.866) (-772.738) [-771.948] (-778.573) -- 0:01:02
31500 -- (-778.814) (-772.794) (-772.493) [-785.872] * [-781.417] (-772.084) (-770.651) (-778.915) -- 0:01:01
32000 -- (-779.489) [-771.338] (-773.897) (-780.353) * (-786.717) (-773.473) (-771.792) [-786.816] -- 0:01:00
32500 -- (-782.190) (-774.410) [-771.040] (-778.035) * (-781.202) [-771.905] (-773.507) (-782.427) -- 0:00:59
33000 -- (-782.141) (-777.090) (-772.220) [-777.991] * [-780.812] (-771.841) (-772.554) (-782.145) -- 0:00:58
33500 -- [-781.320] (-771.046) (-776.603) (-794.612) * [-788.484] (-773.081) (-774.303) (-780.919) -- 0:00:57
34000 -- (-782.569) (-773.539) [-774.058] (-789.305) * (-780.842) (-774.622) (-773.347) [-782.686] -- 0:00:56
34500 -- (-781.676) [-771.854] (-771.445) (-784.661) * [-778.411] (-775.123) (-774.393) (-784.707) -- 0:00:55
35000 -- (-784.622) (-778.707) (-773.425) [-781.670] * [-778.424] (-776.002) (-773.348) (-781.826) -- 0:00:55
Average standard deviation of split frequencies: 0.037320
35500 -- [-779.561] (-778.440) (-775.054) (-780.590) * (-787.734) (-771.306) [-772.511] (-782.194) -- 0:00:54
36000 -- [-778.230] (-777.995) (-775.084) (-787.411) * (-780.285) [-771.604] (-773.618) (-790.694) -- 0:00:53
36500 -- (-779.646) (-775.147) (-777.485) [-775.537] * (-793.724) [-773.245] (-771.778) (-779.240) -- 0:00:52
37000 -- (-783.934) (-775.597) (-777.297) [-781.966] * [-774.029] (-771.568) (-773.525) (-785.564) -- 0:00:52
37500 -- [-781.135] (-773.012) (-772.687) (-784.025) * (-773.541) (-771.937) (-774.928) [-779.528] -- 0:00:51
38000 -- (-780.931) [-774.424] (-776.117) (-784.804) * (-772.518) (-771.778) (-775.349) [-780.168] -- 0:00:50
38500 -- (-787.055) (-772.329) [-774.064] (-782.335) * (-774.373) (-776.732) [-770.778] (-798.394) -- 0:00:49
39000 -- (-779.130) [-771.660] (-773.512) (-776.667) * (-773.447) (-776.113) (-771.712) [-777.350] -- 0:00:49
39500 -- (-784.904) (-775.968) (-773.135) [-779.529] * (-772.189) (-771.867) (-772.495) [-780.837] -- 0:01:12
40000 -- (-784.248) (-773.240) (-774.265) [-790.174] * (-779.507) [-771.153] (-776.206) (-785.931) -- 0:01:12
Average standard deviation of split frequencies: 0.025760
40500 -- (-783.588) (-772.844) (-775.676) [-780.643] * (-781.177) (-771.343) (-772.408) [-773.207] -- 0:01:11
41000 -- (-779.604) (-772.917) [-774.634] (-785.383) * (-772.400) (-774.466) [-771.142] (-771.815) -- 0:01:10
41500 -- (-777.420) (-770.873) (-772.062) [-779.750] * (-774.289) (-773.001) (-771.455) [-770.871] -- 0:01:09
42000 -- (-787.925) (-771.885) (-771.834) [-781.213] * [-771.426] (-774.920) (-770.797) (-774.116) -- 0:01:08
42500 -- (-792.765) (-773.313) (-772.149) [-783.066] * [-773.741] (-773.691) (-772.162) (-772.376) -- 0:01:07
43000 -- (-790.458) [-772.133] (-773.362) (-788.321) * [-772.458] (-775.753) (-770.321) (-782.857) -- 0:01:06
43500 -- (-773.267) (-775.321) (-772.084) [-779.624] * (-772.124) (-775.659) [-771.957] (-775.172) -- 0:01:05
44000 -- (-776.458) [-772.597] (-772.799) (-781.934) * (-776.172) (-773.934) (-773.300) [-777.516] -- 0:01:05
44500 -- [-776.562] (-770.641) (-773.464) (-791.981) * [-774.127] (-772.161) (-775.029) (-772.240) -- 0:01:04
45000 -- (-773.459) (-776.072) (-771.144) [-776.655] * (-776.618) (-772.276) [-772.019] (-774.023) -- 0:01:03
Average standard deviation of split frequencies: 0.025620
45500 -- (-775.484) (-777.216) [-771.451] (-784.841) * (-779.429) [-772.035] (-770.844) (-771.776) -- 0:01:02
46000 -- [-772.466] (-776.724) (-774.399) (-781.990) * [-772.030] (-776.087) (-770.882) (-774.689) -- 0:01:02
46500 -- (-776.661) [-773.653] (-771.565) (-783.740) * (-775.387) (-777.028) (-772.075) [-773.104] -- 0:01:01
47000 -- [-771.967] (-771.880) (-772.638) (-786.568) * (-772.330) (-774.168) (-771.752) [-771.642] -- 0:01:00
47500 -- [-773.482] (-770.734) (-779.891) (-779.259) * (-773.501) (-773.808) [-772.599] (-771.828) -- 0:01:00
48000 -- (-772.572) [-774.997] (-773.938) (-796.724) * (-773.083) [-772.570] (-772.491) (-774.505) -- 0:00:59
48500 -- (-771.313) (-772.731) (-774.261) [-774.101] * (-771.862) (-774.166) (-774.054) [-773.322] -- 0:00:58
49000 -- (-776.533) (-773.483) [-774.548] (-775.194) * (-772.039) (-775.002) (-774.978) [-772.126] -- 0:00:58
49500 -- (-782.330) (-772.041) [-774.058] (-773.732) * (-772.351) (-774.723) (-775.422) [-771.322] -- 0:00:57
50000 -- [-777.710] (-773.972) (-774.188) (-776.522) * (-773.077) (-772.259) [-771.202] (-772.839) -- 0:00:57
Average standard deviation of split frequencies: 0.024656
50500 -- (-776.467) (-774.258) (-772.367) [-772.225] * (-771.605) [-772.698] (-775.483) (-775.045) -- 0:00:56
51000 -- (-774.758) [-776.831] (-771.096) (-774.825) * (-772.430) [-772.065] (-773.471) (-773.030) -- 0:00:55
51500 -- (-774.175) [-774.938] (-771.271) (-774.851) * [-774.225] (-773.484) (-775.202) (-772.925) -- 0:00:55
52000 -- (-771.683) (-776.807) [-772.570] (-772.608) * (-773.636) (-774.808) [-774.869] (-774.753) -- 0:00:54
52500 -- (-771.481) [-775.428] (-780.002) (-773.518) * (-774.433) (-774.735) (-771.009) [-776.803] -- 0:00:54
53000 -- [-771.787] (-773.057) (-777.004) (-772.540) * (-771.352) [-770.896] (-771.109) (-772.406) -- 0:00:53
53500 -- (-771.483) (-772.665) (-772.170) [-772.892] * (-771.246) (-771.521) (-773.079) [-773.590] -- 0:00:53
54000 -- [-771.050] (-771.370) (-771.579) (-771.484) * (-770.962) (-770.878) [-770.515] (-772.412) -- 0:00:52
54500 -- (-771.561) [-771.617] (-773.100) (-775.039) * (-771.461) (-775.613) [-771.077] (-771.190) -- 0:00:52
55000 -- (-771.336) (-773.238) (-773.166) [-771.612] * (-771.208) [-771.465] (-772.931) (-772.234) -- 0:00:51
Average standard deviation of split frequencies: 0.028355
55500 -- (-771.212) (-771.536) (-771.849) [-771.079] * [-771.571] (-779.312) (-773.156) (-770.853) -- 0:00:51
56000 -- [-771.697] (-776.977) (-773.294) (-773.167) * (-776.719) (-772.891) [-771.767] (-772.332) -- 0:01:07
56500 -- (-772.765) (-774.393) [-771.362] (-774.027) * [-773.931] (-772.072) (-776.589) (-773.169) -- 0:01:06
57000 -- [-774.006] (-776.044) (-771.518) (-774.140) * [-772.837] (-772.497) (-772.049) (-777.033) -- 0:01:06
57500 -- (-774.548) (-773.355) [-770.843] (-772.829) * (-780.377) (-773.390) (-773.876) [-773.914] -- 0:01:05
58000 -- (-772.920) (-778.328) [-771.305] (-770.836) * (-774.278) (-772.503) [-771.335] (-773.881) -- 0:01:04
58500 -- (-773.190) (-774.670) [-771.359] (-772.861) * (-773.255) (-774.328) [-771.424] (-772.578) -- 0:01:04
59000 -- [-773.407] (-771.716) (-771.195) (-771.187) * (-771.022) [-772.023] (-772.004) (-771.267) -- 0:01:03
59500 -- (-772.429) [-770.756] (-771.804) (-771.634) * [-772.773] (-775.131) (-772.486) (-781.518) -- 0:01:03
60000 -- (-773.531) (-773.396) [-772.616] (-771.334) * (-773.807) (-771.386) [-772.135] (-771.566) -- 0:01:02
Average standard deviation of split frequencies: 0.033535
60500 -- (-771.594) (-772.977) (-771.379) [-773.914] * (-770.885) [-771.602] (-773.794) (-771.622) -- 0:01:02
61000 -- (-772.509) (-775.740) (-772.408) [-773.413] * (-771.409) (-773.155) [-771.740] (-773.526) -- 0:01:01
61500 -- (-772.355) (-775.207) [-773.256] (-774.667) * (-772.911) [-773.597] (-771.289) (-771.972) -- 0:01:01
62000 -- (-775.256) (-774.362) (-773.035) [-771.355] * (-771.625) (-778.955) (-773.505) [-771.885] -- 0:01:00
62500 -- (-774.707) [-773.420] (-771.177) (-775.996) * (-772.049) (-774.023) [-773.008] (-773.635) -- 0:01:00
63000 -- (-775.875) (-772.956) [-771.976] (-776.199) * (-772.837) [-776.717] (-771.675) (-773.222) -- 0:00:59
63500 -- (-771.505) (-774.682) [-770.911] (-774.280) * (-770.856) (-774.676) [-770.992] (-775.702) -- 0:00:58
64000 -- [-772.399] (-771.420) (-770.880) (-771.474) * (-771.909) (-775.734) [-772.716] (-773.422) -- 0:00:58
64500 -- (-771.795) (-773.943) [-770.771] (-772.959) * [-772.946] (-772.023) (-773.010) (-772.997) -- 0:00:58
65000 -- (-777.365) [-773.922] (-773.027) (-770.716) * (-771.964) (-771.038) [-772.978] (-772.824) -- 0:00:57
Average standard deviation of split frequencies: 0.034284
65500 -- (-774.567) (-772.846) [-773.027] (-771.387) * (-770.808) (-772.817) [-770.730] (-776.187) -- 0:00:57
66000 -- (-774.120) [-770.414] (-773.111) (-771.754) * [-771.517] (-775.017) (-771.305) (-774.726) -- 0:00:56
66500 -- (-773.423) (-776.283) (-771.664) [-772.201] * (-771.582) (-771.701) [-774.198] (-773.827) -- 0:00:56
67000 -- (-772.370) (-776.457) [-775.067] (-772.205) * (-775.284) [-771.378] (-779.389) (-775.891) -- 0:00:55
67500 -- (-774.613) [-773.194] (-771.342) (-774.608) * (-772.587) [-773.527] (-771.085) (-773.974) -- 0:00:55
68000 -- (-776.068) (-770.927) [-771.672] (-771.521) * (-773.971) (-771.045) [-772.230] (-772.084) -- 0:00:54
68500 -- (-772.900) [-771.196] (-772.324) (-772.573) * (-772.817) (-770.853) (-772.218) [-772.144] -- 0:00:54
69000 -- (-774.283) [-773.091] (-776.471) (-773.516) * [-772.263] (-770.805) (-772.552) (-773.052) -- 0:00:53
69500 -- (-772.105) (-776.714) (-773.612) [-773.102] * (-775.725) [-773.131] (-772.782) (-774.849) -- 0:00:53
70000 -- (-771.838) (-774.957) [-773.127] (-776.194) * (-771.957) (-772.080) [-771.856] (-771.399) -- 0:00:53
Average standard deviation of split frequencies: 0.032652
70500 -- [-771.815] (-773.705) (-772.282) (-772.030) * (-772.362) (-772.783) (-770.597) [-771.279] -- 0:00:52
71000 -- (-771.836) (-776.041) [-773.144] (-771.438) * (-772.027) (-774.276) (-773.455) [-775.404] -- 0:00:52
71500 -- (-773.534) (-772.490) (-775.528) [-771.893] * (-774.140) (-771.236) (-776.134) [-772.834] -- 0:00:51
72000 -- [-773.964] (-775.371) (-777.622) (-773.070) * (-772.220) (-774.428) (-774.072) [-773.852] -- 0:00:51
72500 -- (-773.359) [-773.321] (-776.785) (-780.259) * [-772.365] (-771.907) (-775.924) (-772.037) -- 0:00:51
73000 -- (-775.176) (-773.142) [-775.554] (-778.048) * (-774.167) (-772.179) [-773.617] (-771.190) -- 0:01:03
73500 -- (-775.249) (-773.213) (-771.229) [-774.774] * (-772.424) (-775.316) (-776.213) [-771.596] -- 0:01:03
74000 -- [-771.268] (-775.851) (-771.975) (-775.607) * (-773.006) (-774.741) [-774.283] (-772.412) -- 0:01:02
74500 -- (-771.480) (-773.526) [-773.411] (-776.393) * [-771.642] (-772.201) (-772.601) (-771.068) -- 0:01:02
75000 -- [-774.775] (-774.301) (-773.316) (-775.923) * (-772.114) (-771.875) (-775.873) [-771.551] -- 0:01:01
Average standard deviation of split frequencies: 0.032736
75500 -- (-775.082) [-773.809] (-774.544) (-771.088) * [-771.429] (-776.062) (-771.992) (-771.817) -- 0:01:01
76000 -- (-779.663) (-775.205) (-772.375) [-771.329] * [-772.467] (-775.195) (-773.169) (-772.576) -- 0:01:00
76500 -- (-774.001) (-776.398) [-772.997] (-774.568) * (-770.891) (-773.236) [-772.060] (-776.305) -- 0:01:00
77000 -- (-773.136) (-773.897) (-773.726) [-772.245] * [-772.180] (-772.427) (-772.876) (-770.859) -- 0:00:59
77500 -- (-774.684) (-777.437) (-772.507) [-771.981] * (-770.669) (-773.095) (-770.777) [-771.462] -- 0:00:59
78000 -- [-774.020] (-772.280) (-772.715) (-771.173) * (-771.870) [-773.644] (-770.513) (-772.842) -- 0:00:59
78500 -- (-773.180) (-773.052) [-772.290] (-772.949) * (-775.388) (-785.910) [-770.864] (-771.074) -- 0:00:58
79000 -- [-771.125] (-771.705) (-771.441) (-773.292) * (-771.924) (-780.347) (-772.143) [-773.139] -- 0:00:58
79500 -- (-770.557) (-773.494) [-773.632] (-776.171) * (-772.515) (-776.206) [-771.522] (-772.839) -- 0:00:57
80000 -- (-771.420) [-770.919] (-775.449) (-773.328) * (-774.170) (-771.431) [-772.552] (-774.115) -- 0:00:57
Average standard deviation of split frequencies: 0.029544
80500 -- (-771.059) [-770.975] (-775.705) (-771.546) * (-771.770) (-772.418) [-773.833] (-772.167) -- 0:00:57
81000 -- (-772.432) (-771.510) (-775.470) [-771.784] * (-771.334) (-773.285) (-771.015) [-772.584] -- 0:00:56
81500 -- (-774.184) (-771.972) (-773.861) [-772.580] * (-771.360) (-770.936) [-771.129] (-772.539) -- 0:00:56
82000 -- (-778.016) (-772.464) [-773.908] (-771.136) * (-771.706) [-771.993] (-771.610) (-779.211) -- 0:00:55
82500 -- (-774.893) [-771.116] (-772.394) (-772.393) * (-772.715) [-770.594] (-771.444) (-773.543) -- 0:00:55
83000 -- [-772.234] (-771.325) (-772.143) (-771.368) * [-771.848] (-774.765) (-775.410) (-773.649) -- 0:00:55
83500 -- (-771.514) [-773.318] (-772.886) (-771.244) * (-771.899) [-771.422] (-772.117) (-772.846) -- 0:00:54
84000 -- (-772.929) (-773.505) (-774.687) [-772.029] * (-772.329) [-770.825] (-772.112) (-774.483) -- 0:00:54
84500 -- (-772.628) (-774.090) (-773.296) [-771.723] * (-771.731) (-771.300) [-771.997] (-773.227) -- 0:00:54
85000 -- (-774.703) (-773.505) [-773.371] (-772.056) * [-772.280] (-771.455) (-772.165) (-775.206) -- 0:00:53
Average standard deviation of split frequencies: 0.027668
85500 -- (-775.047) (-773.767) (-772.231) [-772.123] * (-773.692) [-779.896] (-772.283) (-771.656) -- 0:00:53
86000 -- (-772.931) (-771.944) [-772.261] (-771.398) * [-771.365] (-771.787) (-774.038) (-773.976) -- 0:00:53
86500 -- [-771.569] (-772.721) (-772.006) (-773.594) * (-772.749) (-773.457) [-773.855] (-775.873) -- 0:00:52
87000 -- (-775.879) (-774.393) [-771.386] (-774.811) * [-772.228] (-772.149) (-771.886) (-773.166) -- 0:00:52
87500 -- (-777.529) (-773.348) [-770.962] (-773.669) * [-772.938] (-772.393) (-777.587) (-772.619) -- 0:00:52
88000 -- [-772.430] (-774.659) (-771.343) (-774.136) * (-773.301) [-772.392] (-774.315) (-774.202) -- 0:00:51
88500 -- (-772.739) (-780.958) [-772.304] (-774.973) * (-772.310) (-774.454) (-772.840) [-771.909] -- 0:00:51
89000 -- [-772.204] (-772.877) (-772.161) (-772.928) * [-772.846] (-771.316) (-772.692) (-776.672) -- 0:00:51
89500 -- (-775.930) (-773.292) (-772.648) [-773.759] * (-772.207) (-771.958) [-772.845] (-773.258) -- 0:01:01
90000 -- (-775.522) [-776.410] (-774.316) (-772.647) * (-776.046) (-772.065) [-772.802] (-777.710) -- 0:01:00
Average standard deviation of split frequencies: 0.027556
90500 -- [-773.806] (-773.377) (-772.577) (-772.657) * [-772.704] (-773.936) (-773.861) (-776.971) -- 0:01:00
91000 -- (-772.813) [-771.775] (-772.111) (-772.436) * (-775.194) (-773.492) [-773.641] (-774.741) -- 0:00:59
91500 -- (-775.975) (-772.308) [-772.947] (-771.453) * [-772.037] (-772.196) (-775.422) (-775.365) -- 0:00:59
92000 -- (-775.565) [-773.572] (-772.595) (-772.573) * (-776.296) [-770.779] (-770.506) (-775.282) -- 0:00:59
92500 -- [-774.678] (-772.144) (-771.821) (-772.103) * (-772.056) [-771.018] (-770.547) (-773.581) -- 0:00:58
93000 -- (-773.635) (-771.137) [-773.130] (-773.510) * [-770.917] (-770.899) (-771.548) (-780.655) -- 0:00:58
93500 -- (-771.111) [-772.137] (-772.178) (-772.848) * (-771.673) (-770.963) [-771.547] (-777.299) -- 0:00:58
94000 -- (-772.289) [-773.552] (-773.220) (-772.812) * (-773.050) [-770.801] (-774.287) (-774.245) -- 0:00:57
94500 -- [-775.291] (-774.387) (-773.514) (-771.654) * [-772.141] (-771.440) (-775.501) (-775.487) -- 0:00:57
95000 -- (-774.044) (-773.949) [-772.497] (-771.966) * [-771.273] (-771.319) (-773.029) (-773.975) -- 0:00:57
Average standard deviation of split frequencies: 0.028687
95500 -- [-772.898] (-773.518) (-772.075) (-771.790) * (-770.901) (-770.853) (-772.379) [-774.059] -- 0:00:56
96000 -- (-772.154) (-774.992) [-771.454] (-772.048) * (-773.469) (-775.565) [-773.746] (-772.426) -- 0:00:56
96500 -- [-772.090] (-774.727) (-772.251) (-772.852) * (-775.088) (-772.859) [-774.952] (-775.408) -- 0:00:56
97000 -- (-775.670) (-778.497) [-774.291] (-772.306) * (-772.607) (-774.244) (-775.207) [-774.317] -- 0:00:55
97500 -- (-773.375) (-771.778) [-774.525] (-771.001) * [-773.578] (-771.577) (-776.451) (-772.049) -- 0:00:55
98000 -- (-775.824) (-771.231) [-774.892] (-772.621) * (-774.688) (-773.433) [-777.377] (-773.497) -- 0:00:55
98500 -- [-771.077] (-774.513) (-775.129) (-772.273) * (-773.042) (-770.847) [-772.338] (-775.819) -- 0:00:54
99000 -- (-772.744) [-770.689] (-773.819) (-772.496) * (-774.047) [-773.937] (-770.863) (-775.269) -- 0:00:54
99500 -- (-770.974) (-771.508) (-772.570) [-771.523] * [-775.294] (-774.397) (-772.195) (-775.437) -- 0:00:54
100000 -- [-773.043] (-770.711) (-771.033) (-772.604) * (-773.349) [-773.776] (-775.451) (-773.028) -- 0:00:54
Average standard deviation of split frequencies: 0.031402
100500 -- (-772.723) (-773.677) [-771.635] (-772.603) * (-771.834) [-775.154] (-770.652) (-772.895) -- 0:00:53
101000 -- [-771.112] (-771.293) (-772.833) (-772.462) * [-774.001] (-774.866) (-771.844) (-775.458) -- 0:00:53
101500 -- [-771.261] (-771.058) (-773.825) (-773.709) * (-773.901) (-772.927) (-774.082) [-771.568] -- 0:00:53
102000 -- (-772.926) (-771.374) [-774.716] (-775.170) * (-772.067) (-773.195) (-772.319) [-774.619] -- 0:00:52
102500 -- [-773.598] (-771.589) (-774.722) (-773.056) * (-773.439) (-771.853) (-771.437) [-775.433] -- 0:00:52
103000 -- (-775.149) (-776.615) (-775.707) [-772.660] * (-773.817) [-772.064] (-775.786) (-772.099) -- 0:00:52
103500 -- [-772.597] (-773.414) (-773.910) (-773.173) * (-772.185) (-773.118) [-772.399] (-771.893) -- 0:00:51
104000 -- (-773.350) (-774.844) (-772.294) [-771.202] * (-772.805) (-771.737) [-772.615] (-771.633) -- 0:00:51
104500 -- (-772.467) (-774.302) (-771.507) [-772.066] * (-774.402) [-772.227] (-772.531) (-773.180) -- 0:00:51
105000 -- (-771.220) (-774.320) [-771.767] (-771.148) * (-771.976) (-772.665) [-771.257] (-774.676) -- 0:00:51
Average standard deviation of split frequencies: 0.028166
105500 -- (-771.920) (-772.666) (-772.220) [-770.920] * [-770.728] (-771.619) (-771.256) (-773.514) -- 0:00:50
106000 -- (-771.746) (-773.509) [-773.690] (-770.519) * (-777.299) (-771.236) [-773.299] (-772.613) -- 0:00:59
106500 -- [-773.868] (-773.908) (-772.246) (-771.284) * (-774.351) (-771.533) (-773.489) [-772.617] -- 0:00:58
107000 -- (-773.913) (-773.696) [-772.200] (-771.057) * [-775.174] (-773.894) (-774.886) (-774.310) -- 0:00:58
107500 -- (-774.450) [-772.692] (-771.721) (-773.147) * [-771.659] (-773.289) (-772.259) (-773.851) -- 0:00:58
108000 -- [-773.272] (-771.884) (-773.154) (-771.556) * [-771.383] (-772.248) (-772.604) (-772.866) -- 0:00:57
108500 -- (-777.618) [-774.420] (-771.555) (-772.720) * [-773.579] (-773.067) (-776.631) (-772.158) -- 0:00:57
109000 -- (-773.766) (-774.688) [-771.712] (-773.236) * [-772.024] (-774.348) (-775.146) (-771.589) -- 0:00:57
109500 -- (-773.068) [-774.714] (-771.813) (-775.173) * (-774.214) (-773.222) (-772.290) [-773.062] -- 0:00:56
110000 -- (-773.260) (-772.108) [-772.696] (-770.500) * [-770.998] (-773.349) (-775.501) (-771.964) -- 0:00:56
Average standard deviation of split frequencies: 0.024848
110500 -- (-773.561) (-771.858) (-770.942) [-772.480] * (-772.028) (-773.229) [-770.921] (-772.528) -- 0:00:56
111000 -- (-773.293) [-772.389] (-771.900) (-773.651) * (-775.691) (-771.836) (-771.275) [-771.845] -- 0:00:56
111500 -- [-771.235] (-773.693) (-775.025) (-773.805) * (-772.832) [-772.940] (-771.423) (-774.173) -- 0:00:55
112000 -- (-773.688) (-771.534) [-774.040] (-774.122) * (-773.740) (-772.035) (-772.664) [-774.053] -- 0:00:55
112500 -- (-772.371) (-771.792) (-777.270) [-773.510] * (-776.101) [-771.545] (-772.019) (-771.755) -- 0:00:55
113000 -- (-771.847) [-771.089] (-778.042) (-771.030) * (-775.316) (-771.459) [-773.757] (-771.823) -- 0:00:54
113500 -- (-772.528) (-771.710) (-774.042) [-774.452] * (-774.878) (-773.636) (-772.850) [-773.209] -- 0:00:54
114000 -- (-772.978) [-775.225] (-773.224) (-775.084) * [-773.801] (-771.553) (-773.158) (-774.169) -- 0:00:54
114500 -- (-771.932) (-771.534) (-774.595) [-773.295] * [-776.457] (-773.394) (-775.823) (-774.524) -- 0:00:54
115000 -- (-771.634) (-773.705) [-774.115] (-775.908) * (-772.994) (-773.643) (-778.723) [-773.963] -- 0:00:53
Average standard deviation of split frequencies: 0.023480
115500 -- [-771.414] (-776.686) (-773.940) (-775.493) * (-775.148) (-773.595) [-774.901] (-771.790) -- 0:00:53
116000 -- (-771.726) (-773.943) [-772.368] (-773.618) * [-775.081] (-771.883) (-770.932) (-773.477) -- 0:00:53
116500 -- (-771.852) [-771.984] (-774.067) (-775.020) * (-771.091) [-774.257] (-773.981) (-772.964) -- 0:00:53
117000 -- (-771.872) (-778.038) (-772.353) [-775.356] * (-771.582) (-777.887) (-773.471) [-771.418] -- 0:00:52
117500 -- (-771.580) [-774.676] (-773.655) (-770.650) * (-771.220) [-771.031] (-773.076) (-777.289) -- 0:00:52
118000 -- (-775.223) [-775.092] (-773.820) (-774.021) * (-772.746) [-773.119] (-774.349) (-777.255) -- 0:00:52
118500 -- (-771.244) [-771.510] (-773.013) (-773.584) * (-772.119) (-773.198) (-774.521) [-776.044] -- 0:00:52
119000 -- [-771.064] (-772.771) (-775.742) (-771.676) * (-772.778) (-772.526) [-772.014] (-775.793) -- 0:00:51
119500 -- (-771.414) (-773.844) (-773.906) [-773.463] * (-774.283) (-773.207) [-772.021] (-777.901) -- 0:00:51
120000 -- (-771.039) (-774.087) (-773.933) [-772.266] * (-774.152) [-770.949] (-772.359) (-784.027) -- 0:00:51
Average standard deviation of split frequencies: 0.024819
120500 -- (-771.116) [-770.805] (-774.598) (-773.495) * (-773.442) (-775.211) [-771.551] (-776.874) -- 0:00:58
121000 -- (-775.461) (-773.034) (-772.622) [-771.367] * (-774.328) (-771.787) (-771.332) [-770.501] -- 0:00:58
121500 -- (-775.768) (-772.425) (-772.548) [-775.854] * (-770.973) (-775.675) [-771.866] (-770.802) -- 0:00:57
122000 -- (-774.213) (-772.964) [-771.372] (-771.510) * (-777.136) (-773.131) [-771.463] (-770.990) -- 0:00:57
122500 -- (-772.326) [-771.617] (-773.071) (-772.501) * (-773.871) [-772.460] (-773.533) (-770.928) -- 0:00:57
123000 -- (-773.567) [-771.395] (-773.130) (-772.019) * [-774.075] (-772.491) (-770.542) (-771.791) -- 0:00:57
123500 -- (-773.195) (-771.959) (-775.416) [-772.896] * (-775.651) (-771.436) [-772.245] (-771.612) -- 0:00:56
124000 -- (-772.994) (-771.472) [-771.003] (-771.210) * (-774.884) (-771.399) [-774.486] (-770.938) -- 0:00:56
124500 -- [-770.676] (-771.983) (-771.848) (-774.215) * (-773.564) (-771.093) (-770.973) [-770.834] -- 0:00:56
125000 -- (-772.951) (-772.667) (-771.622) [-772.565] * [-774.306] (-773.087) (-774.941) (-770.980) -- 0:00:56
Average standard deviation of split frequencies: 0.025773
125500 -- [-772.595] (-774.077) (-771.794) (-771.818) * (-778.670) (-771.841) (-771.609) [-772.808] -- 0:00:55
126000 -- (-772.998) (-772.661) [-772.957] (-773.492) * (-772.611) (-771.629) [-773.268] (-772.360) -- 0:00:55
126500 -- (-771.712) (-773.510) (-772.208) [-771.840] * [-772.940] (-772.254) (-772.397) (-772.059) -- 0:00:55
127000 -- (-774.156) [-770.915] (-771.594) (-776.306) * (-775.373) (-773.813) (-772.523) [-772.577] -- 0:00:54
127500 -- (-771.463) [-773.088] (-771.449) (-772.904) * (-774.108) (-771.905) (-773.527) [-773.008] -- 0:00:54
128000 -- (-774.944) [-773.278] (-772.374) (-772.295) * (-773.700) (-775.367) [-771.870] (-772.039) -- 0:00:54
128500 -- (-772.672) (-772.782) (-770.975) [-770.680] * [-772.480] (-774.868) (-770.450) (-772.080) -- 0:00:54
129000 -- (-771.481) (-774.459) (-770.935) [-770.878] * [-770.927] (-772.743) (-771.085) (-771.987) -- 0:00:54
129500 -- (-773.379) (-776.844) (-772.922) [-771.902] * (-777.065) (-772.145) [-773.274] (-772.688) -- 0:00:53
130000 -- [-775.017] (-772.763) (-775.083) (-771.952) * (-772.463) (-774.117) (-774.946) [-772.323] -- 0:00:53
Average standard deviation of split frequencies: 0.026393
130500 -- (-778.305) (-772.435) (-774.723) [-773.000] * [-771.903] (-772.999) (-776.419) (-771.696) -- 0:00:53
131000 -- (-773.901) (-773.168) [-771.058] (-772.951) * (-774.193) (-772.230) (-773.968) [-772.184] -- 0:00:53
131500 -- (-778.438) [-772.629] (-771.825) (-772.694) * [-774.285] (-771.429) (-775.192) (-771.539) -- 0:00:52
132000 -- (-775.951) (-771.180) (-771.238) [-771.196] * (-772.357) (-771.307) [-772.035] (-778.046) -- 0:00:52
132500 -- (-772.692) (-773.169) (-772.608) [-770.975] * (-771.074) (-771.323) [-772.239] (-772.679) -- 0:00:52
133000 -- (-772.347) [-772.871] (-773.805) (-770.776) * (-771.773) (-770.964) (-771.287) [-776.611] -- 0:00:52
133500 -- (-778.504) (-772.086) [-776.618] (-771.365) * [-773.108] (-774.563) (-771.508) (-771.902) -- 0:00:51
134000 -- (-773.347) (-773.630) (-776.039) [-773.044] * [-773.855] (-773.148) (-773.466) (-770.730) -- 0:00:51
134500 -- (-774.394) (-772.169) (-772.596) [-772.881] * (-773.348) (-775.943) [-772.215] (-771.853) -- 0:00:51
135000 -- (-771.904) (-771.841) (-774.746) [-771.700] * (-777.468) (-774.352) (-772.958) [-772.944] -- 0:00:51
Average standard deviation of split frequencies: 0.024456
135500 -- (-772.404) (-776.262) (-773.923) [-771.895] * (-774.031) (-773.816) (-771.835) [-772.703] -- 0:00:51
136000 -- (-772.155) (-770.376) (-775.132) [-770.747] * (-773.312) [-772.707] (-772.309) (-770.865) -- 0:00:57
136500 -- (-773.918) (-772.728) (-772.938) [-771.737] * (-772.630) (-771.621) (-773.348) [-776.964] -- 0:00:56
137000 -- (-774.036) (-771.794) (-775.313) [-776.739] * (-772.303) (-775.421) [-772.032] (-776.595) -- 0:00:56
137500 -- [-774.276] (-774.693) (-775.272) (-773.504) * (-770.477) [-771.869] (-771.222) (-781.199) -- 0:00:56
138000 -- (-771.082) [-772.584] (-773.969) (-775.427) * (-770.887) [-771.074] (-771.331) (-773.207) -- 0:00:56
138500 -- [-771.396] (-776.535) (-771.638) (-773.034) * (-772.780) [-771.236] (-773.360) (-776.069) -- 0:00:55
139000 -- [-772.313] (-773.068) (-772.171) (-772.042) * (-773.014) (-774.203) (-770.980) [-772.398] -- 0:00:55
139500 -- (-771.564) (-774.108) (-771.212) [-773.798] * (-771.350) (-776.922) [-773.591] (-772.843) -- 0:00:55
140000 -- [-772.558] (-774.434) (-771.739) (-775.582) * (-772.453) (-773.703) [-775.768] (-772.030) -- 0:00:55
Average standard deviation of split frequencies: 0.020896
140500 -- (-774.504) (-771.570) [-772.383] (-775.346) * (-772.957) (-771.698) (-775.193) [-773.754] -- 0:00:55
141000 -- (-775.579) [-772.283] (-771.215) (-773.087) * (-775.171) [-771.202] (-772.321) (-772.311) -- 0:00:54
141500 -- (-771.619) [-771.721] (-771.229) (-772.872) * (-775.717) (-771.358) (-774.517) [-771.563] -- 0:00:54
142000 -- (-772.098) (-773.300) [-774.339] (-771.675) * [-773.214] (-770.711) (-776.409) (-770.894) -- 0:00:54
142500 -- (-771.580) [-771.722] (-772.833) (-773.323) * [-772.749] (-773.160) (-776.581) (-770.614) -- 0:00:54
143000 -- [-774.582] (-772.084) (-771.686) (-777.292) * (-772.116) (-773.561) (-774.054) [-773.503] -- 0:00:53
143500 -- [-772.340] (-771.400) (-772.200) (-772.858) * (-772.370) [-777.467] (-774.258) (-773.873) -- 0:00:53
144000 -- (-772.970) (-772.714) [-774.363] (-771.721) * [-772.757] (-774.325) (-776.325) (-774.293) -- 0:00:53
144500 -- (-772.938) (-772.147) (-776.462) [-773.862] * [-773.178] (-775.535) (-771.167) (-772.034) -- 0:00:53
145000 -- (-772.031) (-771.274) (-771.468) [-770.913] * (-772.866) [-772.071] (-770.834) (-774.104) -- 0:00:53
Average standard deviation of split frequencies: 0.021752
145500 -- (-772.380) (-773.169) [-771.335] (-772.613) * (-773.542) (-773.529) [-770.872] (-770.705) -- 0:00:52
146000 -- (-772.484) (-770.971) [-772.411] (-775.500) * (-770.933) [-772.320] (-770.650) (-772.094) -- 0:00:52
146500 -- [-772.063] (-772.601) (-774.234) (-773.668) * (-774.707) (-772.731) (-771.750) [-773.544] -- 0:00:52
147000 -- (-770.389) (-772.892) (-774.435) [-773.402] * (-778.511) (-774.894) [-773.402] (-772.432) -- 0:00:52
147500 -- (-770.843) (-771.319) (-773.295) [-774.455] * (-771.832) [-776.244] (-773.393) (-773.658) -- 0:00:52
148000 -- (-772.570) (-771.316) [-773.563] (-771.833) * (-775.586) [-772.634] (-774.058) (-772.878) -- 0:00:51
148500 -- [-771.825] (-771.146) (-771.441) (-773.394) * [-775.819] (-775.210) (-772.858) (-772.071) -- 0:00:51
149000 -- (-774.734) [-770.556] (-776.253) (-771.249) * (-772.667) (-775.207) (-774.329) [-777.475] -- 0:00:51
149500 -- (-775.497) (-770.932) [-770.729] (-774.613) * (-772.792) [-771.447] (-773.930) (-776.556) -- 0:00:51
150000 -- (-773.833) [-771.590] (-775.345) (-773.806) * (-771.448) (-771.830) [-771.031] (-775.300) -- 0:00:51
Average standard deviation of split frequencies: 0.021572
150500 -- (-773.013) (-771.341) (-775.148) [-772.038] * (-771.171) [-772.124] (-770.987) (-774.892) -- 0:00:50
151000 -- [-772.775] (-771.945) (-773.572) (-771.961) * (-772.165) (-771.291) (-776.221) [-771.338] -- 0:00:50
151500 -- [-773.399] (-778.364) (-772.907) (-772.207) * (-771.766) (-772.320) [-777.343] (-770.397) -- 0:00:50
152000 -- (-774.598) [-771.942] (-771.426) (-772.449) * (-771.425) (-770.995) [-771.731] (-770.497) -- 0:00:50
152500 -- (-773.796) (-772.757) (-771.111) [-773.482] * (-775.228) [-771.839] (-773.113) (-771.609) -- 0:00:50
153000 -- [-773.239] (-773.645) (-774.775) (-775.414) * (-772.220) (-773.707) (-773.578) [-778.425] -- 0:00:55
153500 -- (-775.702) [-772.938] (-774.275) (-771.345) * (-775.536) (-777.572) [-773.916] (-772.777) -- 0:00:55
154000 -- (-773.437) (-773.061) [-773.433] (-770.874) * (-774.482) [-774.278] (-772.472) (-771.938) -- 0:00:54
154500 -- (-774.889) (-773.423) [-772.124] (-775.660) * (-774.551) (-776.086) (-771.737) [-773.313] -- 0:00:54
155000 -- (-773.272) [-771.216] (-774.462) (-774.480) * (-774.718) (-777.016) (-771.894) [-773.115] -- 0:00:54
Average standard deviation of split frequencies: 0.021992
155500 -- (-775.349) (-772.287) [-774.809] (-773.152) * (-773.536) (-775.599) (-775.774) [-771.327] -- 0:00:54
156000 -- (-771.009) [-771.740] (-775.714) (-773.991) * (-771.619) (-774.666) (-773.401) [-770.754] -- 0:00:54
156500 -- (-774.328) (-777.478) (-772.218) [-773.614] * (-772.929) [-775.195] (-771.504) (-770.710) -- 0:00:53
157000 -- (-775.208) (-773.893) [-776.065] (-773.821) * (-772.535) (-771.821) (-770.926) [-772.389] -- 0:00:53
157500 -- (-774.716) (-772.541) (-774.147) [-774.408] * (-773.816) [-773.047] (-771.810) (-771.791) -- 0:00:53
158000 -- (-770.554) (-772.504) (-770.691) [-773.186] * (-771.017) [-771.344] (-773.785) (-771.483) -- 0:00:53
158500 -- (-772.328) (-772.208) (-773.002) [-772.318] * (-771.277) [-771.730] (-771.971) (-772.103) -- 0:00:53
159000 -- (-776.156) [-772.015] (-776.374) (-774.300) * (-771.525) (-772.051) [-773.129] (-771.423) -- 0:00:52
159500 -- (-774.872) [-778.922] (-772.398) (-772.414) * [-771.761] (-771.772) (-771.450) (-772.270) -- 0:00:52
160000 -- (-773.902) (-774.164) (-773.341) [-772.834] * (-771.308) (-775.357) [-774.131] (-775.738) -- 0:00:52
Average standard deviation of split frequencies: 0.019723
160500 -- (-771.384) [-771.254] (-774.616) (-778.936) * (-772.668) [-771.676] (-775.520) (-774.389) -- 0:00:52
161000 -- (-774.531) [-773.233] (-771.902) (-771.529) * [-772.316] (-773.915) (-771.567) (-773.507) -- 0:00:52
161500 -- (-772.841) [-777.611] (-773.664) (-771.220) * (-777.560) [-774.099] (-772.011) (-774.641) -- 0:00:51
162000 -- (-773.212) (-779.279) (-772.083) [-772.899] * (-774.483) (-775.298) (-772.516) [-774.924] -- 0:00:51
162500 -- (-773.959) (-776.866) (-774.679) [-770.342] * (-771.761) (-775.987) (-772.962) [-773.102] -- 0:00:51
163000 -- (-772.006) (-777.140) (-774.311) [-778.196] * [-773.354] (-772.767) (-771.565) (-777.375) -- 0:00:51
163500 -- (-770.832) (-773.059) [-771.899] (-772.886) * (-773.038) [-772.603] (-772.947) (-774.161) -- 0:00:51
164000 -- (-774.834) (-776.224) [-772.739] (-773.495) * [-771.323] (-773.869) (-775.013) (-774.134) -- 0:00:50
164500 -- [-773.576] (-771.739) (-771.942) (-774.022) * [-773.366] (-774.201) (-774.105) (-775.398) -- 0:00:50
165000 -- (-772.930) (-772.792) (-771.516) [-774.777] * (-771.002) (-770.910) (-773.783) [-774.346] -- 0:00:50
Average standard deviation of split frequencies: 0.017487
165500 -- [-772.340] (-771.372) (-775.119) (-773.402) * [-771.178] (-772.239) (-772.296) (-771.885) -- 0:00:50
166000 -- (-779.724) [-772.290] (-771.027) (-771.278) * [-770.696] (-776.983) (-771.555) (-772.223) -- 0:00:50
166500 -- (-771.450) (-771.334) [-772.015] (-775.705) * (-770.501) (-772.177) [-771.875] (-771.433) -- 0:00:50
167000 -- (-771.862) [-774.195] (-770.861) (-776.254) * (-772.159) (-772.554) [-771.057] (-773.356) -- 0:00:49
167500 -- [-770.376] (-780.576) (-771.403) (-773.750) * (-770.894) (-770.951) (-774.853) [-773.892] -- 0:00:49
168000 -- [-770.935] (-774.819) (-771.092) (-774.238) * (-771.171) (-770.961) [-772.291] (-772.251) -- 0:00:49
168500 -- (-771.967) [-772.085] (-771.957) (-772.730) * (-770.952) (-770.979) [-772.035] (-771.524) -- 0:00:49
169000 -- (-771.998) (-778.319) (-771.966) [-771.052] * [-773.351] (-774.794) (-773.625) (-771.321) -- 0:00:49
169500 -- (-774.512) (-773.403) [-772.894] (-771.543) * (-771.353) (-773.835) (-774.421) [-771.786] -- 0:00:48
170000 -- (-772.676) (-772.535) [-772.074] (-771.903) * (-771.860) [-771.490] (-774.247) (-771.882) -- 0:00:48
Average standard deviation of split frequencies: 0.018198
170500 -- (-772.339) (-777.002) (-770.772) [-772.793] * (-774.729) (-773.080) (-772.286) [-772.337] -- 0:00:53
171000 -- (-774.119) [-771.038] (-771.586) (-779.327) * (-773.243) (-772.213) (-771.232) [-773.060] -- 0:00:53
171500 -- [-770.860] (-771.893) (-772.105) (-772.190) * (-771.509) (-774.956) [-772.268] (-772.357) -- 0:00:53
172000 -- (-773.036) (-771.263) (-772.674) [-771.369] * [-772.833] (-773.996) (-774.112) (-773.831) -- 0:00:52
172500 -- (-775.285) [-771.706] (-771.095) (-774.469) * [-773.147] (-773.348) (-773.015) (-772.714) -- 0:00:52
173000 -- [-773.713] (-773.824) (-772.867) (-771.117) * (-772.864) (-780.090) [-772.418] (-774.677) -- 0:00:52
173500 -- (-774.785) (-772.709) (-772.699) [-771.640] * [-772.384] (-775.977) (-772.089) (-772.982) -- 0:00:52
174000 -- (-771.273) [-773.460] (-771.165) (-772.466) * (-772.566) [-778.714] (-771.879) (-771.459) -- 0:00:52
174500 -- (-772.415) [-773.709] (-771.304) (-774.462) * (-776.819) (-777.183) (-774.215) [-773.190] -- 0:00:52
175000 -- (-780.594) (-773.090) (-775.811) [-776.269] * (-775.811) (-773.053) [-772.070] (-772.360) -- 0:00:51
Average standard deviation of split frequencies: 0.017173
175500 -- (-772.587) (-770.885) (-771.289) [-774.680] * (-772.918) (-772.844) (-775.062) [-772.059] -- 0:00:51
176000 -- (-773.560) (-775.501) [-772.647] (-770.828) * (-773.008) (-772.630) (-773.259) [-773.314] -- 0:00:51
176500 -- [-771.613] (-771.744) (-773.311) (-772.450) * (-771.677) (-771.040) [-774.086] (-770.993) -- 0:00:51
177000 -- (-771.495) (-774.653) [-771.452] (-773.004) * (-770.872) (-772.966) [-772.585] (-772.312) -- 0:00:51
177500 -- (-772.217) [-771.821] (-773.430) (-773.263) * (-771.727) (-781.922) (-772.829) [-770.756] -- 0:00:50
178000 -- (-773.393) [-771.689] (-777.836) (-772.434) * (-772.685) (-773.636) [-772.604] (-775.486) -- 0:00:50
178500 -- (-773.856) (-771.194) [-774.436] (-771.704) * (-771.754) (-774.244) [-773.137] (-771.560) -- 0:00:50
179000 -- (-773.036) (-771.332) (-774.280) [-774.686] * (-772.703) [-774.404] (-772.768) (-772.048) -- 0:00:50
179500 -- (-777.100) (-771.125) [-771.331] (-776.089) * (-771.412) (-774.365) (-772.011) [-771.222] -- 0:00:50
180000 -- (-771.745) (-772.083) [-773.889] (-773.699) * (-776.084) (-771.963) (-778.790) [-774.503] -- 0:00:50
Average standard deviation of split frequencies: 0.017958
180500 -- (-774.895) (-776.113) [-771.386] (-772.591) * (-775.600) (-774.157) [-777.970] (-772.202) -- 0:00:49
181000 -- (-775.543) (-771.693) (-771.757) [-775.873] * (-772.429) (-773.986) [-774.112] (-771.739) -- 0:00:49
181500 -- (-772.715) [-772.171] (-772.007) (-771.692) * (-772.924) (-772.324) (-773.898) [-771.450] -- 0:00:49
182000 -- (-774.934) (-771.126) (-771.562) [-771.742] * [-772.037] (-771.788) (-772.240) (-772.861) -- 0:00:49
182500 -- (-772.922) (-771.121) [-774.409] (-773.969) * (-771.466) [-773.887] (-773.566) (-772.257) -- 0:00:49
183000 -- (-771.696) (-774.179) [-775.459] (-778.440) * [-773.648] (-771.459) (-774.860) (-772.937) -- 0:00:49
183500 -- (-771.415) (-772.532) [-771.898] (-774.570) * (-773.691) [-773.443] (-776.141) (-770.943) -- 0:00:48
184000 -- (-770.766) (-773.860) (-774.849) [-772.611] * (-771.821) (-773.710) [-773.245] (-778.582) -- 0:00:48
184500 -- (-770.971) (-771.590) [-773.397] (-770.521) * (-774.890) (-773.870) [-776.045] (-775.057) -- 0:00:48
185000 -- (-773.912) [-772.259] (-772.704) (-772.018) * [-775.781] (-772.235) (-772.330) (-773.451) -- 0:00:48
Average standard deviation of split frequencies: 0.017178
185500 -- (-771.677) (-774.722) [-774.271] (-773.368) * (-772.360) (-773.483) [-773.435] (-773.815) -- 0:00:48
186000 -- (-771.044) (-775.497) [-770.898] (-771.139) * (-772.450) (-776.539) [-770.832] (-772.419) -- 0:00:48
186500 -- (-772.072) (-773.372) (-777.596) [-772.765] * [-771.773] (-772.640) (-771.575) (-776.838) -- 0:00:47
187000 -- (-772.097) [-776.394] (-776.292) (-772.184) * (-772.884) (-773.245) [-771.761] (-772.372) -- 0:00:52
187500 -- (-772.150) [-773.132] (-776.487) (-772.000) * [-770.795] (-773.638) (-771.995) (-773.168) -- 0:00:52
188000 -- [-771.557] (-772.622) (-772.967) (-771.780) * (-771.587) [-772.364] (-772.693) (-774.143) -- 0:00:51
188500 -- (-772.607) (-772.160) [-772.760] (-773.635) * (-770.780) (-772.589) (-772.704) [-774.656] -- 0:00:51
189000 -- [-771.152] (-770.397) (-772.795) (-772.963) * (-771.134) (-772.967) [-771.187] (-773.450) -- 0:00:51
189500 -- (-770.681) (-771.864) [-771.469] (-771.871) * (-773.508) (-772.235) [-772.430] (-770.550) -- 0:00:51
190000 -- [-771.108] (-771.234) (-771.348) (-772.345) * [-774.324] (-770.941) (-777.692) (-773.888) -- 0:00:51
Average standard deviation of split frequencies: 0.018406
190500 -- (-772.233) (-778.137) (-773.809) [-772.193] * (-775.828) (-774.247) [-770.538] (-772.137) -- 0:00:50
191000 -- [-775.132] (-776.759) (-771.160) (-777.949) * (-774.650) (-777.194) [-772.447] (-778.504) -- 0:00:50
191500 -- [-776.003] (-776.736) (-773.217) (-774.998) * [-772.178] (-771.364) (-770.823) (-773.096) -- 0:00:50
192000 -- (-771.800) [-773.755] (-773.798) (-772.488) * (-773.669) (-772.671) [-773.413] (-774.075) -- 0:00:50
192500 -- (-771.466) [-771.432] (-772.541) (-771.458) * [-772.980] (-771.398) (-770.837) (-771.551) -- 0:00:50
193000 -- (-771.738) (-771.448) [-772.779] (-770.529) * (-771.311) (-771.588) [-773.748] (-774.044) -- 0:00:50
193500 -- (-771.324) (-774.272) (-772.272) [-773.967] * (-771.209) (-772.338) [-772.755] (-772.171) -- 0:00:50
194000 -- (-770.732) (-773.274) (-771.595) [-772.111] * (-770.720) (-771.719) (-775.494) [-771.886] -- 0:00:49
194500 -- (-773.201) [-772.751] (-773.379) (-772.262) * [-772.758] (-772.191) (-773.283) (-771.415) -- 0:00:49
195000 -- (-773.597) [-773.759] (-773.171) (-773.697) * (-774.138) (-772.241) [-771.839] (-771.459) -- 0:00:49
Average standard deviation of split frequencies: 0.020310
195500 -- (-772.795) [-770.334] (-771.207) (-773.848) * (-771.852) (-771.920) (-772.409) [-771.627] -- 0:00:49
196000 -- (-773.106) [-773.642] (-771.071) (-772.412) * [-771.455] (-773.542) (-773.189) (-771.297) -- 0:00:49
196500 -- (-775.610) (-773.818) [-771.357] (-772.559) * (-771.381) [-773.122] (-771.804) (-771.121) -- 0:00:49
197000 -- (-773.379) [-773.138] (-772.362) (-772.546) * (-773.192) [-775.409] (-771.787) (-770.999) -- 0:00:48
197500 -- [-774.025] (-773.317) (-772.387) (-772.482) * (-778.627) [-772.507] (-774.286) (-772.545) -- 0:00:48
198000 -- (-773.989) [-771.388] (-773.612) (-773.334) * (-771.322) [-772.283] (-772.666) (-771.935) -- 0:00:48
198500 -- (-771.154) (-771.285) (-774.787) [-772.673] * (-773.129) [-774.374] (-771.282) (-773.613) -- 0:00:48
199000 -- (-770.816) (-772.021) (-771.508) [-774.359] * (-772.289) (-773.422) [-770.718] (-775.426) -- 0:00:48
199500 -- (-771.003) (-771.425) [-771.912] (-774.368) * [-774.560] (-775.581) (-773.311) (-772.910) -- 0:00:48
200000 -- (-774.739) [-771.116] (-771.898) (-773.942) * (-771.795) [-774.159] (-771.670) (-775.598) -- 0:00:48
Average standard deviation of split frequencies: 0.020490
200500 -- [-772.120] (-771.658) (-771.875) (-774.004) * (-771.673) (-771.844) (-771.324) [-773.507] -- 0:00:47
201000 -- [-772.212] (-772.823) (-774.903) (-772.962) * (-771.826) [-774.248] (-770.373) (-773.103) -- 0:00:47
201500 -- (-772.930) (-773.648) [-772.045] (-773.609) * (-776.201) (-772.233) [-770.639] (-773.298) -- 0:00:47
202000 -- (-772.822) (-773.790) (-772.669) [-771.546] * (-776.075) (-770.667) [-771.619] (-772.842) -- 0:00:47
202500 -- [-774.006] (-774.779) (-776.957) (-773.686) * (-771.353) (-770.379) [-771.476] (-773.022) -- 0:00:47
203000 -- (-777.245) (-773.949) (-772.383) [-771.327] * [-772.216] (-773.742) (-771.242) (-771.132) -- 0:00:47
203500 -- [-772.822] (-772.628) (-772.360) (-771.747) * (-770.712) [-771.575] (-772.130) (-771.722) -- 0:00:46
204000 -- (-773.502) (-773.107) (-772.752) [-772.995] * (-773.194) [-771.130] (-771.777) (-771.476) -- 0:00:46
204500 -- (-776.372) [-772.672] (-772.526) (-773.312) * (-774.226) (-772.161) (-771.805) [-771.894] -- 0:00:50
205000 -- (-774.306) (-771.226) (-771.279) [-772.002] * (-775.575) (-772.331) (-772.712) [-772.032] -- 0:00:50
Average standard deviation of split frequencies: 0.020468
205500 -- (-771.628) [-770.948] (-774.427) (-772.221) * (-773.068) [-772.124] (-771.858) (-773.544) -- 0:00:50
206000 -- (-773.307) [-774.400] (-774.306) (-770.776) * (-773.013) [-771.926] (-771.702) (-773.068) -- 0:00:50
206500 -- (-772.432) (-770.830) [-771.818] (-773.448) * (-773.616) (-772.023) [-771.892] (-772.442) -- 0:00:49
207000 -- (-773.161) (-771.545) [-773.628] (-773.960) * [-772.616] (-772.724) (-771.000) (-770.827) -- 0:00:49
207500 -- (-772.342) [-772.189] (-778.234) (-773.402) * (-772.859) (-773.331) (-772.853) [-772.034] -- 0:00:49
208000 -- (-770.976) (-771.289) (-774.664) [-772.232] * (-771.733) [-771.615] (-771.943) (-771.800) -- 0:00:49
208500 -- (-770.888) [-770.502] (-775.075) (-773.461) * (-771.968) [-772.673] (-771.727) (-771.266) -- 0:00:49
209000 -- [-772.618] (-775.189) (-773.777) (-771.931) * [-772.340] (-772.483) (-773.142) (-770.955) -- 0:00:49
209500 -- [-772.490] (-774.243) (-771.397) (-773.268) * [-771.754] (-772.713) (-777.662) (-772.449) -- 0:00:49
210000 -- (-776.351) (-772.493) [-772.187] (-773.057) * (-774.722) [-771.594] (-772.370) (-771.302) -- 0:00:48
Average standard deviation of split frequencies: 0.020015
210500 -- (-772.650) [-775.386] (-774.488) (-771.846) * (-772.819) (-777.681) [-772.318] (-773.475) -- 0:00:48
211000 -- [-771.733] (-774.124) (-776.669) (-775.455) * [-777.104] (-777.979) (-771.617) (-771.715) -- 0:00:48
211500 -- (-773.250) (-774.347) [-773.152] (-770.927) * (-774.589) [-772.661] (-771.483) (-773.254) -- 0:00:48
212000 -- (-772.724) [-771.905] (-771.161) (-773.338) * (-771.265) (-774.552) [-770.664] (-771.866) -- 0:00:48
212500 -- (-772.907) [-772.021] (-770.760) (-771.165) * (-776.226) (-775.428) (-774.393) [-773.750] -- 0:00:48
213000 -- (-772.156) (-771.572) [-771.435] (-770.900) * (-774.397) (-771.255) [-772.151] (-773.232) -- 0:00:48
213500 -- (-777.349) (-771.929) [-773.593] (-778.373) * (-776.769) (-774.273) (-773.214) [-771.825] -- 0:00:47
214000 -- (-771.986) (-771.340) [-773.506] (-770.720) * (-772.718) [-771.576] (-773.282) (-771.343) -- 0:00:47
214500 -- (-772.801) (-772.783) (-772.318) [-770.695] * [-771.658] (-771.047) (-773.100) (-773.923) -- 0:00:47
215000 -- (-773.351) (-772.541) (-774.092) [-771.505] * (-771.618) (-779.005) (-772.775) [-776.681] -- 0:00:47
Average standard deviation of split frequencies: 0.019763
215500 -- (-774.466) (-773.620) (-771.480) [-770.951] * (-771.352) [-772.708] (-772.526) (-772.623) -- 0:00:47
216000 -- [-771.956] (-776.742) (-771.145) (-773.816) * (-771.569) [-774.185] (-773.701) (-772.763) -- 0:00:47
216500 -- (-773.288) [-775.058] (-775.978) (-773.395) * (-772.697) (-772.887) (-770.627) [-773.664] -- 0:00:47
217000 -- [-775.347] (-773.436) (-773.096) (-775.771) * (-772.666) (-773.990) [-770.952] (-772.704) -- 0:00:46
217500 -- (-776.474) (-771.137) [-771.738] (-774.842) * (-772.587) (-774.469) (-773.162) [-772.481] -- 0:00:46
218000 -- (-772.769) [-770.800] (-774.283) (-772.627) * (-771.554) [-772.467] (-772.051) (-774.267) -- 0:00:46
218500 -- (-770.888) [-773.304] (-773.321) (-775.279) * (-774.678) (-773.261) [-770.473] (-773.631) -- 0:00:46
219000 -- (-770.440) (-770.878) (-773.724) [-772.982] * [-772.312] (-773.420) (-772.471) (-772.523) -- 0:00:46
219500 -- (-770.703) (-771.014) (-772.327) [-773.578] * (-772.838) (-771.886) (-774.917) [-771.788] -- 0:00:46
220000 -- [-772.076] (-770.851) (-770.848) (-773.391) * [-772.552] (-772.330) (-772.571) (-772.021) -- 0:00:46
Average standard deviation of split frequencies: 0.019101
220500 -- (-772.549) (-772.458) [-771.650] (-772.744) * (-772.244) (-772.189) [-771.603] (-773.947) -- 0:00:45
221000 -- (-774.918) (-770.830) (-773.156) [-776.266] * (-776.040) [-771.599] (-772.842) (-772.904) -- 0:00:45
221500 -- (-774.802) [-776.931] (-772.857) (-777.390) * (-771.560) (-771.105) (-772.006) [-774.775] -- 0:00:49
222000 -- [-772.448] (-774.898) (-782.563) (-776.867) * (-771.341) [-772.060] (-778.999) (-771.472) -- 0:00:49
222500 -- (-772.452) [-772.824] (-772.317) (-771.542) * (-770.741) (-774.731) (-772.649) [-772.126] -- 0:00:48
223000 -- (-773.106) (-774.629) [-772.637] (-772.187) * (-770.813) (-770.970) [-776.706] (-771.204) -- 0:00:48
223500 -- [-773.513] (-772.484) (-772.387) (-772.313) * (-774.261) [-771.334] (-772.711) (-774.311) -- 0:00:48
224000 -- (-775.026) (-772.244) (-771.401) [-773.897] * (-776.583) (-770.983) [-772.490] (-774.318) -- 0:00:48
224500 -- (-771.232) (-771.798) [-773.501] (-771.092) * (-771.972) (-772.048) [-784.908] (-773.207) -- 0:00:48
225000 -- (-770.302) (-772.627) [-772.227] (-770.550) * (-774.482) (-774.110) (-773.009) [-772.504] -- 0:00:48
Average standard deviation of split frequencies: 0.018895
225500 -- (-771.769) (-773.593) (-774.610) [-774.586] * [-774.484] (-778.864) (-775.959) (-772.382) -- 0:00:48
226000 -- [-773.539] (-771.381) (-771.943) (-773.703) * (-772.182) (-775.903) (-776.015) [-773.424] -- 0:00:47
226500 -- [-772.706] (-772.053) (-771.088) (-771.779) * (-771.667) (-776.628) (-774.829) [-774.718] -- 0:00:47
227000 -- (-771.325) (-771.372) [-772.728] (-775.208) * (-772.696) (-771.758) [-772.536] (-780.052) -- 0:00:47
227500 -- [-773.942] (-774.427) (-771.591) (-771.295) * [-770.830] (-774.572) (-774.556) (-777.085) -- 0:00:47
228000 -- [-777.795] (-774.347) (-773.091) (-772.107) * [-771.083] (-772.096) (-773.024) (-776.044) -- 0:00:47
228500 -- (-771.346) (-773.855) [-773.074] (-771.303) * (-771.750) [-771.203] (-771.440) (-776.619) -- 0:00:47
229000 -- (-772.404) (-773.351) [-772.954] (-773.519) * (-772.676) (-774.570) (-771.798) [-772.546] -- 0:00:47
229500 -- (-773.681) [-775.630] (-773.055) (-773.816) * [-773.091] (-773.143) (-774.307) (-772.077) -- 0:00:47
230000 -- (-772.553) [-771.574] (-771.025) (-774.414) * (-772.292) [-772.331] (-774.155) (-771.669) -- 0:00:46
Average standard deviation of split frequencies: 0.019595
230500 -- [-773.516] (-771.868) (-775.435) (-777.357) * (-771.082) (-772.563) [-775.366] (-773.586) -- 0:00:46
231000 -- (-771.824) (-773.675) [-771.670] (-773.705) * [-771.923] (-772.495) (-776.840) (-773.439) -- 0:00:46
231500 -- (-771.472) (-776.361) (-771.401) [-772.985] * (-771.199) [-773.547] (-776.860) (-772.204) -- 0:00:46
232000 -- (-772.952) (-772.277) (-772.647) [-771.372] * (-771.697) (-771.888) (-771.318) [-772.799] -- 0:00:46
232500 -- (-775.970) (-772.865) [-773.353] (-772.148) * (-772.082) (-774.341) (-771.776) [-771.561] -- 0:00:46
233000 -- [-772.204] (-773.187) (-775.362) (-773.187) * (-773.593) [-774.184] (-771.408) (-771.773) -- 0:00:46
233500 -- (-772.200) [-773.483] (-774.302) (-772.388) * (-775.114) (-771.130) [-771.416] (-776.613) -- 0:00:45
234000 -- (-774.071) (-773.604) (-773.441) [-773.276] * [-772.430] (-772.045) (-772.449) (-779.364) -- 0:00:45
234500 -- (-777.136) (-775.213) [-770.745] (-775.929) * (-773.308) (-772.030) (-772.457) [-775.098] -- 0:00:45
235000 -- [-772.895] (-772.996) (-773.639) (-774.029) * (-774.986) [-772.260] (-774.240) (-772.008) -- 0:00:45
Average standard deviation of split frequencies: 0.020092
235500 -- (-773.807) (-774.169) (-774.626) [-774.978] * (-774.836) (-771.180) [-771.175] (-772.241) -- 0:00:45
236000 -- (-772.527) (-774.190) (-774.579) [-774.602] * (-785.756) (-771.161) (-773.263) [-771.070] -- 0:00:45
236500 -- [-771.550] (-773.953) (-772.518) (-773.487) * (-775.217) [-771.678] (-771.764) (-772.872) -- 0:00:45
237000 -- [-776.975] (-774.113) (-770.505) (-772.818) * (-771.743) (-773.924) (-770.782) [-773.407] -- 0:00:45
237500 -- (-775.969) (-771.863) [-773.006] (-772.534) * (-771.992) [-775.100] (-773.933) (-774.203) -- 0:00:44
238000 -- [-775.193] (-772.732) (-774.343) (-771.754) * [-771.223] (-774.447) (-776.286) (-771.651) -- 0:00:48
238500 -- (-774.950) [-775.131] (-770.645) (-772.390) * (-771.028) (-773.352) (-775.771) [-773.856] -- 0:00:47
239000 -- (-773.736) (-770.494) [-773.023] (-773.621) * (-773.063) (-770.304) (-772.828) [-773.160] -- 0:00:47
239500 -- [-773.411] (-772.169) (-772.758) (-771.800) * (-773.411) [-770.768] (-774.151) (-771.487) -- 0:00:47
240000 -- (-771.102) (-771.831) [-772.830] (-771.373) * (-776.263) [-770.669] (-773.467) (-774.300) -- 0:00:47
Average standard deviation of split frequencies: 0.016976
240500 -- (-776.742) [-774.185] (-774.402) (-772.849) * (-771.979) (-775.642) (-776.446) [-772.863] -- 0:00:47
241000 -- [-776.435] (-775.970) (-776.452) (-772.017) * (-773.943) [-777.210] (-771.482) (-775.737) -- 0:00:47
241500 -- (-773.323) (-777.230) (-772.910) [-773.157] * (-772.377) [-771.287] (-771.293) (-778.782) -- 0:00:47
242000 -- [-772.231] (-772.643) (-771.353) (-772.394) * (-775.560) (-775.152) (-775.349) [-773.389] -- 0:00:46
242500 -- (-772.286) [-774.972] (-774.050) (-773.049) * (-773.880) [-776.133] (-771.565) (-771.176) -- 0:00:46
243000 -- (-771.168) (-773.786) [-772.203] (-773.808) * (-780.626) (-773.698) [-772.737] (-773.564) -- 0:00:46
243500 -- (-775.366) (-775.353) [-772.348] (-773.624) * (-773.932) (-776.442) [-773.432] (-772.721) -- 0:00:46
244000 -- (-771.392) [-773.569] (-771.029) (-771.180) * (-774.623) (-773.297) [-773.601] (-771.407) -- 0:00:46
244500 -- [-770.641] (-773.301) (-774.350) (-773.094) * (-777.076) (-772.729) (-774.252) [-774.151] -- 0:00:46
245000 -- (-772.433) (-771.501) (-776.452) [-772.412] * (-772.591) (-771.764) [-772.617] (-772.153) -- 0:00:46
Average standard deviation of split frequencies: 0.017134
245500 -- [-772.769] (-773.479) (-776.674) (-772.383) * (-773.785) [-771.382] (-771.342) (-773.508) -- 0:00:46
246000 -- (-772.603) (-774.312) [-771.614] (-773.839) * (-772.233) (-771.759) [-772.839] (-771.045) -- 0:00:45
246500 -- (-771.990) (-772.163) [-772.201] (-775.946) * (-775.246) (-772.758) [-770.774] (-772.652) -- 0:00:45
247000 -- (-775.938) (-774.205) [-772.213] (-775.198) * (-772.702) [-774.671] (-771.156) (-773.229) -- 0:00:45
247500 -- (-772.774) [-772.064] (-772.176) (-775.092) * [-772.442] (-777.659) (-772.830) (-773.771) -- 0:00:45
248000 -- [-773.393] (-771.289) (-771.111) (-776.496) * (-771.364) (-772.379) [-771.163] (-772.979) -- 0:00:45
248500 -- (-774.675) (-771.448) [-771.146] (-773.180) * [-771.465] (-771.946) (-774.748) (-773.370) -- 0:00:45
249000 -- (-772.638) [-772.633] (-771.198) (-773.382) * (-775.027) (-773.075) (-774.448) [-771.297] -- 0:00:45
249500 -- (-772.671) (-770.784) (-774.204) [-775.055] * (-774.344) (-774.851) (-771.081) [-770.910] -- 0:00:45
250000 -- [-771.907] (-772.143) (-772.554) (-776.556) * (-773.889) (-774.495) [-771.175] (-773.505) -- 0:00:45
Average standard deviation of split frequencies: 0.017810
250500 -- (-772.635) (-774.295) [-771.216] (-772.137) * (-771.690) (-779.058) [-772.905] (-773.264) -- 0:00:44
251000 -- (-774.475) (-771.839) [-771.737] (-771.422) * (-772.471) (-774.186) (-774.888) [-773.559] -- 0:00:44
251500 -- (-772.887) [-772.793] (-771.978) (-772.368) * (-778.497) (-774.420) [-774.057] (-771.971) -- 0:00:44
252000 -- (-773.457) [-771.334] (-772.556) (-772.386) * [-773.893] (-773.351) (-773.999) (-774.567) -- 0:00:44
252500 -- (-770.577) (-774.526) (-772.576) [-772.937] * (-781.597) (-775.351) [-776.630] (-773.448) -- 0:00:44
253000 -- (-771.574) [-770.785] (-771.597) (-771.739) * (-774.253) (-772.647) [-771.357] (-778.629) -- 0:00:44
253500 -- (-772.256) (-770.785) [-771.551] (-771.654) * (-771.982) (-775.236) [-770.411] (-776.789) -- 0:00:44
254000 -- (-771.597) (-772.097) [-771.705] (-774.846) * (-771.674) (-773.748) (-772.538) [-771.492] -- 0:00:44
254500 -- (-772.737) [-772.507] (-771.479) (-771.469) * (-772.247) [-772.328] (-772.159) (-772.841) -- 0:00:43
255000 -- (-772.526) (-772.026) [-771.650] (-771.275) * (-773.456) (-771.110) [-773.398] (-772.520) -- 0:00:46
Average standard deviation of split frequencies: 0.018414
255500 -- (-770.892) (-773.222) [-771.389] (-775.021) * [-773.165] (-774.276) (-770.842) (-773.160) -- 0:00:46
256000 -- (-776.071) (-777.238) (-771.468) [-774.716] * (-775.474) (-772.534) [-772.889] (-776.900) -- 0:00:46
256500 -- (-777.159) (-770.757) (-771.356) [-778.795] * [-773.308] (-771.815) (-771.931) (-775.156) -- 0:00:46
257000 -- (-772.525) (-774.031) [-773.350] (-771.480) * [-771.782] (-772.751) (-777.594) (-772.975) -- 0:00:46
257500 -- (-772.958) (-771.045) (-779.698) [-776.915] * (-772.223) [-774.517] (-773.763) (-775.252) -- 0:00:46
258000 -- (-774.535) (-772.982) (-772.583) [-773.985] * (-771.558) [-773.941] (-771.122) (-771.553) -- 0:00:46
258500 -- (-774.500) [-771.431] (-774.152) (-775.970) * (-773.256) (-775.124) [-771.075] (-772.400) -- 0:00:45
259000 -- (-770.829) (-772.422) (-773.323) [-773.704] * (-772.193) (-774.350) (-773.921) [-774.136] -- 0:00:45
259500 -- [-772.796] (-772.905) (-773.994) (-774.339) * (-772.984) [-773.437] (-779.960) (-772.023) -- 0:00:45
260000 -- (-772.124) (-776.712) [-771.855] (-773.519) * (-772.451) [-771.379] (-771.929) (-772.027) -- 0:00:45
Average standard deviation of split frequencies: 0.018085
260500 -- (-776.325) [-774.725] (-772.780) (-776.004) * (-771.698) (-772.047) [-773.639] (-774.574) -- 0:00:45
261000 -- [-772.131] (-774.730) (-774.041) (-777.775) * [-772.644] (-774.144) (-772.655) (-776.663) -- 0:00:45
261500 -- (-771.988) [-772.593] (-771.809) (-772.558) * (-772.968) (-771.436) (-773.836) [-776.004] -- 0:00:45
262000 -- (-770.834) (-779.144) (-771.174) [-770.841] * (-772.741) [-770.980] (-775.397) (-772.982) -- 0:00:45
262500 -- (-771.389) [-770.800] (-772.064) (-776.399) * (-772.310) (-773.835) (-772.054) [-771.698] -- 0:00:44
263000 -- (-771.840) [-771.297] (-773.836) (-771.865) * (-772.046) [-771.096] (-771.417) (-771.600) -- 0:00:44
263500 -- (-771.094) (-772.557) (-772.085) [-770.418] * [-772.087] (-773.256) (-774.441) (-771.748) -- 0:00:44
264000 -- [-772.488] (-771.195) (-775.482) (-771.067) * (-772.789) (-775.374) (-773.750) [-772.241] -- 0:00:44
264500 -- (-777.873) (-772.204) (-772.995) [-771.773] * [-771.439] (-774.630) (-772.963) (-772.363) -- 0:00:44
265000 -- (-772.843) (-772.183) [-773.540] (-772.082) * [-771.460] (-773.847) (-772.774) (-774.751) -- 0:00:44
Average standard deviation of split frequencies: 0.016934
265500 -- (-772.037) (-772.961) [-773.230] (-774.287) * [-772.278] (-773.104) (-774.297) (-772.421) -- 0:00:44
266000 -- (-772.459) [-771.863] (-773.333) (-773.151) * (-773.551) (-771.783) [-773.659] (-772.816) -- 0:00:44
266500 -- (-772.775) [-774.667] (-772.414) (-774.662) * (-775.048) (-771.326) [-775.381] (-771.653) -- 0:00:44
267000 -- (-773.100) [-772.612] (-770.959) (-773.564) * (-775.171) (-776.123) [-773.297] (-775.983) -- 0:00:43
267500 -- (-771.665) (-772.321) (-772.726) [-773.689] * (-773.452) [-773.916] (-773.691) (-771.057) -- 0:00:43
268000 -- (-770.556) [-772.001] (-773.580) (-773.374) * (-772.933) (-774.538) (-774.751) [-771.923] -- 0:00:43
268500 -- (-772.559) (-772.713) [-776.993] (-770.996) * (-772.002) [-771.831] (-776.273) (-775.764) -- 0:00:43
269000 -- [-771.037] (-774.355) (-776.041) (-773.201) * (-771.807) (-773.972) (-772.192) [-775.024] -- 0:00:43
269500 -- (-773.277) (-772.683) (-775.044) [-778.316] * (-772.486) [-773.624] (-771.437) (-773.055) -- 0:00:43
270000 -- (-776.112) [-773.203] (-771.731) (-773.830) * (-772.986) [-772.091] (-771.684) (-773.138) -- 0:00:43
Average standard deviation of split frequencies: 0.016289
270500 -- (-775.564) [-771.521] (-772.876) (-770.862) * (-779.518) (-771.107) [-771.841] (-777.172) -- 0:00:43
271000 -- (-775.072) (-771.210) [-775.699] (-772.272) * (-774.561) (-770.653) [-773.271] (-774.606) -- 0:00:43
271500 -- (-771.170) (-771.997) (-774.597) [-771.226] * (-773.467) (-774.341) [-771.928] (-771.211) -- 0:00:45
272000 -- (-773.583) (-773.157) (-773.631) [-770.707] * [-776.855] (-773.062) (-770.808) (-771.079) -- 0:00:45
272500 -- (-774.898) (-771.618) [-771.519] (-774.637) * (-776.907) [-772.773] (-774.984) (-772.809) -- 0:00:45
273000 -- [-772.041] (-772.926) (-772.454) (-777.073) * (-774.273) (-772.453) (-770.809) [-772.425] -- 0:00:45
273500 -- (-770.987) [-773.479] (-772.466) (-774.550) * (-772.805) (-776.883) (-771.419) [-772.852] -- 0:00:45
274000 -- (-773.189) (-775.195) [-772.919] (-775.356) * [-772.103] (-775.335) (-771.769) (-775.872) -- 0:00:45
274500 -- [-771.919] (-774.652) (-774.792) (-776.763) * (-773.292) (-771.763) (-771.201) [-774.157] -- 0:00:44
275000 -- [-772.419] (-771.301) (-773.134) (-771.502) * (-771.865) (-773.941) [-770.737] (-771.939) -- 0:00:44
Average standard deviation of split frequencies: 0.017783
275500 -- (-771.744) (-770.476) [-773.409] (-773.561) * (-774.500) (-771.231) [-773.594] (-776.882) -- 0:00:44
276000 -- [-770.984] (-775.224) (-772.647) (-771.257) * (-776.053) (-771.343) (-772.449) [-770.936] -- 0:00:44
276500 -- (-772.125) (-773.668) (-771.547) [-771.280] * (-773.211) [-771.150] (-772.588) (-772.371) -- 0:00:44
277000 -- (-773.008) (-772.174) (-776.115) [-773.567] * [-777.652] (-771.254) (-772.411) (-776.575) -- 0:00:44
277500 -- (-771.520) [-771.747] (-771.511) (-775.109) * (-773.930) (-774.354) [-770.955] (-774.530) -- 0:00:44
278000 -- (-772.988) (-773.427) (-771.927) [-771.934] * (-771.858) (-776.343) [-772.901] (-771.032) -- 0:00:44
278500 -- (-779.363) (-772.333) (-773.371) [-771.942] * (-772.002) (-776.209) [-773.744] (-772.380) -- 0:00:44
279000 -- (-778.927) (-778.741) (-771.237) [-772.583] * (-776.615) (-776.067) [-771.328] (-772.138) -- 0:00:43
279500 -- (-776.482) (-777.576) (-772.297) [-772.029] * (-774.388) (-771.566) [-772.307] (-774.058) -- 0:00:43
280000 -- (-772.449) (-776.399) (-772.112) [-771.610] * (-777.944) (-771.656) [-772.489] (-773.046) -- 0:00:43
Average standard deviation of split frequencies: 0.017487
280500 -- [-772.661] (-772.992) (-771.989) (-772.073) * [-776.079] (-772.605) (-773.812) (-774.242) -- 0:00:43
281000 -- (-778.105) (-775.908) [-771.563] (-772.519) * (-778.386) [-772.073] (-773.592) (-772.626) -- 0:00:43
281500 -- (-775.078) [-777.688] (-773.113) (-771.643) * (-775.921) (-772.169) (-772.075) [-773.107] -- 0:00:43
282000 -- (-774.558) [-774.903] (-771.827) (-771.276) * (-771.960) (-772.066) [-771.646] (-773.654) -- 0:00:43
282500 -- (-775.806) [-774.041] (-770.465) (-771.534) * [-773.054] (-773.496) (-773.257) (-775.155) -- 0:00:43
283000 -- [-771.994] (-772.231) (-775.343) (-770.929) * (-773.565) (-774.878) (-771.729) [-772.177] -- 0:00:43
283500 -- (-773.472) [-771.938] (-771.783) (-770.464) * [-771.761] (-771.675) (-771.597) (-776.347) -- 0:00:42
284000 -- (-773.094) (-771.472) (-772.819) [-773.584] * (-774.949) [-773.440] (-772.274) (-773.582) -- 0:00:42
284500 -- [-776.038] (-773.808) (-771.744) (-775.478) * (-775.472) (-775.187) (-771.983) [-773.365] -- 0:00:42
285000 -- (-772.844) [-771.608] (-771.297) (-774.699) * (-774.865) [-773.143] (-771.363) (-774.857) -- 0:00:42
Average standard deviation of split frequencies: 0.016580
285500 -- (-771.936) (-771.648) (-773.315) [-772.518] * (-773.982) [-772.196] (-771.176) (-777.756) -- 0:00:42
286000 -- [-771.649] (-771.824) (-772.487) (-773.036) * (-772.359) [-771.430] (-771.430) (-775.770) -- 0:00:42
286500 -- [-771.850] (-773.402) (-771.852) (-771.126) * [-772.495] (-773.347) (-771.259) (-771.705) -- 0:00:42
287000 -- (-772.122) (-771.434) [-774.093] (-774.473) * [-771.641] (-776.020) (-773.163) (-771.741) -- 0:00:42
287500 -- (-772.627) (-772.695) [-776.817] (-772.550) * [-771.265] (-774.659) (-772.620) (-776.012) -- 0:00:42
288000 -- (-770.919) [-770.728] (-775.458) (-771.546) * (-774.043) (-770.807) [-770.726] (-772.476) -- 0:00:44
288500 -- [-772.985] (-771.044) (-777.104) (-773.822) * (-777.580) (-773.537) [-771.329] (-774.896) -- 0:00:44
289000 -- (-773.893) (-772.314) [-771.187] (-772.236) * (-772.551) (-772.544) (-771.899) [-775.147] -- 0:00:44
289500 -- [-771.040] (-772.543) (-772.613) (-775.781) * (-774.974) (-772.180) (-771.133) [-775.101] -- 0:00:44
290000 -- (-771.946) [-774.370] (-775.600) (-772.280) * [-774.880] (-772.608) (-772.389) (-773.822) -- 0:00:44
Average standard deviation of split frequencies: 0.016218
290500 -- [-773.134] (-779.690) (-772.933) (-771.589) * [-771.939] (-772.883) (-773.379) (-774.922) -- 0:00:43
291000 -- (-775.756) [-773.147] (-771.714) (-771.119) * (-772.795) [-772.426] (-776.822) (-774.915) -- 0:00:43
291500 -- (-771.250) [-771.780] (-773.576) (-771.751) * (-772.519) (-775.106) (-775.014) [-771.072] -- 0:00:43
292000 -- (-774.872) (-772.291) (-771.836) [-773.676] * [-772.288] (-775.047) (-771.946) (-772.036) -- 0:00:43
292500 -- [-771.909] (-772.138) (-772.027) (-774.375) * (-771.990) (-779.690) (-772.406) [-771.147] -- 0:00:43
293000 -- [-775.472] (-772.142) (-772.183) (-777.691) * (-777.396) (-775.730) [-771.580] (-771.850) -- 0:00:43
293500 -- (-773.012) (-771.711) [-774.230] (-771.270) * (-772.669) (-771.120) [-772.222] (-772.004) -- 0:00:43
294000 -- (-772.402) (-770.799) (-775.935) [-771.144] * (-771.522) (-771.756) (-773.089) [-771.435] -- 0:00:43
294500 -- (-776.405) (-772.365) (-773.195) [-771.753] * (-773.178) (-774.358) (-774.215) [-772.467] -- 0:00:43
295000 -- (-774.229) [-771.020] (-773.889) (-771.753) * (-775.283) (-774.009) [-774.036] (-774.327) -- 0:00:43
Average standard deviation of split frequencies: 0.015551
295500 -- (-774.009) [-772.114] (-771.493) (-770.998) * (-773.824) [-774.857] (-771.342) (-775.691) -- 0:00:42
296000 -- (-772.167) (-772.480) (-771.174) [-771.439] * [-771.423] (-776.276) (-773.214) (-774.017) -- 0:00:42
296500 -- [-773.843] (-772.143) (-771.174) (-773.600) * (-775.971) (-775.633) [-771.173] (-777.308) -- 0:00:42
297000 -- (-774.538) [-770.567] (-771.103) (-772.268) * (-771.106) (-772.602) (-771.310) [-772.552] -- 0:00:42
297500 -- (-771.355) (-773.911) (-772.175) [-775.002] * (-771.565) (-771.218) (-771.362) [-772.673] -- 0:00:42
298000 -- [-773.055] (-775.543) (-771.151) (-772.450) * (-771.467) (-771.806) (-772.298) [-774.182] -- 0:00:42
298500 -- (-772.872) (-772.154) [-777.637] (-772.973) * [-772.408] (-773.709) (-775.434) (-773.528) -- 0:00:42
299000 -- [-771.864] (-775.875) (-774.101) (-773.178) * (-775.409) (-777.434) [-772.351] (-776.696) -- 0:00:42
299500 -- (-776.110) [-771.679] (-780.032) (-773.129) * (-770.645) [-772.224] (-771.758) (-774.336) -- 0:00:42
300000 -- (-771.676) (-772.667) [-771.497] (-774.594) * (-772.483) [-771.563] (-770.773) (-773.556) -- 0:00:42
Average standard deviation of split frequencies: 0.015417
300500 -- (-772.079) [-771.417] (-771.532) (-773.010) * (-772.146) [-774.765] (-772.511) (-772.245) -- 0:00:41
301000 -- [-772.185] (-772.538) (-773.719) (-772.879) * [-771.041] (-771.299) (-772.064) (-772.192) -- 0:00:41
301500 -- [-772.210] (-773.742) (-771.935) (-773.343) * (-772.654) [-770.583] (-772.040) (-771.964) -- 0:00:41
302000 -- [-770.831] (-772.067) (-772.426) (-772.971) * [-772.048] (-771.110) (-781.829) (-771.217) -- 0:00:41
302500 -- (-772.929) [-772.933] (-770.795) (-772.118) * (-774.097) [-771.489] (-773.470) (-773.839) -- 0:00:41
303000 -- (-773.813) [-774.721] (-771.894) (-773.467) * (-773.212) [-773.374] (-771.401) (-771.229) -- 0:00:41
303500 -- (-772.756) [-773.310] (-771.119) (-776.140) * (-772.565) (-771.219) (-775.272) [-773.187] -- 0:00:41
304000 -- (-772.867) [-773.438] (-773.118) (-772.670) * [-772.169] (-778.663) (-775.761) (-775.797) -- 0:00:41
304500 -- (-771.923) (-773.889) (-771.186) [-774.146] * [-770.702] (-772.119) (-772.634) (-774.496) -- 0:00:43
305000 -- (-774.553) (-771.169) (-778.276) [-774.074] * [-772.734] (-772.781) (-772.521) (-771.835) -- 0:00:43
Average standard deviation of split frequencies: 0.015491
305500 -- (-776.560) (-772.062) [-773.497] (-775.621) * (-772.857) (-771.708) (-772.315) [-771.478] -- 0:00:43
306000 -- (-771.627) (-771.984) [-772.894] (-777.353) * (-772.413) (-771.687) [-773.537] (-770.737) -- 0:00:43
306500 -- (-771.612) (-772.469) (-774.983) [-773.988] * (-773.163) [-773.680] (-775.467) (-775.100) -- 0:00:42
307000 -- [-770.649] (-770.673) (-770.800) (-773.591) * (-772.585) (-776.616) [-772.740] (-774.471) -- 0:00:42
307500 -- (-773.495) (-770.456) [-771.903] (-770.945) * (-771.878) (-772.569) (-771.733) [-775.715] -- 0:00:42
308000 -- [-775.219] (-773.597) (-774.407) (-774.456) * (-771.105) [-771.228] (-771.158) (-774.474) -- 0:00:42
308500 -- (-775.771) (-771.182) (-773.175) [-772.937] * (-772.871) (-776.183) [-772.519] (-771.659) -- 0:00:42
309000 -- (-772.475) (-771.720) (-773.417) [-776.458] * (-774.002) (-772.642) [-771.943] (-773.499) -- 0:00:42
309500 -- (-772.765) (-771.195) [-772.552] (-775.951) * (-776.874) (-771.881) [-773.013] (-774.261) -- 0:00:42
310000 -- (-773.444) (-771.941) [-770.788] (-782.739) * [-772.397] (-771.719) (-774.173) (-773.516) -- 0:00:42
Average standard deviation of split frequencies: 0.015973
310500 -- [-771.781] (-774.212) (-772.326) (-781.381) * (-770.963) (-773.035) (-772.067) [-771.200] -- 0:00:42
311000 -- [-771.952] (-771.334) (-771.589) (-772.755) * (-773.401) [-774.115] (-772.860) (-772.937) -- 0:00:42
311500 -- (-772.397) (-771.713) [-772.825] (-774.803) * (-773.916) (-773.357) (-771.935) [-772.707] -- 0:00:41
312000 -- (-773.388) (-772.031) (-775.816) [-774.578] * (-772.077) (-775.315) (-775.792) [-772.700] -- 0:00:41
312500 -- [-772.027] (-771.550) (-772.844) (-772.884) * (-771.988) (-776.657) [-772.391] (-772.819) -- 0:00:41
313000 -- (-774.703) (-772.095) (-775.119) [-776.501] * (-774.130) (-774.052) [-773.510] (-771.510) -- 0:00:41
313500 -- [-772.563] (-773.255) (-775.803) (-772.258) * [-772.110] (-774.874) (-772.345) (-772.955) -- 0:00:41
314000 -- (-773.216) (-773.331) [-772.666] (-771.201) * (-776.499) [-772.056] (-773.087) (-774.578) -- 0:00:41
314500 -- (-771.744) [-772.794] (-771.509) (-772.260) * (-771.753) (-771.910) [-771.338] (-773.138) -- 0:00:41
315000 -- (-772.117) (-772.840) (-773.913) [-771.282] * (-772.115) [-773.499] (-772.059) (-773.433) -- 0:00:41
Average standard deviation of split frequencies: 0.018252
315500 -- [-772.157] (-774.118) (-771.939) (-773.433) * (-774.021) (-775.189) (-775.141) [-774.866] -- 0:00:41
316000 -- (-772.021) [-776.238] (-776.442) (-771.031) * [-771.873] (-771.813) (-773.014) (-773.920) -- 0:00:41
316500 -- (-773.370) (-776.858) [-772.608] (-777.185) * (-775.514) [-771.265] (-774.039) (-771.290) -- 0:00:41
317000 -- [-772.243] (-778.874) (-773.069) (-773.513) * (-775.914) (-772.470) [-776.414] (-773.992) -- 0:00:40
317500 -- [-773.967] (-776.325) (-772.760) (-774.753) * (-772.419) [-771.386] (-777.252) (-770.959) -- 0:00:40
318000 -- [-771.631] (-774.400) (-774.476) (-775.070) * (-774.392) (-778.457) [-771.151] (-770.754) -- 0:00:40
318500 -- [-770.881] (-774.010) (-771.215) (-774.594) * [-771.506] (-776.430) (-771.242) (-771.492) -- 0:00:40
319000 -- [-771.142] (-775.767) (-771.829) (-774.362) * (-771.906) (-774.248) [-774.652] (-770.683) -- 0:00:40
319500 -- (-776.870) [-772.078] (-774.201) (-772.504) * (-772.550) (-773.677) [-771.979] (-771.142) -- 0:00:40
320000 -- (-772.453) [-776.657] (-773.752) (-773.814) * (-774.070) [-773.946] (-770.795) (-772.119) -- 0:00:40
Average standard deviation of split frequencies: 0.018160
320500 -- (-772.844) (-775.759) [-771.357] (-773.074) * (-774.046) (-776.272) [-772.971] (-772.432) -- 0:00:40
321000 -- (-772.057) (-774.430) (-771.850) [-771.247] * (-773.062) [-772.322] (-774.150) (-774.971) -- 0:00:42
321500 -- (-771.995) (-774.539) (-771.291) [-771.338] * (-770.876) (-774.577) (-774.360) [-771.377] -- 0:00:42
322000 -- [-770.784] (-774.191) (-771.213) (-771.981) * (-772.732) [-772.354] (-771.852) (-771.360) -- 0:00:42
322500 -- [-773.094] (-770.970) (-776.178) (-772.600) * (-773.085) [-773.373] (-771.810) (-774.115) -- 0:00:42
323000 -- [-774.218] (-771.874) (-775.080) (-773.348) * (-772.731) (-776.089) [-771.822] (-775.255) -- 0:00:41
323500 -- [-774.273] (-773.400) (-776.735) (-772.992) * (-771.594) (-772.384) (-771.110) [-772.145] -- 0:00:41
324000 -- (-774.712) (-772.144) [-775.177] (-771.623) * (-771.788) (-772.656) [-773.780] (-773.086) -- 0:00:41
324500 -- (-772.091) (-773.702) [-771.494] (-773.504) * (-772.174) [-771.116] (-774.571) (-773.730) -- 0:00:41
325000 -- (-773.756) (-772.683) (-774.395) [-772.202] * (-774.173) (-773.169) (-776.400) [-771.018] -- 0:00:41
Average standard deviation of split frequencies: 0.018798
325500 -- [-775.966] (-772.838) (-771.544) (-775.176) * (-770.884) [-772.212] (-775.761) (-771.169) -- 0:00:41
326000 -- (-773.677) (-775.260) (-774.083) [-772.183] * (-771.237) (-775.900) [-773.619] (-772.793) -- 0:00:41
326500 -- (-773.537) (-776.597) [-774.346] (-771.586) * (-771.334) [-776.784] (-775.562) (-773.509) -- 0:00:41
327000 -- (-774.068) (-781.350) (-774.957) [-771.679] * [-771.327] (-775.355) (-777.910) (-771.805) -- 0:00:41
327500 -- [-772.760] (-775.262) (-774.076) (-773.039) * (-773.933) [-777.207] (-776.002) (-772.125) -- 0:00:41
328000 -- (-772.907) [-771.858] (-771.402) (-779.417) * (-774.398) [-771.363] (-773.620) (-772.842) -- 0:00:40
328500 -- (-771.433) [-771.858] (-771.727) (-771.621) * (-772.620) (-770.992) (-772.326) [-772.825] -- 0:00:40
329000 -- [-773.816] (-771.358) (-775.749) (-773.246) * [-774.410] (-774.861) (-774.947) (-771.460) -- 0:00:40
329500 -- (-771.685) [-772.342] (-775.145) (-770.715) * [-773.440] (-772.884) (-775.302) (-772.698) -- 0:00:40
330000 -- (-773.152) [-772.311] (-774.464) (-771.525) * (-772.248) [-773.330] (-772.444) (-778.443) -- 0:00:40
Average standard deviation of split frequencies: 0.018030
330500 -- (-772.731) (-775.177) [-775.281] (-773.016) * (-776.997) [-771.782] (-774.626) (-771.818) -- 0:00:40
331000 -- (-776.531) (-773.914) (-774.448) [-771.648] * [-775.967] (-772.892) (-773.861) (-773.640) -- 0:00:40
331500 -- (-773.883) (-771.939) [-775.912] (-773.773) * [-771.024] (-775.471) (-771.616) (-773.382) -- 0:00:40
332000 -- [-772.624] (-774.802) (-772.882) (-771.968) * (-773.076) (-772.500) [-771.287] (-775.065) -- 0:00:40
332500 -- [-774.328] (-772.348) (-773.993) (-772.967) * (-777.037) (-772.789) [-770.868] (-771.835) -- 0:00:40
333000 -- (-773.276) (-774.235) (-772.352) [-776.276] * (-772.750) (-780.339) (-771.863) [-775.091] -- 0:00:40
333500 -- [-773.189] (-775.661) (-770.837) (-771.624) * [-771.939] (-775.884) (-773.797) (-775.152) -- 0:00:39
334000 -- (-777.048) (-775.163) [-770.881] (-779.586) * (-772.230) (-774.415) (-771.196) [-773.465] -- 0:00:39
334500 -- [-774.938] (-771.470) (-772.648) (-770.956) * (-772.738) [-770.720] (-770.750) (-776.107) -- 0:00:39
335000 -- (-773.289) [-773.317] (-773.056) (-774.418) * (-771.242) [-771.809] (-773.932) (-776.589) -- 0:00:39
Average standard deviation of split frequencies: 0.018156
335500 -- [-773.777] (-776.373) (-773.118) (-772.156) * [-770.949] (-775.158) (-774.110) (-774.932) -- 0:00:39
336000 -- (-773.313) (-776.199) (-771.676) [-772.093] * (-776.663) (-772.729) [-772.765] (-775.411) -- 0:00:39
336500 -- (-772.759) (-774.345) (-772.908) [-772.255] * [-773.489] (-776.052) (-771.916) (-778.267) -- 0:00:39
337000 -- (-773.531) (-771.830) [-772.522] (-771.541) * (-772.907) [-772.102] (-770.699) (-773.434) -- 0:00:39
337500 -- (-775.023) [-772.495] (-772.656) (-771.932) * (-773.359) (-774.601) (-772.786) [-771.028] -- 0:00:41
338000 -- (-775.448) (-771.880) [-772.190] (-772.426) * [-771.485] (-775.910) (-775.345) (-773.165) -- 0:00:41
338500 -- (-772.150) [-771.396] (-776.314) (-771.681) * [-771.775] (-773.414) (-775.651) (-771.824) -- 0:00:41
339000 -- (-772.791) (-771.757) (-772.901) [-772.231] * (-781.091) (-776.253) [-772.772] (-772.196) -- 0:00:40
339500 -- [-772.132] (-772.597) (-774.682) (-771.769) * (-773.959) (-771.380) [-771.381] (-771.765) -- 0:00:40
340000 -- (-772.140) (-772.933) [-774.344] (-773.019) * [-772.918] (-771.613) (-771.425) (-775.308) -- 0:00:40
Average standard deviation of split frequencies: 0.018421
340500 -- [-772.767] (-774.046) (-776.641) (-771.278) * (-772.029) (-774.259) (-772.318) [-772.411] -- 0:00:40
341000 -- (-773.075) (-772.287) [-771.255] (-772.173) * (-772.497) (-772.133) [-772.947] (-773.089) -- 0:00:40
341500 -- (-773.488) [-772.061] (-773.450) (-771.134) * (-773.843) (-774.191) [-773.083] (-773.035) -- 0:00:40
342000 -- (-773.668) (-777.117) (-773.034) [-772.376] * (-772.521) (-774.851) [-772.013] (-773.246) -- 0:00:40
342500 -- [-771.287] (-775.007) (-773.692) (-773.826) * (-772.094) (-772.627) [-772.315] (-771.672) -- 0:00:40
343000 -- (-771.356) (-776.483) (-776.275) [-773.019] * (-771.290) [-773.634] (-773.259) (-773.763) -- 0:00:40
343500 -- (-771.630) (-771.715) (-771.529) [-772.423] * (-773.697) (-772.927) [-773.049] (-773.176) -- 0:00:40
344000 -- (-775.804) (-773.656) (-773.427) [-773.377] * (-773.422) [-773.017] (-773.850) (-772.984) -- 0:00:40
344500 -- (-771.278) (-776.533) (-774.949) [-772.411] * (-776.694) [-774.151] (-771.244) (-771.680) -- 0:00:39
345000 -- (-772.187) (-773.046) (-774.667) [-771.244] * [-772.510] (-771.800) (-771.525) (-774.432) -- 0:00:39
Average standard deviation of split frequencies: 0.017952
345500 -- (-779.776) [-772.327] (-774.524) (-774.346) * [-771.464] (-772.316) (-770.874) (-772.247) -- 0:00:39
346000 -- (-773.576) (-772.502) [-771.514] (-775.833) * (-772.720) [-775.429] (-772.515) (-773.763) -- 0:00:39
346500 -- [-774.598] (-775.851) (-774.458) (-774.494) * (-772.524) [-772.269] (-772.579) (-772.202) -- 0:00:39
347000 -- (-773.250) (-771.425) [-772.585] (-770.796) * [-772.280] (-773.293) (-773.850) (-774.149) -- 0:00:39
347500 -- (-770.776) (-773.331) [-774.223] (-771.390) * [-772.730] (-774.350) (-774.202) (-773.948) -- 0:00:39
348000 -- [-777.922] (-773.072) (-771.140) (-774.365) * [-773.068] (-772.930) (-773.232) (-773.079) -- 0:00:39
348500 -- (-776.042) (-772.270) [-775.109] (-772.648) * (-772.077) (-772.142) [-773.114] (-771.120) -- 0:00:39
349000 -- (-774.182) (-772.436) (-771.701) [-777.623] * [-771.249] (-774.055) (-778.075) (-771.138) -- 0:00:39
349500 -- (-770.840) (-775.783) (-772.768) [-772.884] * [-772.105] (-773.001) (-775.692) (-772.281) -- 0:00:39
350000 -- [-771.306] (-772.926) (-771.375) (-774.513) * (-775.696) (-772.375) (-773.952) [-771.334] -- 0:00:39
Average standard deviation of split frequencies: 0.017792
350500 -- [-774.634] (-774.366) (-773.948) (-772.498) * (-773.565) (-771.669) (-771.981) [-772.748] -- 0:00:38
351000 -- [-773.499] (-773.445) (-774.130) (-772.410) * [-774.113] (-772.053) (-771.386) (-776.541) -- 0:00:38
351500 -- (-773.253) (-771.965) [-771.845] (-776.941) * (-775.072) [-772.979] (-775.838) (-773.055) -- 0:00:38
352000 -- (-773.165) (-771.031) [-774.817] (-772.222) * (-775.537) (-773.176) (-773.478) [-779.805] -- 0:00:38
352500 -- (-771.491) (-771.440) [-772.473] (-773.695) * [-774.322] (-774.599) (-771.737) (-771.694) -- 0:00:38
353000 -- [-773.360] (-780.042) (-773.084) (-775.141) * (-772.301) [-773.931] (-774.098) (-773.875) -- 0:00:38
353500 -- (-771.153) (-770.498) [-772.604] (-777.874) * (-771.294) [-772.010] (-771.757) (-773.182) -- 0:00:38
354000 -- (-770.952) (-770.849) [-772.807] (-773.905) * [-772.198] (-771.793) (-770.821) (-773.861) -- 0:00:38
354500 -- (-773.774) (-771.333) (-776.286) [-771.333] * (-774.340) [-771.996] (-774.011) (-773.327) -- 0:00:40
355000 -- [-773.927] (-770.442) (-773.601) (-771.433) * (-771.579) (-771.536) [-771.973] (-772.045) -- 0:00:39
Average standard deviation of split frequencies: 0.017131
355500 -- (-775.124) (-773.153) [-773.431] (-780.005) * [-774.532] (-774.595) (-772.881) (-773.099) -- 0:00:39
356000 -- (-770.668) (-773.846) (-772.987) [-771.226] * (-772.249) (-775.111) (-771.798) [-775.332] -- 0:00:39
356500 -- (-772.179) [-772.021] (-771.337) (-772.253) * (-774.380) (-772.624) (-771.457) [-770.824] -- 0:00:39
357000 -- (-772.753) (-772.853) (-771.419) [-771.975] * [-771.003] (-772.330) (-771.183) (-771.226) -- 0:00:39
357500 -- [-773.992] (-774.168) (-770.576) (-771.259) * [-771.296] (-773.362) (-773.562) (-771.122) -- 0:00:39
358000 -- [-775.131] (-777.242) (-770.538) (-776.004) * [-775.202] (-771.710) (-773.027) (-772.344) -- 0:00:39
358500 -- (-771.810) [-773.805] (-770.660) (-771.140) * (-771.253) (-773.071) (-774.839) [-772.179] -- 0:00:39
359000 -- (-774.472) (-771.743) [-772.423] (-771.772) * (-772.563) (-773.780) [-772.888] (-775.549) -- 0:00:39
359500 -- (-772.503) [-770.703] (-772.986) (-774.694) * (-771.765) (-774.513) [-772.481] (-772.593) -- 0:00:39
360000 -- [-772.370] (-771.373) (-771.849) (-772.945) * (-772.343) (-772.161) [-770.978] (-772.151) -- 0:00:39
Average standard deviation of split frequencies: 0.017645
360500 -- [-772.277] (-773.160) (-772.346) (-772.713) * (-772.169) [-772.686] (-771.165) (-772.685) -- 0:00:39
361000 -- (-772.668) (-772.124) [-773.733] (-775.426) * (-771.147) [-770.385] (-771.987) (-772.291) -- 0:00:38
361500 -- (-775.133) (-772.629) [-773.842] (-773.966) * [-775.319] (-770.962) (-771.556) (-772.624) -- 0:00:38
362000 -- [-771.321] (-777.374) (-773.322) (-775.288) * (-774.336) (-772.134) (-772.331) [-771.670] -- 0:00:38
362500 -- [-772.683] (-774.606) (-772.518) (-775.301) * [-771.074] (-771.414) (-775.059) (-772.958) -- 0:00:38
363000 -- (-774.901) [-778.402] (-771.132) (-775.299) * (-772.245) (-775.616) [-773.305] (-772.004) -- 0:00:38
363500 -- (-772.286) (-775.495) [-771.988] (-774.779) * (-772.436) [-776.797] (-773.225) (-771.717) -- 0:00:38
364000 -- (-770.842) (-772.080) (-773.322) [-773.496] * (-773.008) (-773.758) (-774.740) [-771.135] -- 0:00:38
364500 -- (-772.329) (-775.409) [-772.490] (-773.993) * (-772.721) (-774.859) (-771.503) [-771.055] -- 0:00:38
365000 -- (-775.451) [-774.194] (-771.219) (-772.941) * [-772.052] (-776.481) (-771.269) (-772.298) -- 0:00:38
Average standard deviation of split frequencies: 0.017629
365500 -- (-771.250) [-776.265] (-773.635) (-771.409) * (-773.494) (-781.979) [-778.087] (-770.495) -- 0:00:38
366000 -- (-772.886) (-772.023) (-773.033) [-772.159] * (-773.338) (-771.713) (-773.998) [-774.934] -- 0:00:38
366500 -- (-772.936) [-771.073] (-775.848) (-773.304) * (-771.718) (-771.384) [-778.518] (-776.039) -- 0:00:38
367000 -- (-773.390) [-775.017] (-776.434) (-773.203) * [-771.175] (-772.721) (-773.414) (-776.558) -- 0:00:37
367500 -- (-773.272) (-772.471) (-776.875) [-771.108] * [-774.688] (-770.774) (-772.196) (-771.996) -- 0:00:37
368000 -- [-773.010] (-771.010) (-775.083) (-770.747) * (-771.364) (-775.659) [-772.721] (-771.678) -- 0:00:37
368500 -- (-773.031) (-772.465) [-770.783] (-771.262) * (-773.948) (-773.888) (-772.221) [-771.418] -- 0:00:37
369000 -- [-773.125] (-773.350) (-771.005) (-770.910) * (-780.113) (-776.752) (-773.558) [-772.966] -- 0:00:37
369500 -- (-779.680) [-770.724] (-771.544) (-777.477) * [-774.395] (-771.796) (-772.753) (-770.920) -- 0:00:37
370000 -- (-771.280) (-773.637) (-772.137) [-771.057] * [-773.048] (-772.561) (-773.262) (-772.502) -- 0:00:37
Average standard deviation of split frequencies: 0.016772
370500 -- (-773.411) [-771.444] (-773.894) (-772.725) * (-776.731) (-773.021) (-773.321) [-773.617] -- 0:00:37
371000 -- (-772.442) [-771.192] (-773.879) (-772.720) * (-771.274) [-773.803] (-771.461) (-771.465) -- 0:00:38
371500 -- [-775.029] (-773.197) (-773.748) (-772.662) * (-773.013) [-771.470] (-775.639) (-771.986) -- 0:00:38
372000 -- [-774.380] (-774.828) (-773.350) (-774.532) * (-771.604) [-773.155] (-772.248) (-776.358) -- 0:00:38
372500 -- (-772.107) [-771.062] (-773.633) (-773.590) * (-774.631) (-774.921) [-771.558] (-778.398) -- 0:00:38
373000 -- (-770.964) (-771.073) (-771.449) [-771.481] * [-774.628] (-774.863) (-771.627) (-774.454) -- 0:00:38
373500 -- (-771.627) (-772.802) (-773.352) [-772.485] * (-773.496) (-780.079) [-771.097] (-772.280) -- 0:00:38
374000 -- (-773.032) (-778.626) (-771.466) [-773.020] * (-773.526) (-774.894) [-774.665] (-774.466) -- 0:00:38
374500 -- [-778.456] (-771.867) (-771.086) (-774.236) * (-775.847) (-771.815) (-774.055) [-772.221] -- 0:00:38
375000 -- [-777.078] (-771.935) (-772.237) (-774.245) * (-774.657) (-771.343) (-781.363) [-771.228] -- 0:00:38
Average standard deviation of split frequencies: 0.017631
375500 -- (-774.249) (-774.300) [-771.188] (-773.428) * (-773.034) [-772.388] (-776.638) (-772.468) -- 0:00:38
376000 -- (-774.031) (-773.033) [-773.809] (-772.656) * [-772.394] (-773.008) (-776.238) (-771.179) -- 0:00:38
376500 -- (-778.606) [-774.876] (-773.335) (-773.656) * (-774.023) (-773.125) (-773.806) [-771.920] -- 0:00:38
377000 -- [-775.449] (-774.517) (-772.541) (-771.198) * (-774.116) (-773.697) [-772.121] (-770.376) -- 0:00:38
377500 -- (-775.817) (-773.510) (-773.414) [-771.390] * (-771.766) [-772.742] (-772.121) (-774.367) -- 0:00:37
378000 -- [-774.244] (-778.492) (-771.466) (-771.373) * (-776.386) (-775.145) [-771.868] (-776.741) -- 0:00:37
378500 -- (-771.953) [-772.373] (-772.603) (-772.086) * (-773.369) [-772.579] (-774.624) (-773.215) -- 0:00:37
379000 -- [-771.285] (-773.785) (-772.328) (-774.284) * (-776.402) (-774.276) [-774.259] (-773.147) -- 0:00:37
379500 -- (-772.326) (-773.874) (-775.991) [-773.120] * (-775.354) [-773.122] (-774.767) (-774.249) -- 0:00:37
380000 -- [-771.556] (-772.552) (-774.424) (-771.917) * [-774.012] (-770.887) (-773.755) (-772.589) -- 0:00:37
Average standard deviation of split frequencies: 0.016718
380500 -- [-772.623] (-774.208) (-774.169) (-773.674) * (-773.770) [-775.794] (-771.924) (-773.787) -- 0:00:37
381000 -- (-771.573) [-775.423] (-773.063) (-773.017) * (-773.156) (-772.063) [-773.347] (-773.996) -- 0:00:37
381500 -- (-774.429) (-770.996) [-772.776] (-771.283) * (-773.195) (-771.831) [-774.668] (-774.528) -- 0:00:37
382000 -- (-771.934) (-772.750) [-771.702] (-772.760) * [-774.507] (-772.289) (-772.380) (-774.186) -- 0:00:37
382500 -- [-772.742] (-771.659) (-772.836) (-773.720) * (-774.816) (-774.629) (-772.023) [-774.501] -- 0:00:37
383000 -- (-773.913) [-772.760] (-772.347) (-772.365) * [-777.819] (-774.402) (-771.982) (-772.386) -- 0:00:37
383500 -- (-772.015) [-773.782] (-773.842) (-774.046) * (-773.282) [-772.179] (-772.315) (-773.017) -- 0:00:36
384000 -- [-774.175] (-773.142) (-772.998) (-776.866) * (-776.980) (-773.187) [-772.406] (-773.518) -- 0:00:36
384500 -- (-772.627) (-775.338) [-773.289] (-772.723) * (-774.350) [-773.079] (-771.623) (-776.901) -- 0:00:36
385000 -- (-772.209) [-774.247] (-773.816) (-773.539) * (-770.845) [-771.046] (-774.563) (-775.479) -- 0:00:36
Average standard deviation of split frequencies: 0.015876
385500 -- (-773.084) [-773.005] (-771.580) (-773.441) * (-773.589) (-772.688) [-773.151] (-774.866) -- 0:00:36
386000 -- (-775.847) [-775.896] (-771.609) (-774.025) * (-773.151) [-773.598] (-772.773) (-773.898) -- 0:00:36
386500 -- [-773.032] (-772.450) (-775.654) (-773.846) * (-773.336) [-772.245] (-780.009) (-772.974) -- 0:00:36
387000 -- (-773.136) (-773.256) (-772.888) [-774.006] * (-772.622) (-772.320) [-772.276] (-774.158) -- 0:00:38
387500 -- (-774.144) (-771.501) (-772.194) [-771.026] * (-776.642) (-774.803) (-773.932) [-771.507] -- 0:00:37
388000 -- (-773.713) [-775.392] (-771.296) (-773.687) * (-770.776) [-774.362] (-776.755) (-772.463) -- 0:00:37
388500 -- (-772.512) [-772.560] (-772.577) (-772.374) * (-778.622) [-773.801] (-773.628) (-771.843) -- 0:00:37
389000 -- (-774.356) [-772.443] (-772.259) (-772.233) * (-772.985) [-773.221] (-772.758) (-771.876) -- 0:00:37
389500 -- (-781.590) [-771.315] (-775.722) (-773.237) * (-775.291) [-775.539] (-774.675) (-773.232) -- 0:00:37
390000 -- (-773.553) (-771.619) (-772.244) [-772.762] * [-771.740] (-772.777) (-773.804) (-773.913) -- 0:00:37
Average standard deviation of split frequencies: 0.015838
390500 -- [-777.495] (-771.149) (-775.178) (-774.026) * (-774.897) (-773.487) (-775.315) [-772.924] -- 0:00:37
391000 -- [-771.588] (-771.753) (-774.566) (-774.608) * (-773.857) [-771.179] (-775.564) (-772.868) -- 0:00:37
391500 -- (-772.388) [-774.229] (-770.659) (-777.023) * (-775.132) (-772.800) [-773.121] (-777.797) -- 0:00:37
392000 -- (-772.427) (-775.161) (-776.381) [-772.748] * (-771.707) [-771.238] (-773.056) (-773.152) -- 0:00:37
392500 -- (-774.885) (-771.423) [-773.259] (-776.045) * (-772.406) (-770.981) (-773.404) [-776.660] -- 0:00:37
393000 -- [-771.296] (-774.042) (-771.623) (-773.180) * (-772.708) (-771.967) (-774.102) [-773.544] -- 0:00:37
393500 -- (-772.195) (-772.255) [-771.921] (-772.115) * [-771.730] (-772.406) (-779.690) (-773.778) -- 0:00:36
394000 -- (-776.736) (-774.891) [-771.545] (-773.001) * (-771.622) (-772.380) (-781.181) [-775.451] -- 0:00:36
394500 -- (-774.668) (-771.770) [-772.408] (-773.327) * (-773.075) [-772.081] (-777.091) (-775.198) -- 0:00:36
395000 -- (-772.252) [-773.405] (-774.749) (-772.999) * [-772.620] (-774.613) (-774.579) (-772.780) -- 0:00:36
Average standard deviation of split frequencies: 0.015922
395500 -- [-771.407] (-771.531) (-774.127) (-771.338) * (-771.883) (-773.110) (-776.490) [-774.332] -- 0:00:36
396000 -- (-772.666) (-773.578) [-771.158] (-771.836) * [-772.995] (-775.549) (-771.156) (-776.786) -- 0:00:36
396500 -- (-773.062) (-772.813) (-770.779) [-771.599] * (-775.972) [-771.550] (-774.008) (-774.695) -- 0:00:36
397000 -- (-774.389) (-771.921) [-776.552] (-773.480) * (-772.020) [-770.585] (-771.712) (-772.733) -- 0:00:36
397500 -- (-776.642) [-773.132] (-774.198) (-770.333) * (-772.705) (-771.809) [-770.829] (-774.058) -- 0:00:36
398000 -- [-771.061] (-774.485) (-773.883) (-773.926) * (-776.551) [-775.267] (-772.195) (-772.046) -- 0:00:36
398500 -- [-773.637] (-774.331) (-770.795) (-774.244) * (-773.082) [-772.485] (-771.473) (-771.973) -- 0:00:36
399000 -- (-774.767) (-773.998) [-772.459] (-773.149) * [-773.133] (-772.557) (-771.401) (-772.566) -- 0:00:36
399500 -- (-771.094) [-772.313] (-774.902) (-772.496) * (-771.823) [-772.456] (-772.667) (-770.573) -- 0:00:36
400000 -- [-772.984] (-771.401) (-773.343) (-773.515) * (-771.998) [-771.429] (-771.636) (-773.390) -- 0:00:36
Average standard deviation of split frequencies: 0.015589
400500 -- (-771.147) (-772.289) [-773.260] (-773.133) * (-772.890) (-772.733) (-776.954) [-772.914] -- 0:00:35
401000 -- (-779.706) (-773.371) (-775.598) [-772.970] * [-771.873] (-775.441) (-778.782) (-773.295) -- 0:00:35
401500 -- (-775.519) (-776.201) (-773.518) [-773.930] * (-771.176) (-771.196) (-778.432) [-772.182] -- 0:00:35
402000 -- (-772.954) (-772.471) [-771.895] (-772.028) * (-773.625) (-773.968) (-772.002) [-773.849] -- 0:00:35
402500 -- (-774.561) [-771.206] (-776.845) (-771.503) * (-774.932) (-772.796) (-773.673) [-770.629] -- 0:00:35
403000 -- (-772.850) [-773.427] (-770.760) (-774.628) * [-773.451] (-771.523) (-772.264) (-771.947) -- 0:00:35
403500 -- (-774.811) [-772.305] (-771.878) (-771.193) * (-771.132) (-771.162) (-773.017) [-772.492] -- 0:00:35
404000 -- [-774.119] (-772.737) (-773.783) (-774.464) * (-771.466) (-771.734) [-772.130] (-772.365) -- 0:00:36
404500 -- (-770.795) (-772.235) (-772.120) [-774.440] * (-773.932) (-773.231) [-772.056] (-773.019) -- 0:00:36
405000 -- (-773.179) (-773.639) (-773.707) [-777.448] * (-774.773) [-775.992] (-773.117) (-772.942) -- 0:00:36
Average standard deviation of split frequencies: 0.014343
405500 -- (-774.103) (-773.140) (-778.841) [-771.375] * (-775.242) (-771.834) (-772.960) [-771.978] -- 0:00:36
406000 -- (-773.624) [-774.253] (-772.489) (-772.531) * (-772.513) [-771.418] (-775.121) (-775.012) -- 0:00:36
406500 -- (-772.837) (-777.929) (-772.138) [-773.561] * (-770.798) [-771.688] (-771.854) (-775.909) -- 0:00:36
407000 -- [-770.644] (-773.942) (-771.395) (-774.585) * (-771.542) [-771.803] (-774.873) (-771.604) -- 0:00:36
407500 -- (-770.644) [-774.874] (-775.309) (-773.218) * [-772.724] (-773.099) (-771.725) (-776.721) -- 0:00:36
408000 -- (-771.950) (-774.774) (-775.172) [-770.797] * (-773.253) [-775.524] (-772.936) (-773.295) -- 0:00:36
408500 -- (-770.720) (-773.726) [-771.207] (-774.387) * [-772.425] (-774.888) (-775.866) (-773.295) -- 0:00:36
409000 -- (-772.179) [-772.540] (-772.878) (-773.809) * [-774.618] (-772.732) (-772.332) (-772.616) -- 0:00:36
409500 -- (-775.225) (-775.695) [-775.475] (-774.863) * (-771.683) (-770.972) (-775.861) [-771.609] -- 0:00:36
410000 -- (-772.628) (-776.042) (-774.537) [-774.800] * [-774.876] (-772.588) (-774.595) (-774.802) -- 0:00:35
Average standard deviation of split frequencies: 0.014112
410500 -- (-772.641) (-772.537) (-772.549) [-772.084] * (-773.981) (-776.204) [-777.541] (-778.833) -- 0:00:35
411000 -- (-771.886) (-770.565) [-771.006] (-771.335) * (-772.839) [-773.436] (-774.506) (-771.219) -- 0:00:35
411500 -- (-771.692) [-773.483] (-770.619) (-774.650) * (-770.777) [-772.928] (-771.378) (-773.149) -- 0:00:35
412000 -- (-773.783) (-771.648) [-772.468] (-771.846) * (-771.386) [-774.149] (-772.136) (-774.158) -- 0:00:35
412500 -- (-773.337) (-775.525) (-771.347) [-772.148] * [-771.526] (-776.519) (-773.623) (-772.642) -- 0:00:35
413000 -- [-774.040] (-771.468) (-774.620) (-771.264) * [-772.734] (-776.138) (-775.218) (-770.812) -- 0:00:35
413500 -- (-774.033) (-772.586) (-775.242) [-772.321] * (-773.230) (-776.180) [-774.667] (-772.175) -- 0:00:35
414000 -- (-770.626) [-775.610] (-773.162) (-773.273) * (-773.217) (-774.086) [-771.683] (-773.019) -- 0:00:35
414500 -- (-770.874) [-775.705] (-771.377) (-775.012) * (-772.419) (-774.749) (-772.199) [-772.092] -- 0:00:35
415000 -- [-772.647] (-771.914) (-773.283) (-771.432) * (-776.700) (-774.853) [-771.903] (-773.902) -- 0:00:35
Average standard deviation of split frequencies: 0.013102
415500 -- (-772.241) (-772.086) (-772.508) [-771.877] * (-774.143) (-772.905) [-774.477] (-770.828) -- 0:00:35
416000 -- (-773.131) (-771.819) [-772.695] (-775.621) * [-772.106] (-771.245) (-774.676) (-771.951) -- 0:00:35
416500 -- (-771.923) (-771.899) [-775.726] (-774.073) * (-771.042) (-771.195) [-774.921] (-773.565) -- 0:00:35
417000 -- (-771.213) [-774.015] (-775.177) (-776.818) * [-774.171] (-771.070) (-778.600) (-772.436) -- 0:00:34
417500 -- (-774.942) (-771.393) [-772.069] (-771.339) * (-771.819) (-772.239) (-777.319) [-772.104] -- 0:00:34
418000 -- (-772.450) (-771.743) (-773.053) [-771.079] * (-771.873) [-774.715] (-772.075) (-774.262) -- 0:00:34
418500 -- (-771.619) [-773.912] (-771.552) (-771.093) * (-771.884) (-774.289) [-771.792] (-773.960) -- 0:00:34
419000 -- [-773.850] (-774.938) (-771.488) (-770.631) * [-773.109] (-773.525) (-772.953) (-773.713) -- 0:00:34
419500 -- (-773.515) (-772.402) [-776.936] (-770.776) * (-776.503) (-772.808) [-772.035] (-773.593) -- 0:00:34
420000 -- (-772.234) (-774.225) [-777.110] (-773.183) * (-773.509) (-773.911) (-772.603) [-771.037] -- 0:00:34
Average standard deviation of split frequencies: 0.014107
420500 -- [-771.592] (-774.270) (-775.911) (-772.377) * [-774.059] (-773.566) (-771.233) (-771.668) -- 0:00:35
421000 -- (-774.171) [-772.198] (-774.275) (-771.084) * (-773.700) (-774.354) [-775.599] (-773.904) -- 0:00:35
421500 -- [-772.200] (-772.540) (-771.907) (-772.184) * (-773.074) (-773.417) (-771.722) [-772.081] -- 0:00:35
422000 -- (-772.560) (-773.468) (-773.096) [-773.269] * (-771.582) (-773.309) (-775.232) [-774.395] -- 0:00:35
422500 -- [-774.078] (-772.081) (-773.091) (-777.776) * [-770.982] (-771.745) (-771.717) (-775.267) -- 0:00:35
423000 -- [-771.984] (-771.636) (-770.925) (-773.380) * (-772.479) [-772.870] (-772.681) (-775.649) -- 0:00:35
423500 -- (-771.583) (-773.744) [-771.252] (-773.234) * (-775.672) [-773.108] (-772.086) (-775.462) -- 0:00:35
424000 -- (-772.493) (-774.412) (-773.253) [-775.678] * (-774.125) (-771.653) (-777.680) [-773.801] -- 0:00:35
424500 -- (-774.064) [-771.113] (-771.316) (-775.313) * (-775.715) (-772.013) (-772.925) [-770.933] -- 0:00:35
425000 -- (-773.370) (-773.600) [-771.250] (-775.777) * (-775.979) (-771.902) [-772.851] (-771.365) -- 0:00:35
Average standard deviation of split frequencies: 0.013800
425500 -- (-778.323) (-778.867) (-771.951) [-773.542] * (-774.369) (-774.070) (-773.399) [-772.750] -- 0:00:35
426000 -- (-779.550) [-772.491] (-775.837) (-771.708) * (-780.741) [-773.612] (-772.164) (-773.047) -- 0:00:35
426500 -- (-771.847) (-773.084) (-778.319) [-772.750] * [-772.942] (-774.740) (-772.230) (-774.478) -- 0:00:34
427000 -- (-772.320) (-775.507) (-781.481) [-772.875] * (-772.418) [-772.283] (-772.924) (-776.092) -- 0:00:34
427500 -- (-772.083) (-771.841) [-772.021] (-771.478) * [-772.200] (-776.402) (-770.778) (-776.724) -- 0:00:34
428000 -- (-771.157) (-772.561) (-774.022) [-770.877] * (-772.358) (-770.947) (-771.277) [-771.173] -- 0:00:34
428500 -- [-775.615] (-773.141) (-771.657) (-771.862) * (-774.409) (-772.463) [-771.980] (-772.943) -- 0:00:34
429000 -- (-776.411) [-774.670] (-772.872) (-772.652) * [-772.627] (-772.901) (-772.958) (-773.668) -- 0:00:34
429500 -- (-772.366) [-774.217] (-771.300) (-771.821) * (-774.538) [-772.488] (-774.020) (-771.856) -- 0:00:34
430000 -- [-773.801] (-771.770) (-772.320) (-773.266) * [-772.712] (-771.672) (-772.481) (-776.698) -- 0:00:34
Average standard deviation of split frequencies: 0.012709
430500 -- (-773.940) [-772.197] (-773.664) (-774.020) * (-776.405) (-772.211) (-780.333) [-775.660] -- 0:00:34
431000 -- [-772.323] (-772.854) (-772.867) (-772.054) * (-775.521) (-773.400) (-778.107) [-771.032] -- 0:00:34
431500 -- [-773.055] (-775.580) (-772.843) (-771.315) * (-775.509) (-771.528) [-773.500] (-771.684) -- 0:00:34
432000 -- (-773.217) [-771.396] (-776.461) (-775.530) * (-774.837) (-774.018) (-777.383) [-773.106] -- 0:00:34
432500 -- [-771.864] (-772.526) (-771.573) (-773.312) * [-771.471] (-773.082) (-772.694) (-771.862) -- 0:00:34
433000 -- (-771.457) (-777.845) (-772.732) [-775.790] * (-771.809) (-773.430) (-771.529) [-772.417] -- 0:00:34
433500 -- (-770.805) [-773.317] (-772.966) (-774.289) * (-772.917) (-773.182) [-780.015] (-771.049) -- 0:00:33
434000 -- [-770.804] (-771.369) (-773.983) (-773.509) * (-774.711) [-775.095] (-776.959) (-770.916) -- 0:00:33
434500 -- (-774.574) (-772.109) [-774.014] (-771.874) * (-775.850) (-771.703) [-771.574] (-772.280) -- 0:00:33
435000 -- (-779.577) (-771.942) (-772.232) [-773.368] * [-772.484] (-772.853) (-776.014) (-775.287) -- 0:00:33
Average standard deviation of split frequencies: 0.012211
435500 -- (-771.448) (-775.714) (-772.452) [-771.119] * [-770.899] (-772.311) (-771.913) (-772.413) -- 0:00:33
436000 -- [-775.678] (-773.723) (-775.125) (-772.313) * (-771.977) (-771.901) [-770.791] (-772.842) -- 0:00:33
436500 -- (-772.712) (-774.265) (-773.812) [-771.805] * (-772.402) (-771.800) [-773.158] (-772.493) -- 0:00:33
437000 -- (-775.560) (-772.146) [-771.947] (-771.940) * (-770.742) [-772.059] (-773.481) (-777.566) -- 0:00:34
437500 -- (-774.585) (-773.225) [-771.404] (-772.110) * (-775.279) (-778.930) (-772.212) [-774.409] -- 0:00:34
438000 -- [-771.669] (-774.605) (-773.032) (-774.551) * (-776.176) (-773.942) [-772.070] (-773.408) -- 0:00:34
438500 -- (-773.112) (-773.320) (-773.292) [-775.857] * [-772.757] (-773.871) (-771.839) (-775.708) -- 0:00:34
439000 -- (-775.708) (-772.497) [-772.662] (-773.589) * [-770.828] (-770.725) (-771.235) (-774.377) -- 0:00:34
439500 -- (-772.768) [-772.288] (-778.212) (-771.405) * (-772.251) (-770.893) [-772.232] (-772.841) -- 0:00:34
440000 -- [-770.551] (-772.269) (-773.159) (-772.655) * (-773.218) (-770.693) (-774.130) [-772.975] -- 0:00:34
Average standard deviation of split frequencies: 0.011956
440500 -- (-773.354) (-771.680) (-774.242) [-771.765] * (-773.323) [-771.077] (-777.603) (-773.231) -- 0:00:34
441000 -- [-771.784] (-777.650) (-776.033) (-775.867) * (-771.972) (-772.363) (-773.520) [-773.751] -- 0:00:34
441500 -- (-772.206) (-772.882) (-773.573) [-774.597] * (-770.966) (-771.050) (-772.391) [-772.534] -- 0:00:34
442000 -- (-772.901) (-775.013) (-774.078) [-771.654] * (-776.912) (-774.156) (-777.369) [-774.362] -- 0:00:34
442500 -- (-773.097) [-774.979] (-771.726) (-771.442) * (-774.596) (-772.724) [-774.116] (-775.962) -- 0:00:34
443000 -- [-771.099] (-774.116) (-771.776) (-771.478) * [-776.226] (-774.090) (-772.355) (-772.911) -- 0:00:33
443500 -- (-773.537) [-773.190] (-773.716) (-774.673) * (-774.002) [-772.924] (-773.592) (-772.337) -- 0:00:33
444000 -- (-773.638) (-775.212) (-777.393) [-771.055] * (-776.113) (-772.642) (-771.000) [-772.793] -- 0:00:33
444500 -- (-775.588) (-772.761) [-774.109] (-777.650) * (-774.725) (-772.838) (-771.883) [-771.306] -- 0:00:33
445000 -- (-772.277) (-770.913) [-773.352] (-771.917) * (-771.346) [-772.104] (-772.987) (-772.037) -- 0:00:33
Average standard deviation of split frequencies: 0.011627
445500 -- [-771.740] (-770.645) (-772.258) (-773.349) * (-771.379) (-773.159) (-770.745) [-773.289] -- 0:00:33
446000 -- [-772.428] (-771.687) (-772.528) (-771.884) * [-774.489] (-772.132) (-770.756) (-774.379) -- 0:00:33
446500 -- [-773.176] (-773.221) (-772.657) (-772.723) * [-772.507] (-772.187) (-772.062) (-771.989) -- 0:00:33
447000 -- (-775.060) (-771.504) (-774.111) [-775.948] * (-772.213) (-782.163) [-771.475] (-771.993) -- 0:00:33
447500 -- (-772.776) [-771.950] (-774.125) (-772.041) * (-772.788) (-774.069) (-774.169) [-775.423] -- 0:00:33
448000 -- [-776.490] (-771.224) (-775.280) (-775.132) * (-774.967) [-771.089] (-773.194) (-776.381) -- 0:00:33
448500 -- (-772.800) (-771.776) [-774.183] (-772.425) * (-773.216) (-771.829) (-772.682) [-773.398] -- 0:00:33
449000 -- (-773.242) [-771.089] (-775.257) (-777.770) * [-772.530] (-771.128) (-774.130) (-772.620) -- 0:00:33
449500 -- (-772.890) [-772.543] (-772.741) (-775.378) * (-774.314) (-774.860) [-771.372] (-774.460) -- 0:00:33
450000 -- [-772.762] (-774.268) (-779.507) (-772.173) * (-774.418) [-772.107] (-771.412) (-775.495) -- 0:00:33
Average standard deviation of split frequencies: 0.010768
450500 -- (-776.763) (-773.394) [-775.821] (-772.181) * (-774.247) (-771.350) (-772.386) [-771.185] -- 0:00:32
451000 -- (-780.340) (-773.372) [-778.066] (-779.137) * (-776.855) (-773.940) (-776.058) [-773.120] -- 0:00:32
451500 -- (-772.971) (-772.105) (-776.964) [-772.704] * (-772.627) [-771.008] (-776.526) (-773.160) -- 0:00:32
452000 -- (-775.805) (-771.824) (-772.874) [-774.563] * (-774.273) (-773.308) [-771.208] (-771.817) -- 0:00:32
452500 -- (-780.823) (-774.464) (-777.615) [-772.051] * (-773.033) (-774.806) (-772.131) [-771.469] -- 0:00:32
453000 -- (-776.198) [-775.298] (-775.655) (-776.133) * [-774.651] (-771.978) (-772.519) (-775.942) -- 0:00:32
453500 -- (-771.482) [-772.604] (-771.384) (-770.771) * (-775.454) [-771.409] (-777.986) (-774.279) -- 0:00:32
454000 -- [-771.854] (-772.736) (-773.053) (-770.815) * [-774.637] (-778.367) (-773.405) (-777.913) -- 0:00:33
454500 -- (-772.191) (-774.567) (-772.169) [-771.234] * (-770.793) (-773.056) [-774.424] (-773.870) -- 0:00:33
455000 -- (-774.980) [-772.742] (-776.727) (-774.460) * (-771.382) (-772.362) (-770.692) [-775.512] -- 0:00:33
Average standard deviation of split frequencies: 0.009692
455500 -- (-775.240) (-771.469) [-771.507] (-771.480) * (-773.272) (-770.765) [-771.086] (-772.770) -- 0:00:33
456000 -- (-773.711) (-774.496) [-770.735] (-775.090) * (-773.884) [-770.632] (-771.490) (-773.375) -- 0:00:33
456500 -- (-774.643) (-777.217) [-770.864] (-771.859) * (-773.409) (-771.265) (-777.120) [-770.687] -- 0:00:33
457000 -- (-773.700) (-775.915) (-771.171) [-771.074] * [-771.458] (-771.746) (-771.535) (-773.832) -- 0:00:33
457500 -- [-777.181] (-777.662) (-772.968) (-770.389) * (-773.042) [-771.616] (-772.950) (-774.937) -- 0:00:33
458000 -- (-772.789) (-773.417) [-771.296] (-771.227) * (-772.087) (-772.270) (-771.814) [-770.937] -- 0:00:33
458500 -- (-773.286) [-774.776] (-773.253) (-772.693) * (-773.165) (-771.476) (-771.191) [-772.353] -- 0:00:33
459000 -- (-773.004) (-773.797) (-772.470) [-771.701] * (-775.646) (-773.132) (-771.374) [-772.433] -- 0:00:33
459500 -- (-772.651) (-771.796) [-772.320] (-772.644) * (-774.761) (-775.710) [-773.338] (-776.302) -- 0:00:32
460000 -- (-772.935) (-771.665) (-776.318) [-773.598] * (-773.314) (-771.994) [-772.691] (-774.040) -- 0:00:32
Average standard deviation of split frequencies: 0.008826
460500 -- (-774.001) [-771.249] (-773.124) (-779.541) * (-772.341) (-774.710) [-772.003] (-773.126) -- 0:00:32
461000 -- (-772.189) [-770.833] (-774.457) (-773.652) * (-770.732) [-771.953] (-770.528) (-772.002) -- 0:00:32
461500 -- [-775.393] (-772.798) (-773.195) (-772.877) * (-771.095) [-772.176] (-770.710) (-775.090) -- 0:00:32
462000 -- [-773.856] (-773.127) (-772.422) (-771.638) * (-771.751) (-774.427) (-773.510) [-773.360] -- 0:00:32
462500 -- (-777.035) [-773.334] (-773.567) (-774.826) * (-774.439) (-774.005) [-775.207] (-770.620) -- 0:00:32
463000 -- (-771.055) [-773.760] (-773.138) (-774.421) * (-772.676) (-774.526) (-771.507) [-771.842] -- 0:00:32
463500 -- (-770.443) (-771.467) [-773.207] (-773.464) * (-774.923) [-774.936] (-775.043) (-771.780) -- 0:00:32
464000 -- [-773.002] (-772.571) (-773.993) (-774.776) * [-776.757] (-776.108) (-773.602) (-771.212) -- 0:00:32
464500 -- (-772.695) (-772.274) [-773.627] (-772.386) * [-774.156] (-776.498) (-770.822) (-772.972) -- 0:00:32
465000 -- (-777.110) [-775.275] (-777.728) (-773.934) * (-770.633) (-776.275) [-770.823] (-771.888) -- 0:00:32
Average standard deviation of split frequencies: 0.009164
465500 -- (-784.427) [-774.004] (-775.005) (-773.529) * [-772.648] (-771.339) (-772.079) (-771.255) -- 0:00:32
466000 -- (-771.920) (-771.857) [-771.146] (-770.867) * [-771.087] (-771.376) (-772.797) (-772.372) -- 0:00:32
466500 -- (-774.307) [-771.789] (-771.055) (-771.834) * (-771.776) [-771.606] (-775.641) (-773.835) -- 0:00:32
467000 -- [-771.892] (-774.272) (-771.114) (-771.610) * (-770.912) (-772.527) [-771.398] (-775.550) -- 0:00:31
467500 -- (-773.861) (-770.781) [-771.017] (-775.112) * (-771.618) (-772.412) [-774.918] (-771.212) -- 0:00:31
468000 -- (-775.477) (-774.193) [-777.274] (-781.121) * (-771.404) [-773.666] (-775.852) (-770.579) -- 0:00:31
468500 -- (-774.775) (-776.592) [-772.620] (-771.861) * (-772.203) (-773.174) (-772.586) [-770.940] -- 0:00:31
469000 -- (-777.572) (-774.312) (-772.494) [-772.078] * [-772.644] (-771.974) (-773.217) (-771.925) -- 0:00:31
469500 -- (-777.609) (-773.836) [-772.157] (-774.314) * [-773.794] (-775.549) (-775.940) (-770.773) -- 0:00:31
470000 -- (-771.811) (-773.193) (-771.719) [-775.510] * [-772.319] (-773.223) (-771.573) (-771.057) -- 0:00:31
Average standard deviation of split frequencies: 0.008720
470500 -- (-770.801) [-772.021] (-774.532) (-772.490) * (-772.115) [-771.529] (-771.853) (-775.371) -- 0:00:32
471000 -- (-771.974) [-774.262] (-772.538) (-771.536) * (-772.759) (-774.324) [-771.849] (-775.436) -- 0:00:32
471500 -- [-774.106] (-771.576) (-773.240) (-774.692) * [-772.666] (-773.325) (-772.352) (-772.240) -- 0:00:32
472000 -- (-775.005) (-772.922) [-771.643] (-773.270) * [-772.226] (-776.211) (-773.301) (-772.937) -- 0:00:32
472500 -- [-771.988] (-772.827) (-772.991) (-772.375) * [-770.877] (-771.068) (-771.952) (-772.760) -- 0:00:32
473000 -- (-771.391) (-776.399) [-773.096] (-771.722) * (-773.593) (-774.777) [-771.521] (-773.745) -- 0:00:32
473500 -- (-774.526) (-776.854) (-773.129) [-774.183] * [-773.468] (-774.908) (-774.307) (-774.379) -- 0:00:32
474000 -- [-774.463] (-773.948) (-774.568) (-777.540) * (-770.746) [-774.258] (-771.891) (-772.148) -- 0:00:32
474500 -- (-777.345) [-775.606] (-774.771) (-772.102) * (-771.403) (-775.684) [-772.416] (-771.026) -- 0:00:32
475000 -- (-772.563) (-771.657) (-771.033) [-772.916] * (-773.311) [-772.004] (-775.198) (-771.888) -- 0:00:32
Average standard deviation of split frequencies: 0.008797
475500 -- (-772.927) (-774.143) (-773.145) [-771.331] * (-778.132) (-774.262) (-771.766) [-771.213] -- 0:00:31
476000 -- [-772.242] (-773.350) (-771.324) (-772.855) * [-770.962] (-777.216) (-771.240) (-773.066) -- 0:00:31
476500 -- [-772.377] (-773.948) (-770.737) (-772.525) * (-771.253) [-772.962] (-772.014) (-773.299) -- 0:00:31
477000 -- (-775.345) [-773.995] (-773.458) (-772.367) * (-771.385) (-770.854) (-772.464) [-773.081] -- 0:00:31
477500 -- (-777.848) (-776.764) [-774.397] (-772.582) * (-772.258) [-774.149] (-777.249) (-771.702) -- 0:00:31
478000 -- (-772.723) (-773.490) (-773.191) [-774.308] * (-771.455) [-773.606] (-771.742) (-772.142) -- 0:00:31
478500 -- (-773.639) [-773.684] (-773.023) (-775.558) * [-772.014] (-772.713) (-771.794) (-773.503) -- 0:00:31
479000 -- [-772.624] (-772.434) (-770.855) (-772.360) * (-772.759) (-772.890) (-772.713) [-773.452] -- 0:00:31
479500 -- (-771.300) (-774.338) (-772.687) [-771.833] * (-772.221) (-771.445) (-774.267) [-771.853] -- 0:00:31
480000 -- (-773.121) [-772.922] (-771.553) (-771.291) * (-771.576) [-771.660] (-770.747) (-773.255) -- 0:00:31
Average standard deviation of split frequencies: 0.009057
480500 -- (-773.258) [-772.212] (-770.742) (-771.370) * [-776.375] (-773.241) (-775.999) (-775.023) -- 0:00:31
481000 -- (-773.553) [-771.522] (-776.065) (-773.006) * (-774.149) (-774.142) [-775.235] (-775.104) -- 0:00:31
481500 -- (-775.918) (-774.132) [-771.581] (-779.201) * (-772.767) (-774.122) [-777.770] (-772.893) -- 0:00:31
482000 -- [-772.734] (-771.485) (-771.685) (-774.801) * (-771.669) (-778.239) [-774.474] (-778.669) -- 0:00:31
482500 -- (-771.419) (-771.531) [-773.523] (-771.600) * (-773.889) (-773.206) (-772.215) [-773.850] -- 0:00:31
483000 -- (-774.285) [-773.168] (-774.071) (-774.808) * (-772.128) [-771.013] (-773.200) (-773.466) -- 0:00:31
483500 -- (-776.667) [-776.413] (-774.622) (-772.678) * (-772.906) (-777.551) (-771.271) [-772.672] -- 0:00:30
484000 -- (-772.630) (-774.052) [-774.664] (-774.881) * (-775.742) [-771.921] (-773.874) (-773.800) -- 0:00:30
484500 -- (-772.570) [-772.410] (-772.840) (-772.704) * (-772.330) [-772.444] (-770.886) (-774.919) -- 0:00:30
485000 -- [-771.202] (-772.740) (-773.162) (-774.560) * (-775.338) [-772.666] (-772.703) (-774.503) -- 0:00:30
Average standard deviation of split frequencies: 0.008787
485500 -- (-774.371) (-779.111) (-775.726) [-772.052] * (-773.229) (-772.063) (-773.405) [-773.622] -- 0:00:30
486000 -- [-772.603] (-771.311) (-773.852) (-771.165) * (-775.731) (-772.733) [-773.061] (-773.123) -- 0:00:30
486500 -- [-772.414] (-773.207) (-771.799) (-775.599) * [-772.100] (-771.072) (-775.065) (-774.010) -- 0:00:30
487000 -- (-771.988) [-771.036] (-772.468) (-774.165) * (-773.280) (-771.442) [-773.437] (-772.925) -- 0:00:31
487500 -- [-775.430] (-771.828) (-772.094) (-772.957) * (-774.930) (-772.758) [-771.157] (-775.282) -- 0:00:31
488000 -- (-771.435) [-775.557] (-773.633) (-772.284) * (-773.759) [-770.457] (-771.352) (-771.600) -- 0:00:31
488500 -- (-775.577) (-773.773) [-773.576] (-771.076) * (-772.117) (-771.545) [-773.494] (-772.120) -- 0:00:31
489000 -- (-772.255) (-776.953) [-772.349] (-772.069) * [-771.424] (-773.208) (-771.187) (-772.450) -- 0:00:31
489500 -- (-774.226) (-773.674) [-772.320] (-771.025) * [-773.012] (-772.353) (-772.577) (-771.128) -- 0:00:31
490000 -- [-773.885] (-775.645) (-771.778) (-776.077) * (-772.122) [-770.874] (-772.756) (-772.520) -- 0:00:31
Average standard deviation of split frequencies: 0.009777
490500 -- (-775.346) [-772.912] (-773.326) (-773.680) * (-771.328) (-770.668) [-773.486] (-773.214) -- 0:00:31
491000 -- (-771.432) (-773.162) [-771.530] (-774.866) * (-772.980) (-775.580) [-773.417] (-775.817) -- 0:00:31
491500 -- [-772.871] (-772.368) (-773.843) (-771.588) * (-771.463) (-772.440) (-772.024) [-771.666] -- 0:00:31
492000 -- (-771.643) [-775.339] (-773.346) (-773.742) * (-773.324) (-774.634) (-771.297) [-771.754] -- 0:00:30
492500 -- (-770.873) (-774.937) [-772.279] (-774.798) * (-771.846) (-773.660) (-770.976) [-776.472] -- 0:00:30
493000 -- (-773.073) [-772.693] (-774.023) (-777.172) * (-771.930) [-770.523] (-775.569) (-774.860) -- 0:00:30
493500 -- (-771.305) (-774.997) [-772.190] (-774.518) * (-772.289) [-770.345] (-772.031) (-772.635) -- 0:00:30
494000 -- (-775.964) (-776.601) [-773.232] (-776.071) * (-773.647) (-773.822) (-770.827) [-772.996] -- 0:00:30
494500 -- [-775.206] (-776.683) (-770.722) (-775.604) * (-771.996) (-774.640) [-770.759] (-773.547) -- 0:00:30
495000 -- [-773.689] (-774.717) (-774.488) (-774.267) * (-772.025) [-773.651] (-770.703) (-772.800) -- 0:00:30
Average standard deviation of split frequencies: 0.010098
495500 -- (-773.060) [-772.461] (-771.919) (-772.921) * (-773.552) [-774.076] (-770.591) (-774.612) -- 0:00:30
496000 -- [-771.235] (-773.902) (-771.085) (-772.153) * (-774.221) [-773.488] (-775.628) (-771.611) -- 0:00:30
496500 -- (-771.928) (-773.128) [-771.662] (-772.658) * (-773.013) (-773.349) [-772.739] (-771.824) -- 0:00:30
497000 -- (-773.657) (-772.760) (-772.406) [-771.282] * (-777.688) [-774.634] (-777.482) (-774.001) -- 0:00:30
497500 -- [-771.032] (-773.945) (-776.615) (-772.715) * (-772.369) [-772.778] (-782.684) (-772.818) -- 0:00:30
498000 -- (-772.466) (-773.214) (-777.737) [-774.188] * (-776.867) (-772.651) (-771.063) [-770.775] -- 0:00:30
498500 -- [-771.181] (-775.072) (-772.479) (-770.998) * (-772.439) (-772.755) [-773.768] (-773.871) -- 0:00:30
499000 -- [-771.985] (-775.562) (-770.794) (-773.286) * (-772.482) (-772.506) (-771.872) [-770.930] -- 0:00:30
499500 -- (-771.702) (-772.706) (-772.295) [-771.905] * [-772.767] (-771.462) (-774.463) (-772.639) -- 0:00:30
500000 -- (-773.325) (-771.390) (-772.950) [-771.102] * (-773.216) (-772.183) [-771.969] (-774.350) -- 0:00:30
Average standard deviation of split frequencies: 0.008976
500500 -- (-770.571) (-771.008) (-774.007) [-772.923] * (-771.343) (-775.767) (-771.144) [-771.484] -- 0:00:29
501000 -- (-771.458) [-771.938] (-772.778) (-771.474) * [-771.681] (-774.368) (-770.883) (-772.084) -- 0:00:29
501500 -- (-771.551) (-772.469) (-770.882) [-772.829] * (-773.334) [-771.603] (-771.988) (-772.256) -- 0:00:29
502000 -- (-774.308) (-775.948) [-772.299] (-772.073) * (-770.769) [-774.749] (-774.789) (-774.689) -- 0:00:29
502500 -- (-772.407) [-772.522] (-772.357) (-770.884) * (-776.446) [-771.574] (-773.084) (-771.352) -- 0:00:29
503000 -- [-772.162] (-773.976) (-772.673) (-771.573) * (-772.825) [-775.629] (-771.349) (-773.074) -- 0:00:29
503500 -- (-776.336) (-774.573) (-773.250) [-772.260] * (-774.620) [-774.822] (-770.914) (-772.812) -- 0:00:30
504000 -- (-772.126) (-772.801) [-771.415] (-771.769) * (-776.790) (-772.856) [-772.350] (-772.460) -- 0:00:30
504500 -- (-771.498) (-773.213) (-772.279) [-773.302] * (-776.013) [-772.242] (-770.902) (-772.823) -- 0:00:30
505000 -- (-772.062) (-773.291) (-773.962) [-771.526] * [-772.797] (-771.404) (-772.595) (-775.554) -- 0:00:30
Average standard deviation of split frequencies: 0.008819
505500 -- (-772.837) (-771.594) (-773.686) [-774.784] * (-772.745) (-775.226) (-773.871) [-774.825] -- 0:00:30
506000 -- (-773.456) (-772.101) [-770.960] (-772.670) * [-772.539] (-772.656) (-774.383) (-770.756) -- 0:00:30
506500 -- [-772.004] (-775.574) (-772.128) (-772.684) * (-773.347) (-777.233) (-773.967) [-772.618] -- 0:00:30
507000 -- [-773.558] (-773.073) (-771.416) (-773.308) * [-771.873] (-774.513) (-773.721) (-783.528) -- 0:00:30
507500 -- (-773.419) (-772.274) (-774.375) [-770.957] * (-771.928) (-773.943) (-773.867) [-772.003] -- 0:00:30
508000 -- (-774.336) [-773.925] (-772.097) (-774.935) * (-771.807) (-771.493) (-773.408) [-771.282] -- 0:00:30
508500 -- (-773.850) (-771.783) (-771.456) [-773.010] * [-773.168] (-771.911) (-773.037) (-772.235) -- 0:00:29
509000 -- (-775.995) [-772.112] (-773.553) (-773.399) * [-772.475] (-772.623) (-772.459) (-771.956) -- 0:00:29
509500 -- (-773.308) (-772.336) [-773.494] (-775.531) * (-771.096) (-770.752) (-772.290) [-771.565] -- 0:00:29
510000 -- (-772.643) [-772.990] (-774.690) (-770.856) * (-772.088) (-772.846) (-772.872) [-772.661] -- 0:00:29
Average standard deviation of split frequencies: 0.009108
510500 -- (-775.240) [-771.109] (-771.324) (-771.248) * (-772.360) [-771.111] (-772.119) (-771.941) -- 0:00:29
511000 -- [-776.167] (-770.543) (-774.496) (-772.449) * [-771.683] (-771.713) (-772.623) (-771.293) -- 0:00:29
511500 -- (-775.959) (-770.660) (-770.964) [-771.713] * (-775.465) [-772.343] (-772.761) (-777.043) -- 0:00:29
512000 -- (-773.957) [-770.799] (-771.472) (-771.764) * (-773.866) [-774.049] (-773.681) (-774.670) -- 0:00:29
512500 -- (-771.733) [-771.350] (-772.839) (-773.127) * (-772.857) (-777.083) [-775.765] (-773.591) -- 0:00:29
513000 -- (-774.202) (-772.832) (-773.508) [-773.227] * (-772.977) (-777.695) (-772.223) [-774.494] -- 0:00:29
513500 -- (-775.640) [-772.223] (-771.236) (-774.879) * (-774.889) (-771.770) (-772.350) [-773.938] -- 0:00:29
514000 -- (-771.981) [-773.911] (-772.571) (-774.026) * [-774.516] (-774.285) (-775.449) (-774.297) -- 0:00:29
514500 -- (-772.013) (-778.706) [-772.024] (-772.770) * [-771.773] (-781.066) (-774.037) (-777.762) -- 0:00:29
515000 -- [-771.558] (-773.881) (-775.028) (-775.081) * (-773.126) (-778.176) [-773.073] (-781.233) -- 0:00:29
Average standard deviation of split frequencies: 0.008953
515500 -- (-772.207) [-772.062] (-775.049) (-771.727) * (-772.840) (-770.776) (-771.015) [-772.463] -- 0:00:29
516000 -- (-772.355) (-773.899) (-773.767) [-771.109] * (-773.788) (-775.819) [-772.627] (-771.075) -- 0:00:29
516500 -- [-773.298] (-771.613) (-773.894) (-770.774) * (-776.722) (-775.586) (-772.091) [-772.419] -- 0:00:29
517000 -- (-772.234) (-771.931) (-775.465) [-772.117] * (-774.882) (-774.523) [-774.103] (-773.294) -- 0:00:28
517500 -- (-774.066) [-774.585] (-775.916) (-775.492) * (-774.252) (-773.192) (-772.037) [-773.165] -- 0:00:28
518000 -- [-774.794] (-774.774) (-770.850) (-771.326) * [-771.487] (-772.774) (-772.057) (-771.042) -- 0:00:28
518500 -- [-772.837] (-774.178) (-770.822) (-772.851) * [-773.538] (-772.053) (-772.651) (-773.185) -- 0:00:28
519000 -- (-772.828) (-771.438) [-771.509] (-772.180) * (-771.891) [-772.774] (-776.451) (-777.237) -- 0:00:28
519500 -- (-774.063) (-772.397) (-772.425) [-772.860] * [-771.443] (-771.800) (-774.100) (-780.621) -- 0:00:28
520000 -- (-777.281) [-771.825] (-772.569) (-774.576) * (-774.584) [-770.827] (-776.706) (-776.892) -- 0:00:28
Average standard deviation of split frequencies: 0.009235
520500 -- (-777.042) (-771.055) [-772.477] (-775.528) * (-777.256) (-773.272) [-773.673] (-774.639) -- 0:00:29
521000 -- (-772.068) (-772.442) [-771.896] (-772.290) * (-771.863) (-774.207) [-771.673] (-772.015) -- 0:00:29
521500 -- (-773.318) [-770.688] (-771.007) (-772.975) * (-773.311) (-773.658) [-773.966] (-772.973) -- 0:00:29
522000 -- (-777.975) (-773.601) (-772.971) [-772.827] * (-770.820) (-773.922) (-772.940) [-774.828] -- 0:00:29
522500 -- (-779.087) (-773.395) (-772.870) [-772.887] * (-773.494) (-771.988) [-773.961] (-777.030) -- 0:00:29
523000 -- [-774.073] (-773.193) (-773.566) (-772.276) * (-773.132) (-775.054) (-773.669) [-771.960] -- 0:00:29
523500 -- (-771.758) [-771.502] (-772.467) (-773.302) * (-772.176) (-771.484) [-772.234] (-771.801) -- 0:00:29
524000 -- (-773.004) (-772.059) (-775.736) [-772.058] * [-772.015] (-774.094) (-770.913) (-777.395) -- 0:00:29
524500 -- (-772.809) (-771.469) [-774.436] (-771.507) * [-771.400] (-774.991) (-770.638) (-774.796) -- 0:00:29
525000 -- (-771.768) (-776.415) [-773.562] (-772.713) * [-772.736] (-776.651) (-770.796) (-779.529) -- 0:00:28
Average standard deviation of split frequencies: 0.009380
525500 -- (-771.782) [-774.987] (-771.772) (-773.436) * (-774.078) (-770.390) (-772.003) [-770.750] -- 0:00:28
526000 -- (-771.730) [-775.519] (-771.700) (-773.032) * (-771.785) (-772.743) [-771.069] (-770.845) -- 0:00:28
526500 -- [-772.061] (-773.342) (-773.705) (-772.109) * (-772.353) [-771.830] (-771.840) (-772.204) -- 0:00:28
527000 -- [-773.243] (-774.293) (-779.247) (-772.806) * [-776.015] (-771.244) (-774.670) (-771.704) -- 0:00:28
527500 -- (-772.151) [-772.328] (-772.150) (-772.004) * (-777.337) (-773.636) (-773.084) [-772.009] -- 0:00:28
528000 -- [-771.990] (-771.835) (-773.486) (-779.096) * (-776.471) (-772.039) [-772.717] (-770.866) -- 0:00:28
528500 -- (-773.411) (-771.837) (-776.113) [-773.012] * [-772.823] (-777.513) (-772.577) (-776.503) -- 0:00:28
529000 -- (-774.756) (-774.006) [-772.184] (-773.282) * (-775.473) (-772.476) (-772.987) [-775.568] -- 0:00:28
529500 -- (-773.630) [-772.222] (-773.576) (-771.553) * [-773.315] (-775.235) (-774.722) (-774.176) -- 0:00:28
530000 -- [-771.043] (-771.019) (-773.690) (-773.757) * (-771.342) (-776.260) [-771.220] (-773.108) -- 0:00:28
Average standard deviation of split frequencies: 0.009831
530500 -- [-771.458] (-775.838) (-772.402) (-772.990) * [-773.286] (-773.134) (-773.151) (-775.146) -- 0:00:28
531000 -- (-772.435) [-773.619] (-772.944) (-773.415) * (-776.175) (-771.352) (-776.571) [-773.412] -- 0:00:28
531500 -- (-773.171) (-773.537) [-773.221] (-772.549) * (-772.687) [-772.262] (-772.979) (-772.220) -- 0:00:28
532000 -- (-772.105) (-776.231) [-771.607] (-772.756) * (-775.380) (-772.377) (-773.810) [-770.995] -- 0:00:28
532500 -- (-773.773) (-771.785) (-771.723) [-773.989] * (-774.429) (-771.732) (-771.246) [-772.860] -- 0:00:28
533000 -- (-773.774) (-772.451) [-771.946] (-772.961) * (-775.875) [-774.205] (-775.758) (-774.542) -- 0:00:28
533500 -- [-771.133] (-774.484) (-773.607) (-773.184) * (-772.005) (-774.671) [-771.838] (-775.104) -- 0:00:27
534000 -- (-771.459) (-773.592) [-775.076] (-771.083) * (-772.501) (-775.543) [-771.518] (-772.463) -- 0:00:27
534500 -- (-773.046) (-774.460) [-774.952] (-772.506) * [-773.415] (-774.435) (-773.073) (-772.266) -- 0:00:27
535000 -- (-772.917) (-771.162) [-773.409] (-772.831) * (-772.686) (-772.319) (-774.542) [-771.397] -- 0:00:27
Average standard deviation of split frequencies: 0.009968
535500 -- (-772.540) (-771.579) (-773.757) [-772.358] * (-771.146) [-772.552] (-773.149) (-774.218) -- 0:00:27
536000 -- (-770.528) (-775.200) (-775.779) [-771.637] * (-771.997) [-772.375] (-774.231) (-776.770) -- 0:00:27
536500 -- (-770.687) (-778.140) [-774.756] (-771.100) * (-778.721) (-772.574) [-771.418] (-773.812) -- 0:00:27
537000 -- [-774.442] (-777.275) (-771.827) (-772.602) * (-773.953) (-772.371) [-772.953] (-773.459) -- 0:00:28
537500 -- (-777.168) (-777.270) (-771.392) [-771.318] * (-773.431) (-770.748) (-771.057) [-772.598] -- 0:00:28
538000 -- [-773.009] (-776.353) (-773.219) (-772.386) * (-774.383) [-772.673] (-771.743) (-771.450) -- 0:00:28
538500 -- (-772.860) (-772.356) [-771.814] (-771.195) * [-771.392] (-771.522) (-774.911) (-771.833) -- 0:00:28
539000 -- (-771.712) [-773.847] (-772.424) (-770.631) * (-771.588) (-772.621) (-774.439) [-772.942] -- 0:00:28
539500 -- (-774.727) (-772.454) (-773.768) [-770.631] * (-771.354) [-773.370] (-774.508) (-772.041) -- 0:00:28
540000 -- (-779.696) [-774.797] (-773.995) (-771.127) * [-772.675] (-772.370) (-772.544) (-772.363) -- 0:00:28
Average standard deviation of split frequencies: 0.009649
540500 -- [-775.630] (-772.690) (-771.605) (-771.545) * (-773.625) (-772.658) [-771.739] (-771.800) -- 0:00:28
541000 -- (-772.457) (-772.941) [-772.627] (-770.739) * (-771.589) (-773.021) [-772.136] (-773.406) -- 0:00:27
541500 -- (-772.391) (-776.049) (-773.025) [-771.590] * (-772.696) (-772.887) (-771.196) [-776.602] -- 0:00:27
542000 -- [-773.344] (-771.828) (-775.759) (-771.992) * (-772.031) (-770.653) (-775.374) [-773.116] -- 0:00:27
542500 -- (-773.701) (-773.640) (-775.547) [-773.109] * [-772.266] (-779.025) (-773.095) (-774.609) -- 0:00:27
543000 -- (-771.868) [-772.733] (-778.118) (-774.429) * (-775.334) (-775.925) (-771.772) [-773.737] -- 0:00:27
543500 -- [-773.538] (-770.826) (-771.489) (-772.878) * (-771.390) (-777.203) (-771.276) [-776.783] -- 0:00:27
544000 -- (-776.796) (-774.065) [-770.764] (-776.307) * (-772.339) (-771.580) [-771.988] (-774.600) -- 0:00:27
544500 -- (-775.264) (-770.951) (-772.661) [-773.496] * (-775.788) (-771.874) [-772.483] (-774.268) -- 0:00:27
545000 -- [-771.797] (-771.862) (-771.464) (-773.274) * (-773.422) (-773.753) (-771.289) [-771.496] -- 0:00:27
Average standard deviation of split frequencies: 0.010188
545500 -- [-772.066] (-771.067) (-771.464) (-771.888) * (-773.759) [-771.657] (-773.023) (-773.543) -- 0:00:27
546000 -- [-773.741] (-773.826) (-778.439) (-774.488) * (-771.944) [-770.600] (-773.457) (-771.449) -- 0:00:27
546500 -- (-772.112) (-773.394) (-773.870) [-772.579] * (-770.693) (-771.515) [-773.506] (-772.198) -- 0:00:27
547000 -- (-773.978) (-773.150) [-773.727] (-772.772) * [-770.932] (-770.890) (-773.448) (-776.197) -- 0:00:27
547500 -- (-772.074) (-771.914) (-774.259) [-780.014] * (-772.738) (-774.123) [-771.851] (-770.732) -- 0:00:27
548000 -- (-776.532) (-771.569) (-772.814) [-773.944] * (-779.108) (-770.971) [-771.441] (-770.384) -- 0:00:27
548500 -- (-777.169) (-775.115) (-773.302) [-771.390] * (-772.018) (-772.042) [-771.905] (-771.552) -- 0:00:27
549000 -- [-776.217] (-772.504) (-772.455) (-774.911) * (-772.359) [-772.804] (-773.298) (-773.098) -- 0:00:27
549500 -- (-776.759) [-772.276] (-772.960) (-771.413) * (-774.256) [-775.303] (-771.057) (-771.707) -- 0:00:27
550000 -- (-776.514) [-779.160] (-771.129) (-774.493) * (-776.381) (-778.865) (-774.422) [-772.107] -- 0:00:27
Average standard deviation of split frequencies: 0.010672
550500 -- [-772.268] (-776.341) (-774.520) (-771.228) * (-771.814) (-773.500) (-774.707) [-771.294] -- 0:00:26
551000 -- [-771.147] (-776.490) (-774.596) (-771.856) * (-775.282) [-772.786] (-773.347) (-770.935) -- 0:00:26
551500 -- (-773.747) (-770.707) [-772.750] (-772.202) * (-772.249) (-777.784) [-772.750] (-771.037) -- 0:00:26
552000 -- (-772.205) (-771.873) (-772.217) [-770.997] * (-772.289) (-773.267) [-774.393] (-772.739) -- 0:00:26
552500 -- (-772.120) [-772.123] (-772.946) (-771.941) * [-771.734] (-773.389) (-773.327) (-773.884) -- 0:00:26
553000 -- [-774.364] (-771.867) (-773.148) (-772.054) * [-770.976] (-772.173) (-771.752) (-772.978) -- 0:00:27
553500 -- (-774.164) (-774.545) (-773.299) [-771.923] * [-771.035] (-771.058) (-771.457) (-778.916) -- 0:00:27
554000 -- (-772.372) (-773.961) (-772.542) [-773.858] * (-771.254) [-770.629] (-771.137) (-775.735) -- 0:00:27
554500 -- (-772.549) (-773.153) (-770.970) [-771.132] * (-772.022) (-771.751) [-772.083] (-773.665) -- 0:00:27
555000 -- (-775.301) (-772.560) (-771.252) [-772.295] * (-774.117) [-773.259] (-775.979) (-772.976) -- 0:00:27
Average standard deviation of split frequencies: 0.010118
555500 -- (-775.605) (-770.873) [-771.160] (-772.481) * (-775.473) (-774.323) [-773.145] (-772.819) -- 0:00:27
556000 -- (-776.099) (-772.885) (-772.048) [-772.181] * [-771.435] (-774.582) (-772.844) (-773.482) -- 0:00:27
556500 -- (-774.295) [-775.676] (-772.584) (-773.651) * (-771.122) (-771.717) (-772.386) [-772.080] -- 0:00:27
557000 -- (-772.047) (-776.118) (-773.982) [-770.886] * (-770.950) [-779.432] (-775.113) (-771.477) -- 0:00:27
557500 -- (-771.508) (-773.072) (-779.955) [-771.790] * (-774.114) (-774.767) (-772.719) [-771.445] -- 0:00:26
558000 -- (-775.428) (-772.194) [-777.492] (-772.829) * (-776.264) (-771.687) (-771.591) [-771.423] -- 0:00:26
558500 -- (-771.858) (-771.670) (-771.982) [-773.280] * (-771.777) [-772.408] (-774.576) (-770.882) -- 0:00:26
559000 -- (-773.902) [-772.880] (-774.988) (-772.282) * [-771.016] (-773.482) (-774.300) (-773.564) -- 0:00:26
559500 -- (-771.666) [-771.968] (-774.530) (-771.280) * (-771.046) (-775.204) (-772.358) [-773.524] -- 0:00:26
560000 -- (-773.874) (-771.574) [-771.563] (-778.358) * [-770.762] (-772.773) (-773.602) (-776.247) -- 0:00:26
Average standard deviation of split frequencies: 0.009865
560500 -- [-771.796] (-771.386) (-775.845) (-775.012) * [-773.721] (-772.862) (-771.307) (-774.553) -- 0:00:26
561000 -- (-775.728) (-775.064) [-771.240] (-771.593) * [-773.038] (-771.648) (-773.942) (-773.021) -- 0:00:26
561500 -- (-771.803) (-772.207) (-771.430) [-771.306] * (-771.970) [-773.609] (-777.012) (-771.875) -- 0:00:26
562000 -- [-772.536] (-772.561) (-772.971) (-774.413) * [-775.608] (-774.578) (-771.596) (-772.279) -- 0:00:26
562500 -- [-772.351] (-772.516) (-772.365) (-772.280) * (-771.744) [-772.104] (-773.266) (-772.350) -- 0:00:26
563000 -- (-771.047) (-771.516) [-773.461] (-775.269) * (-771.187) [-771.080] (-772.539) (-772.815) -- 0:00:26
563500 -- (-771.012) (-772.091) [-774.215] (-773.141) * (-773.897) (-771.735) [-772.437] (-773.580) -- 0:00:26
564000 -- (-770.966) (-774.048) (-775.284) [-771.337] * (-773.939) [-771.069] (-775.309) (-771.636) -- 0:00:26
564500 -- (-770.493) (-771.466) (-774.697) [-771.516] * (-771.764) [-771.986] (-773.120) (-772.311) -- 0:00:26
565000 -- (-770.811) [-771.502] (-772.624) (-771.752) * [-772.908] (-772.687) (-772.050) (-773.040) -- 0:00:26
Average standard deviation of split frequencies: 0.009828
565500 -- [-775.579] (-773.139) (-773.347) (-771.857) * (-775.399) [-772.576] (-770.900) (-775.333) -- 0:00:26
566000 -- (-772.817) (-771.022) (-771.674) [-772.711] * [-775.312] (-773.981) (-771.835) (-773.738) -- 0:00:26
566500 -- (-772.895) [-771.227] (-776.011) (-772.049) * (-775.289) (-772.188) (-770.742) [-772.611] -- 0:00:26
567000 -- [-774.246] (-771.578) (-770.727) (-772.919) * [-772.535] (-770.809) (-771.568) (-771.504) -- 0:00:25
567500 -- (-772.494) [-771.132] (-778.666) (-771.047) * (-772.489) (-770.828) (-774.468) [-771.513] -- 0:00:25
568000 -- (-771.432) [-772.020] (-779.217) (-771.893) * (-774.488) (-772.550) (-772.044) [-774.017] -- 0:00:25
568500 -- (-772.441) (-772.992) (-772.313) [-771.890] * (-771.636) (-770.994) [-774.374] (-775.439) -- 0:00:25
569000 -- (-770.927) (-778.430) (-772.920) [-771.702] * (-773.801) (-770.614) [-773.937] (-782.750) -- 0:00:25
569500 -- [-770.713] (-777.027) (-775.533) (-771.405) * (-771.214) (-770.568) [-772.502] (-771.263) -- 0:00:26
570000 -- (-772.333) (-776.161) [-774.741] (-776.667) * (-776.261) (-771.581) [-770.865] (-774.635) -- 0:00:26
Average standard deviation of split frequencies: 0.009417
570500 -- (-770.871) (-776.982) (-773.337) [-775.598] * (-776.145) [-776.656] (-772.361) (-772.721) -- 0:00:26
571000 -- (-770.744) (-773.156) [-771.074] (-775.607) * (-774.460) (-772.236) [-772.145] (-771.353) -- 0:00:26
571500 -- (-771.802) (-771.300) (-777.292) [-773.983] * (-773.004) (-772.702) (-773.164) [-772.607] -- 0:00:26
572000 -- (-772.522) [-775.597] (-773.539) (-777.585) * (-771.796) (-771.702) [-772.078] (-776.268) -- 0:00:26
572500 -- (-772.799) (-772.375) [-775.352] (-774.475) * [-772.044] (-774.867) (-772.181) (-774.323) -- 0:00:26
573000 -- (-771.753) (-773.562) [-772.998] (-773.476) * [-772.754] (-772.644) (-773.949) (-771.363) -- 0:00:26
573500 -- (-771.347) (-773.919) [-771.556] (-770.937) * (-775.454) (-776.520) [-771.758] (-774.422) -- 0:00:26
574000 -- (-771.865) (-771.314) [-771.685] (-770.562) * (-775.704) (-773.105) [-771.264] (-776.057) -- 0:00:25
574500 -- (-771.651) (-771.512) [-773.465] (-771.629) * (-772.497) (-772.814) [-776.252] (-772.518) -- 0:00:25
575000 -- (-776.886) [-770.831] (-772.750) (-773.607) * [-772.023] (-771.553) (-776.249) (-772.124) -- 0:00:25
Average standard deviation of split frequencies: 0.010367
575500 -- (-774.157) (-772.021) (-772.344) [-772.904] * (-772.522) (-771.083) [-771.330] (-772.420) -- 0:00:25
576000 -- (-771.781) (-774.994) (-772.661) [-773.186] * (-772.309) (-772.716) [-776.254] (-770.643) -- 0:00:25
576500 -- (-771.324) (-773.913) (-771.864) [-771.978] * (-773.007) [-773.131] (-770.474) (-771.145) -- 0:00:25
577000 -- (-772.472) (-773.321) (-772.389) [-771.510] * (-773.684) (-772.307) (-771.309) [-772.636] -- 0:00:25
577500 -- (-771.320) (-770.661) [-775.496] (-771.796) * [-772.782] (-775.783) (-771.337) (-773.749) -- 0:00:25
578000 -- (-771.664) [-770.655] (-773.831) (-777.896) * [-776.942] (-772.573) (-771.848) (-774.386) -- 0:00:25
578500 -- (-772.356) [-773.115] (-773.253) (-775.596) * [-775.481] (-774.209) (-772.841) (-772.219) -- 0:00:25
579000 -- (-774.383) (-775.019) (-775.491) [-774.189] * (-772.419) (-773.667) [-771.431] (-772.682) -- 0:00:25
579500 -- (-772.514) (-773.947) (-771.695) [-771.932] * [-770.871] (-771.138) (-770.679) (-770.960) -- 0:00:25
580000 -- (-777.575) (-772.946) (-773.157) [-771.589] * (-773.444) (-772.443) (-770.803) [-771.565] -- 0:00:25
Average standard deviation of split frequencies: 0.009958
580500 -- (-774.037) [-773.597] (-777.696) (-772.448) * (-775.547) [-771.969] (-771.821) (-775.146) -- 0:00:25
581000 -- [-771.704] (-771.905) (-774.777) (-775.694) * (-773.811) [-774.871] (-772.525) (-777.156) -- 0:00:25
581500 -- (-773.470) [-772.222] (-775.278) (-772.004) * [-773.626] (-774.400) (-773.458) (-772.598) -- 0:00:25
582000 -- (-782.152) [-773.530] (-774.823) (-770.630) * (-771.527) (-771.952) (-771.536) [-770.807] -- 0:00:25
582500 -- (-772.647) (-772.544) [-775.340] (-771.579) * (-771.298) (-774.210) [-771.963] (-771.201) -- 0:00:25
583000 -- (-771.799) (-771.606) [-772.419] (-772.174) * (-772.562) (-777.347) (-771.932) [-770.986] -- 0:00:25
583500 -- (-773.631) [-772.442] (-772.255) (-771.976) * [-771.006] (-770.833) (-771.039) (-772.161) -- 0:00:24
584000 -- (-772.261) (-771.521) (-774.372) [-772.994] * (-772.398) (-772.359) [-773.183] (-772.138) -- 0:00:24
584500 -- (-771.293) (-770.994) [-771.960] (-771.888) * (-774.141) (-772.040) (-774.283) [-772.380] -- 0:00:24
585000 -- (-773.170) (-774.721) (-771.531) [-770.977] * [-776.265] (-772.654) (-774.178) (-774.029) -- 0:00:24
Average standard deviation of split frequencies: 0.010297
585500 -- (-772.670) (-774.683) [-771.271] (-772.002) * (-772.948) (-774.826) (-773.602) [-774.586] -- 0:00:24
586000 -- (-774.369) (-772.661) (-771.275) [-773.232] * (-773.555) [-771.406] (-771.952) (-771.215) -- 0:00:25
586500 -- (-774.668) (-772.176) [-770.783] (-772.510) * (-773.718) (-775.372) (-773.159) [-772.465] -- 0:00:25
587000 -- (-774.233) [-771.722] (-771.718) (-773.374) * (-771.515) (-779.241) [-771.040] (-774.144) -- 0:00:25
587500 -- (-771.953) [-772.421] (-771.142) (-772.101) * (-771.275) [-772.424] (-772.097) (-773.454) -- 0:00:25
588000 -- (-773.990) [-773.863] (-773.143) (-773.096) * (-778.241) (-774.136) [-772.917] (-773.558) -- 0:00:25
588500 -- (-773.405) [-773.679] (-771.616) (-772.573) * (-774.526) (-774.210) (-774.567) [-774.253] -- 0:00:25
589000 -- (-772.511) (-773.548) [-770.862] (-777.567) * (-776.005) (-777.954) [-770.829] (-775.857) -- 0:00:25
589500 -- (-773.377) [-771.690] (-771.328) (-774.336) * (-772.428) [-773.153] (-772.927) (-774.685) -- 0:00:25
590000 -- (-770.607) [-774.475] (-775.374) (-773.868) * (-772.694) (-772.737) [-776.202] (-777.337) -- 0:00:25
Average standard deviation of split frequencies: 0.010322
590500 -- [-772.907] (-771.828) (-773.727) (-775.900) * [-771.846] (-771.968) (-772.623) (-771.644) -- 0:00:24
591000 -- (-777.021) [-774.088] (-772.741) (-770.901) * [-772.732] (-775.280) (-772.791) (-773.761) -- 0:00:24
591500 -- (-778.030) (-773.151) [-771.666] (-771.997) * (-771.640) (-774.121) [-771.882] (-771.209) -- 0:00:24
592000 -- [-775.008] (-772.408) (-772.994) (-772.726) * (-775.398) [-771.943] (-773.441) (-771.420) -- 0:00:24
592500 -- (-780.266) [-772.317] (-773.082) (-772.463) * (-773.747) [-774.425] (-775.205) (-771.473) -- 0:00:24
593000 -- (-774.776) (-773.517) [-771.558] (-771.338) * [-773.121] (-774.843) (-774.801) (-773.733) -- 0:00:24
593500 -- (-773.358) (-771.457) (-773.140) [-773.454] * (-773.801) [-771.838] (-772.470) (-772.147) -- 0:00:24
594000 -- [-771.581] (-780.572) (-772.664) (-775.579) * (-772.207) (-772.726) (-771.490) [-773.122] -- 0:00:24
594500 -- (-774.161) [-778.307] (-772.595) (-772.385) * (-776.149) (-775.190) [-772.172] (-772.941) -- 0:00:24
595000 -- (-772.644) (-771.067) (-772.179) [-771.879] * (-774.359) [-771.437] (-771.067) (-770.838) -- 0:00:24
Average standard deviation of split frequencies: 0.009597
595500 -- (-771.976) (-770.801) (-772.660) [-771.251] * [-772.128] (-773.878) (-772.320) (-773.923) -- 0:00:24
596000 -- (-773.013) [-771.474] (-772.220) (-774.445) * (-772.509) (-772.250) [-771.167] (-772.620) -- 0:00:24
596500 -- (-771.259) (-771.348) (-774.800) [-772.202] * [-772.085] (-773.269) (-773.807) (-772.999) -- 0:00:24
597000 -- (-772.864) (-771.557) [-774.513] (-772.838) * (-775.603) (-775.927) [-773.125] (-773.440) -- 0:00:24
597500 -- (-773.415) [-772.056] (-773.035) (-773.600) * (-773.959) (-771.347) [-771.211] (-773.399) -- 0:00:24
598000 -- [-770.879] (-771.830) (-773.988) (-774.606) * (-771.427) [-771.312] (-772.971) (-771.668) -- 0:00:24
598500 -- (-771.230) (-774.294) (-771.250) [-772.448] * [-772.164] (-772.826) (-771.726) (-772.397) -- 0:00:24
599000 -- [-772.595] (-774.161) (-771.825) (-781.642) * (-772.615) (-773.283) (-773.108) [-772.946] -- 0:00:24
599500 -- (-774.354) (-771.879) [-770.734] (-771.905) * (-773.152) (-773.304) (-773.429) [-772.035] -- 0:00:24
600000 -- [-772.717] (-772.341) (-771.272) (-774.166) * (-775.873) (-772.016) [-777.060] (-774.153) -- 0:00:24
Average standard deviation of split frequencies: 0.008790
600500 -- (-771.864) [-773.505] (-776.536) (-773.340) * [-772.239] (-773.123) (-772.721) (-771.307) -- 0:00:23
601000 -- [-773.367] (-772.891) (-771.939) (-771.501) * (-772.182) [-773.406] (-773.496) (-771.621) -- 0:00:23
601500 -- (-776.171) [-775.600] (-772.442) (-772.165) * (-773.298) [-771.935] (-773.685) (-772.981) -- 0:00:23
602000 -- (-773.654) (-775.481) [-775.366] (-777.057) * (-771.623) (-772.060) [-773.660] (-772.865) -- 0:00:23
602500 -- [-772.077] (-774.194) (-773.730) (-774.112) * (-772.418) (-772.566) (-775.206) [-771.918] -- 0:00:24
603000 -- (-771.599) [-775.677] (-771.232) (-771.284) * [-774.401] (-772.249) (-773.770) (-771.607) -- 0:00:24
603500 -- (-772.968) [-771.293] (-772.815) (-771.691) * (-771.103) [-772.561] (-772.079) (-771.899) -- 0:00:24
604000 -- [-775.837] (-771.511) (-776.912) (-774.087) * (-772.004) (-773.324) (-774.470) [-773.188] -- 0:00:24
604500 -- [-772.095] (-771.730) (-778.575) (-770.947) * [-771.630] (-776.570) (-777.082) (-774.681) -- 0:00:24
605000 -- (-771.341) (-775.737) [-774.344] (-772.164) * (-776.592) [-772.298] (-777.483) (-772.055) -- 0:00:24
Average standard deviation of split frequencies: 0.008609
605500 -- (-772.128) [-772.599] (-773.673) (-773.215) * (-773.137) (-775.984) [-772.109] (-773.046) -- 0:00:24
606000 -- (-770.912) (-772.412) (-773.549) [-771.334] * (-772.827) (-774.350) (-772.717) [-773.899] -- 0:00:24
606500 -- [-773.027] (-771.428) (-776.940) (-772.788) * (-772.018) (-775.213) (-773.428) [-772.865] -- 0:00:24
607000 -- (-773.201) [-774.265] (-773.234) (-771.231) * (-773.565) (-775.693) [-772.838] (-771.925) -- 0:00:23
607500 -- (-775.709) (-771.992) (-770.347) [-773.893] * (-776.206) [-776.219] (-773.082) (-771.277) -- 0:00:23
608000 -- (-773.685) (-771.861) [-770.814] (-774.988) * (-775.331) (-778.074) (-771.669) [-771.378] -- 0:00:23
608500 -- (-773.288) [-772.000] (-773.456) (-772.835) * (-775.603) (-780.723) [-775.704] (-770.434) -- 0:00:23
609000 -- (-773.886) (-772.435) [-772.833] (-772.843) * (-773.999) (-784.701) [-772.094] (-774.948) -- 0:00:23
609500 -- (-772.783) (-773.434) (-771.205) [-774.510] * (-772.009) (-776.752) (-776.105) [-770.917] -- 0:00:23
610000 -- (-771.909) (-772.045) (-773.032) [-771.845] * [-772.450] (-775.134) (-772.074) (-771.083) -- 0:00:23
Average standard deviation of split frequencies: 0.008286
610500 -- (-773.272) [-776.044] (-772.551) (-773.514) * (-771.805) (-774.795) [-771.552] (-772.766) -- 0:00:23
611000 -- (-772.617) (-775.405) (-771.223) [-771.554] * [-772.398] (-773.645) (-771.132) (-775.265) -- 0:00:23
611500 -- [-772.119] (-771.937) (-772.506) (-774.260) * [-772.698] (-774.826) (-773.462) (-774.485) -- 0:00:23
612000 -- (-772.843) (-771.651) [-773.066] (-775.685) * (-777.921) (-772.810) (-774.640) [-771.381] -- 0:00:23
612500 -- (-772.018) [-772.770] (-773.289) (-779.678) * [-773.407] (-775.863) (-771.925) (-772.113) -- 0:00:23
613000 -- (-771.755) [-771.636] (-772.146) (-771.462) * (-773.655) (-775.277) [-771.154] (-773.746) -- 0:00:23
613500 -- [-773.728] (-770.903) (-771.283) (-771.871) * (-773.220) (-775.982) [-772.435] (-775.867) -- 0:00:23
614000 -- [-775.183] (-772.779) (-771.880) (-771.734) * (-771.653) [-771.961] (-772.035) (-774.371) -- 0:00:23
614500 -- [-772.693] (-772.903) (-773.059) (-775.112) * (-771.471) (-777.388) (-772.258) [-772.676] -- 0:00:23
615000 -- [-771.628] (-772.344) (-774.298) (-772.852) * (-772.780) (-775.519) (-772.946) [-774.068] -- 0:00:23
Average standard deviation of split frequencies: 0.007653
615500 -- (-772.321) (-773.607) [-772.410] (-771.727) * [-774.326] (-771.556) (-774.368) (-772.510) -- 0:00:23
616000 -- (-772.662) (-771.117) [-771.513] (-772.470) * (-774.968) (-772.441) (-772.008) [-772.487] -- 0:00:23
616500 -- (-774.129) (-777.134) (-772.320) [-772.333] * (-774.485) [-771.399] (-774.040) (-774.593) -- 0:00:23
617000 -- (-772.556) (-775.838) [-773.782] (-772.621) * (-775.536) (-771.921) (-773.298) [-775.338] -- 0:00:22
617500 -- [-771.341] (-775.672) (-771.057) (-772.473) * (-774.991) (-774.692) [-772.540] (-771.676) -- 0:00:22
618000 -- [-771.341] (-776.066) (-771.284) (-775.555) * (-773.648) (-773.619) [-774.863] (-772.500) -- 0:00:22
618500 -- [-775.938] (-772.339) (-774.505) (-773.186) * (-773.847) [-773.324] (-775.298) (-775.331) -- 0:00:22
619000 -- (-771.417) [-772.762] (-774.636) (-772.525) * [-772.769] (-772.281) (-777.460) (-771.806) -- 0:00:23
619500 -- [-774.438] (-772.940) (-776.110) (-773.815) * (-772.346) [-772.226] (-773.296) (-772.092) -- 0:00:23
620000 -- [-774.509] (-773.924) (-772.531) (-772.657) * [-771.737] (-775.471) (-775.323) (-773.586) -- 0:00:23
Average standard deviation of split frequencies: 0.008253
620500 -- [-775.211] (-773.359) (-771.699) (-773.467) * (-773.372) (-773.336) (-775.249) [-772.435] -- 0:00:23
621000 -- (-771.611) (-773.930) [-773.848] (-770.584) * [-770.766] (-773.494) (-775.997) (-772.053) -- 0:00:23
621500 -- (-771.949) (-771.078) (-771.328) [-775.095] * (-770.723) [-777.344] (-771.991) (-776.997) -- 0:00:23
622000 -- (-776.112) (-771.258) [-771.406] (-771.386) * (-773.333) [-773.680] (-771.790) (-773.633) -- 0:00:23
622500 -- [-775.288] (-771.789) (-771.386) (-772.356) * (-773.165) [-776.590] (-772.068) (-771.831) -- 0:00:23
623000 -- (-772.192) (-770.907) [-778.253] (-777.911) * [-774.987] (-774.470) (-774.388) (-773.196) -- 0:00:22
623500 -- [-771.978] (-770.521) (-772.561) (-771.663) * (-771.043) (-773.544) [-772.357] (-777.987) -- 0:00:22
624000 -- (-773.044) [-770.677] (-773.154) (-772.167) * (-772.316) (-773.108) (-771.745) [-772.458] -- 0:00:22
624500 -- [-773.468] (-775.000) (-772.150) (-775.652) * (-773.102) [-771.612] (-772.386) (-776.542) -- 0:00:22
625000 -- (-774.059) (-778.769) [-770.831] (-772.085) * [-773.187] (-772.850) (-771.388) (-771.931) -- 0:00:22
Average standard deviation of split frequencies: 0.008886
625500 -- (-772.320) (-776.705) (-770.874) [-772.602] * (-772.633) (-772.383) (-772.869) [-773.073] -- 0:00:22
626000 -- (-770.849) (-771.964) [-771.000] (-772.046) * (-770.990) (-771.103) [-772.501] (-774.781) -- 0:00:22
626500 -- (-772.303) (-774.323) (-771.522) [-772.857] * [-770.686] (-771.189) (-770.664) (-772.277) -- 0:00:22
627000 -- (-777.638) (-773.760) [-774.629] (-776.256) * (-772.663) (-772.191) (-771.707) [-771.397] -- 0:00:22
627500 -- (-771.778) (-774.492) (-772.662) [-772.158] * (-774.391) (-773.838) (-776.830) [-770.706] -- 0:00:22
628000 -- (-771.082) (-774.574) [-773.284] (-777.101) * (-776.048) (-775.994) (-771.998) [-771.754] -- 0:00:22
628500 -- (-771.367) (-771.660) (-772.065) [-771.288] * (-771.243) [-770.633] (-773.722) (-771.543) -- 0:00:22
629000 -- [-773.869] (-775.332) (-771.572) (-772.044) * (-771.339) (-770.481) [-777.133] (-772.415) -- 0:00:22
629500 -- (-775.409) (-771.032) (-771.127) [-771.141] * [-772.630] (-772.152) (-775.328) (-773.859) -- 0:00:22
630000 -- [-771.404] (-771.447) (-771.430) (-772.617) * (-772.895) (-771.386) [-777.023] (-771.198) -- 0:00:22
Average standard deviation of split frequencies: 0.008920
630500 -- [-773.836] (-773.345) (-772.294) (-772.359) * (-772.888) [-771.222] (-771.249) (-771.956) -- 0:00:22
631000 -- (-772.560) (-778.229) (-773.391) [-774.507] * (-773.104) (-771.013) [-772.530] (-771.261) -- 0:00:22
631500 -- (-773.799) (-772.689) [-772.270] (-773.424) * [-771.424] (-772.970) (-772.549) (-772.895) -- 0:00:22
632000 -- (-772.329) (-781.063) [-772.364] (-771.828) * (-771.635) [-771.029] (-775.297) (-780.408) -- 0:00:22
632500 -- [-772.324] (-774.247) (-772.196) (-774.385) * [-771.032] (-776.097) (-772.982) (-772.608) -- 0:00:22
633000 -- (-771.013) (-770.808) (-773.068) [-770.458] * (-775.628) (-771.962) (-771.050) [-772.690] -- 0:00:22
633500 -- [-774.130] (-772.331) (-772.051) (-771.329) * (-772.131) (-774.320) (-771.846) [-771.416] -- 0:00:21
634000 -- (-773.669) (-772.795) [-771.044] (-772.516) * [-773.267] (-773.004) (-773.893) (-775.783) -- 0:00:21
634500 -- (-776.159) (-770.809) [-771.057] (-774.031) * (-771.617) (-773.309) [-773.912] (-771.546) -- 0:00:21
635000 -- (-773.200) (-773.768) [-772.268] (-774.616) * (-771.462) (-772.576) [-771.271] (-771.689) -- 0:00:21
Average standard deviation of split frequencies: 0.009092
635500 -- (-770.759) (-776.287) (-772.631) [-775.273] * (-771.774) (-774.522) [-771.908] (-777.841) -- 0:00:21
636000 -- [-771.559] (-772.956) (-774.789) (-771.402) * [-773.261] (-772.213) (-775.589) (-774.745) -- 0:00:22
636500 -- (-772.066) (-771.247) [-773.011] (-773.964) * (-772.758) (-773.237) [-774.727] (-771.190) -- 0:00:22
637000 -- (-772.811) [-772.571] (-771.663) (-775.639) * (-773.357) [-772.150] (-771.781) (-773.018) -- 0:00:22
637500 -- (-771.752) (-778.556) [-770.929] (-773.003) * [-774.550] (-774.249) (-773.181) (-771.842) -- 0:00:22
638000 -- (-771.392) (-774.571) (-773.581) [-773.152] * (-774.392) [-772.881] (-772.459) (-773.585) -- 0:00:22
638500 -- (-770.710) (-773.995) [-773.215] (-773.343) * (-771.905) (-772.296) (-771.650) [-770.995] -- 0:00:22
639000 -- (-772.479) [-771.115] (-772.201) (-773.003) * (-770.770) (-772.597) [-773.313] (-775.360) -- 0:00:22
639500 -- (-772.604) [-771.639] (-772.331) (-772.960) * [-771.644] (-774.301) (-774.706) (-771.034) -- 0:00:21
640000 -- (-770.889) (-771.573) (-771.904) [-770.882] * (-772.808) (-771.664) (-775.105) [-770.656] -- 0:00:21
Average standard deviation of split frequencies: 0.009075
640500 -- (-773.694) (-771.448) (-778.071) [-771.225] * (-774.673) (-774.492) (-773.097) [-771.266] -- 0:00:21
641000 -- (-771.865) (-772.621) (-777.786) [-771.299] * (-773.162) (-771.930) (-776.182) [-772.013] -- 0:00:21
641500 -- (-771.869) (-771.875) [-773.716] (-772.371) * [-773.470] (-776.623) (-772.300) (-771.004) -- 0:00:21
642000 -- (-771.704) (-772.663) (-774.187) [-772.513] * (-773.600) [-772.576] (-772.954) (-771.330) -- 0:00:21
642500 -- (-773.912) [-771.595] (-773.241) (-773.206) * (-772.484) (-773.814) [-772.147] (-773.134) -- 0:00:21
643000 -- (-772.418) (-775.232) (-771.885) [-771.249] * (-775.385) [-771.468] (-776.418) (-771.961) -- 0:00:21
643500 -- (-777.410) [-771.601] (-781.958) (-771.907) * (-772.859) (-771.685) (-778.380) [-774.190] -- 0:00:21
644000 -- (-774.026) (-771.057) (-770.956) [-773.063] * [-770.971] (-772.349) (-772.864) (-770.851) -- 0:00:21
644500 -- [-771.181] (-771.155) (-773.273) (-774.069) * (-773.236) (-773.324) (-773.855) [-770.404] -- 0:00:21
645000 -- (-771.055) (-770.915) (-773.432) [-772.189] * [-773.786] (-772.411) (-772.269) (-773.262) -- 0:00:21
Average standard deviation of split frequencies: 0.009146
645500 -- (-774.958) (-771.012) (-773.583) [-771.520] * (-770.636) [-771.259] (-772.957) (-774.301) -- 0:00:21
646000 -- (-772.388) (-773.098) [-773.151] (-774.052) * [-773.067] (-772.828) (-772.912) (-772.490) -- 0:00:21
646500 -- [-772.724] (-773.177) (-773.742) (-774.967) * [-771.632] (-773.214) (-773.982) (-773.061) -- 0:00:21
647000 -- [-777.200] (-774.124) (-782.531) (-772.796) * [-771.059] (-772.244) (-774.664) (-770.995) -- 0:00:21
647500 -- [-772.793] (-772.902) (-771.782) (-771.622) * (-775.714) (-774.608) [-771.614] (-775.239) -- 0:00:21
648000 -- (-770.686) (-771.993) [-771.284] (-774.506) * (-772.549) (-773.738) [-771.782] (-773.407) -- 0:00:21
648500 -- (-771.399) (-773.861) [-774.934] (-771.829) * (-771.904) (-773.267) (-771.770) [-773.263] -- 0:00:21
649000 -- (-770.898) (-774.513) (-770.893) [-770.979] * (-771.163) (-772.069) (-776.864) [-772.135] -- 0:00:21
649500 -- [-772.778] (-774.074) (-771.874) (-772.484) * [-770.644] (-772.610) (-773.039) (-772.817) -- 0:00:21
650000 -- [-771.939] (-774.499) (-773.828) (-772.052) * (-770.608) [-773.200] (-771.869) (-773.640) -- 0:00:21
Average standard deviation of split frequencies: 0.008935
650500 -- (-775.109) (-771.439) (-774.594) [-772.794] * [-771.714] (-772.994) (-772.413) (-773.038) -- 0:00:20
651000 -- (-770.711) (-772.086) [-773.096] (-773.757) * [-771.769] (-771.883) (-773.739) (-772.195) -- 0:00:20
651500 -- (-772.300) (-772.870) [-774.009] (-779.354) * (-772.902) (-771.904) (-773.588) [-771.276] -- 0:00:20
652000 -- [-772.795] (-773.313) (-773.172) (-775.470) * [-773.320] (-772.452) (-774.517) (-771.204) -- 0:00:20
652500 -- (-772.366) [-775.678] (-773.559) (-773.190) * (-774.570) (-774.160) (-772.474) [-772.269] -- 0:00:21
653000 -- (-772.004) (-771.298) [-775.436] (-775.389) * [-775.567] (-772.891) (-770.842) (-772.770) -- 0:00:21
653500 -- (-771.908) [-770.891] (-774.720) (-774.051) * (-773.158) [-772.223] (-771.738) (-772.749) -- 0:00:21
654000 -- (-772.315) (-771.090) (-773.821) [-775.406] * (-772.280) (-772.106) (-773.405) [-772.029] -- 0:00:21
654500 -- [-770.496] (-776.099) (-771.660) (-773.853) * (-771.731) (-773.187) [-770.884] (-771.494) -- 0:00:21
655000 -- (-773.006) (-772.683) [-772.645] (-775.013) * (-772.970) (-773.936) [-771.585] (-773.738) -- 0:00:21
Average standard deviation of split frequencies: 0.009677
655500 -- [-775.445] (-771.725) (-776.453) (-776.026) * [-772.382] (-773.431) (-772.678) (-774.381) -- 0:00:21
656000 -- (-773.479) [-770.974] (-770.934) (-776.017) * (-772.903) (-772.084) (-772.373) [-773.104] -- 0:00:20
656500 -- (-772.586) (-770.879) [-772.565] (-771.438) * [-773.378] (-773.043) (-773.930) (-778.941) -- 0:00:20
657000 -- (-773.718) [-775.188] (-771.578) (-770.699) * [-778.348] (-771.736) (-771.283) (-772.769) -- 0:00:20
657500 -- (-770.942) (-775.120) (-773.634) [-773.521] * (-776.810) (-771.544) (-776.035) [-771.957] -- 0:00:20
658000 -- (-773.742) (-775.188) (-772.603) [-773.131] * [-776.565] (-771.956) (-774.265) (-777.511) -- 0:00:20
658500 -- [-773.578] (-771.702) (-773.735) (-772.688) * (-776.072) [-775.793] (-774.685) (-776.671) -- 0:00:20
659000 -- (-775.734) (-772.903) [-773.886] (-772.583) * (-773.971) (-770.712) (-776.161) [-773.603] -- 0:00:20
659500 -- (-771.363) (-774.246) [-773.426] (-772.086) * (-774.387) [-771.763] (-772.863) (-776.946) -- 0:00:20
660000 -- (-774.664) [-770.557] (-772.855) (-773.541) * (-773.618) [-772.348] (-771.173) (-775.952) -- 0:00:20
Average standard deviation of split frequencies: 0.009466
660500 -- [-772.540] (-770.736) (-773.625) (-773.368) * (-773.914) [-771.840] (-775.539) (-773.542) -- 0:00:20
661000 -- (-771.131) (-771.649) [-775.125] (-773.791) * (-774.977) (-770.809) (-773.761) [-771.557] -- 0:00:20
661500 -- (-772.547) [-771.736] (-778.426) (-775.292) * (-772.632) (-773.155) [-771.674] (-772.640) -- 0:00:20
662000 -- (-773.373) (-771.450) [-778.043] (-775.912) * (-773.102) [-772.660] (-773.360) (-773.869) -- 0:00:20
662500 -- [-773.942] (-771.560) (-773.643) (-774.304) * [-770.405] (-773.717) (-772.127) (-777.135) -- 0:00:20
663000 -- [-771.983] (-772.536) (-772.740) (-771.785) * (-771.198) (-771.830) (-773.616) [-773.909] -- 0:00:20
663500 -- [-771.976] (-774.042) (-772.232) (-775.522) * (-773.176) (-777.840) (-771.854) [-771.093] -- 0:00:20
664000 -- [-773.916] (-772.629) (-772.478) (-772.805) * (-773.881) [-772.720] (-772.404) (-772.434) -- 0:00:20
664500 -- (-777.647) (-774.369) (-773.890) [-772.723] * (-773.462) (-771.729) [-773.047] (-773.331) -- 0:00:20
665000 -- (-779.316) (-771.999) [-770.960] (-772.650) * (-774.624) (-773.920) [-771.040] (-772.940) -- 0:00:20
Average standard deviation of split frequencies: 0.009154
665500 -- (-776.942) (-773.731) (-772.656) [-771.561] * (-773.912) (-775.366) (-770.933) [-773.669] -- 0:00:20
666000 -- [-771.263] (-771.670) (-772.271) (-771.509) * (-773.756) (-775.497) [-777.349] (-773.954) -- 0:00:20
666500 -- (-771.049) (-775.801) [-771.285] (-770.962) * [-773.580] (-772.135) (-775.315) (-773.335) -- 0:00:20
667000 -- (-774.739) [-772.428] (-771.291) (-774.638) * (-772.575) [-773.319] (-775.169) (-772.804) -- 0:00:19
667500 -- (-773.442) (-772.236) (-770.934) [-773.757] * (-772.521) (-775.223) (-771.064) [-772.930] -- 0:00:19
668000 -- (-775.618) (-770.628) [-771.714] (-773.100) * (-772.173) [-772.129] (-775.173) (-772.421) -- 0:00:19
668500 -- [-772.532] (-772.166) (-772.930) (-774.156) * (-771.746) (-772.313) [-774.506] (-777.381) -- 0:00:19
669000 -- (-771.515) [-771.357] (-771.052) (-771.436) * (-774.180) (-773.213) (-773.303) [-771.737] -- 0:00:20
669500 -- [-773.294] (-771.485) (-771.141) (-771.197) * (-776.202) (-776.983) (-773.150) [-771.309] -- 0:00:20
670000 -- (-771.895) [-772.618] (-778.193) (-773.711) * (-773.253) (-775.488) (-778.397) [-773.528] -- 0:00:20
Average standard deviation of split frequencies: 0.008622
670500 -- (-772.832) [-775.921] (-774.285) (-774.635) * (-772.303) (-771.313) [-772.268] (-778.975) -- 0:00:20
671000 -- (-776.621) [-773.028] (-770.409) (-778.592) * (-773.439) [-772.452] (-777.156) (-773.342) -- 0:00:20
671500 -- [-774.820] (-774.599) (-771.675) (-771.138) * (-775.885) [-771.108] (-775.226) (-771.568) -- 0:00:20
672000 -- (-770.570) (-775.511) (-772.006) [-771.039] * (-771.918) (-772.231) [-772.137] (-772.511) -- 0:00:20
672500 -- (-771.639) (-773.026) [-773.788] (-772.414) * (-771.779) (-771.400) (-777.068) [-771.559] -- 0:00:19
673000 -- (-777.496) (-771.078) [-773.803] (-771.438) * [-771.204] (-772.967) (-776.942) (-771.340) -- 0:00:19
673500 -- (-771.671) (-772.594) [-772.975] (-773.111) * (-774.807) [-773.475] (-771.732) (-771.061) -- 0:00:19
674000 -- (-771.769) (-772.344) [-772.741] (-771.858) * [-772.156] (-773.880) (-772.751) (-773.446) -- 0:00:19
674500 -- (-778.285) (-774.366) [-772.375] (-771.369) * [-773.214] (-772.912) (-775.399) (-774.289) -- 0:00:19
675000 -- (-782.246) [-773.278] (-773.278) (-772.589) * [-772.881] (-773.205) (-771.303) (-772.784) -- 0:00:19
Average standard deviation of split frequencies: 0.008107
675500 -- [-774.110] (-773.943) (-771.616) (-772.845) * [-772.885] (-774.517) (-775.595) (-772.597) -- 0:00:19
676000 -- (-773.435) (-771.584) [-772.098] (-771.583) * (-771.105) [-772.324] (-771.868) (-772.973) -- 0:00:19
676500 -- (-773.973) (-770.793) (-772.901) [-773.519] * (-773.357) (-773.272) [-771.344] (-773.432) -- 0:00:19
677000 -- (-773.997) [-770.649] (-777.880) (-772.280) * (-773.047) [-771.406] (-772.322) (-775.086) -- 0:00:19
677500 -- [-772.149] (-770.841) (-779.486) (-772.761) * (-771.048) (-772.381) [-773.221] (-773.193) -- 0:00:19
678000 -- (-775.151) (-774.914) (-772.766) [-775.174] * (-772.499) [-773.385] (-770.390) (-774.074) -- 0:00:19
678500 -- (-770.958) (-774.675) [-771.142] (-773.290) * (-772.931) (-777.204) (-770.990) [-774.214] -- 0:00:19
679000 -- (-771.370) [-774.113] (-775.443) (-772.433) * (-771.906) (-772.922) [-772.095] (-770.906) -- 0:00:19
679500 -- [-773.236] (-782.456) (-776.660) (-774.271) * (-770.798) (-772.085) (-778.628) [-772.695] -- 0:00:19
680000 -- (-773.455) [-771.728] (-772.806) (-771.956) * (-774.159) (-778.441) [-772.869] (-774.783) -- 0:00:19
Average standard deviation of split frequencies: 0.007705
680500 -- (-774.962) (-771.321) (-772.697) [-772.619] * (-772.139) (-773.383) (-771.965) [-773.406] -- 0:00:19
681000 -- (-777.024) (-771.645) (-771.577) [-771.702] * (-772.286) (-776.120) [-771.280] (-775.960) -- 0:00:19
681500 -- (-774.620) [-774.832] (-775.076) (-772.795) * (-771.167) (-772.172) (-771.853) [-774.898] -- 0:00:19
682000 -- (-773.644) (-771.477) (-772.151) [-774.277] * (-775.545) (-771.514) [-773.892] (-774.075) -- 0:00:19
682500 -- (-771.982) (-773.082) (-773.230) [-774.263] * (-773.957) (-772.907) [-770.858] (-775.768) -- 0:00:19
683000 -- (-772.340) [-776.371] (-773.022) (-772.283) * [-773.281] (-770.768) (-770.975) (-772.146) -- 0:00:19
683500 -- (-773.416) (-771.893) [-773.421] (-771.633) * (-772.902) (-774.278) [-773.617] (-774.051) -- 0:00:18
684000 -- [-775.910] (-771.098) (-773.714) (-779.064) * (-774.867) [-772.603] (-771.592) (-771.759) -- 0:00:18
684500 -- (-776.839) [-771.621] (-772.848) (-770.704) * (-771.495) (-775.363) [-772.843] (-775.289) -- 0:00:18
685000 -- (-774.410) [-772.060] (-773.533) (-771.912) * [-771.934] (-773.673) (-772.222) (-770.983) -- 0:00:18
Average standard deviation of split frequencies: 0.007344
685500 -- (-771.856) (-772.278) (-772.937) [-771.667] * [-771.671] (-771.448) (-775.332) (-771.516) -- 0:00:18
686000 -- (-771.444) (-778.215) (-775.420) [-772.893] * [-773.968] (-772.297) (-773.360) (-771.249) -- 0:00:19
686500 -- (-772.491) (-772.991) (-775.032) [-771.803] * (-777.714) (-773.019) [-773.472] (-770.655) -- 0:00:19
687000 -- (-771.197) [-771.698] (-771.177) (-773.670) * [-776.163] (-775.130) (-775.832) (-770.752) -- 0:00:19
687500 -- (-771.241) [-774.630] (-770.908) (-773.479) * (-773.789) [-774.137] (-778.094) (-771.534) -- 0:00:19
688000 -- (-773.300) [-772.718] (-770.904) (-776.637) * (-773.024) (-773.256) (-774.967) [-772.012] -- 0:00:19
688500 -- [-772.969] (-778.259) (-773.798) (-772.298) * (-774.783) (-772.929) (-774.808) [-771.745] -- 0:00:19
689000 -- (-775.961) [-772.747] (-776.355) (-773.520) * [-773.976] (-772.268) (-772.174) (-773.074) -- 0:00:18
689500 -- (-773.053) (-772.094) (-773.316) [-773.206] * [-771.803] (-771.320) (-772.524) (-772.194) -- 0:00:18
690000 -- (-773.313) [-772.418] (-773.501) (-771.321) * [-771.810] (-771.591) (-772.322) (-770.874) -- 0:00:18
Average standard deviation of split frequencies: 0.007806
690500 -- [-771.427] (-772.341) (-773.623) (-770.796) * [-772.901] (-776.191) (-771.468) (-771.099) -- 0:00:18
691000 -- (-772.631) (-774.695) (-772.758) [-775.036] * (-775.302) (-773.121) [-771.847] (-772.110) -- 0:00:18
691500 -- (-771.546) (-771.589) (-774.727) [-772.948] * (-770.851) (-773.930) (-773.397) [-771.861] -- 0:00:18
692000 -- (-783.710) (-771.837) [-772.423] (-773.386) * (-775.049) [-771.437] (-775.507) (-772.113) -- 0:00:18
692500 -- (-771.808) [-772.632] (-772.598) (-772.905) * (-772.071) (-772.444) [-775.602] (-774.952) -- 0:00:18
693000 -- (-775.091) (-771.467) (-776.745) [-771.026] * (-771.216) (-771.274) [-772.367] (-774.362) -- 0:00:18
693500 -- (-775.411) [-773.602] (-774.801) (-771.188) * (-776.113) (-771.873) [-771.687] (-774.650) -- 0:00:18
694000 -- [-771.943] (-774.676) (-772.838) (-773.946) * (-773.830) [-771.298] (-772.409) (-775.707) -- 0:00:18
694500 -- (-771.699) (-772.757) (-771.605) [-775.553] * (-774.512) (-772.799) [-772.428] (-774.063) -- 0:00:18
695000 -- (-772.019) (-772.558) (-775.007) [-771.244] * (-771.767) (-773.086) [-774.050] (-772.392) -- 0:00:18
Average standard deviation of split frequencies: 0.008805
695500 -- (-771.833) [-771.714] (-771.626) (-770.868) * [-771.473] (-772.392) (-771.807) (-773.532) -- 0:00:18
696000 -- (-775.853) (-771.279) [-777.287] (-771.223) * [-771.170] (-777.766) (-773.875) (-772.156) -- 0:00:18
696500 -- [-778.369] (-775.446) (-772.892) (-772.234) * (-771.195) [-776.746] (-773.908) (-771.588) -- 0:00:18
697000 -- (-772.800) [-773.097] (-772.715) (-772.489) * (-771.782) [-774.943] (-773.167) (-770.977) -- 0:00:18
697500 -- [-771.314] (-773.257) (-775.305) (-770.671) * [-770.643] (-774.853) (-772.657) (-770.944) -- 0:00:18
698000 -- (-773.211) [-772.301] (-775.909) (-771.871) * (-773.248) [-771.420] (-773.437) (-770.675) -- 0:00:18
698500 -- (-776.028) (-772.867) (-773.210) [-774.192] * (-773.582) [-771.567] (-774.207) (-772.083) -- 0:00:18
699000 -- (-772.760) [-772.910] (-774.321) (-773.972) * (-772.014) [-771.918] (-771.768) (-772.271) -- 0:00:18
699500 -- (-771.957) (-772.918) [-773.001] (-771.699) * (-771.958) (-772.822) (-773.015) [-771.214] -- 0:00:18
700000 -- [-771.845] (-772.860) (-774.984) (-772.232) * (-772.776) (-772.742) (-774.476) [-771.477] -- 0:00:18
Average standard deviation of split frequencies: 0.008746
700500 -- (-772.038) (-773.839) (-772.762) [-770.511] * (-771.506) (-772.721) (-773.032) [-771.657] -- 0:00:17
701000 -- [-774.399] (-774.081) (-773.524) (-771.514) * [-771.836] (-778.257) (-773.260) (-772.115) -- 0:00:17
701500 -- [-778.780] (-773.180) (-775.028) (-773.420) * (-774.357) (-771.413) [-772.283] (-774.881) -- 0:00:17
702000 -- (-771.221) (-776.552) (-774.068) [-776.232] * (-774.743) (-773.621) [-772.235] (-774.690) -- 0:00:17
702500 -- (-772.145) (-775.520) (-772.197) [-771.404] * (-773.910) [-771.648] (-773.749) (-773.281) -- 0:00:18
703000 -- (-775.534) (-774.890) (-772.747) [-771.027] * (-773.978) (-772.057) (-777.514) [-773.012] -- 0:00:18
703500 -- (-774.209) (-770.692) [-772.199] (-772.494) * (-772.132) (-771.284) [-772.572] (-773.471) -- 0:00:18
704000 -- (-773.605) (-771.631) (-771.621) [-772.141] * [-771.102] (-775.045) (-772.484) (-770.535) -- 0:00:18
704500 -- (-773.447) (-774.106) [-771.823] (-772.145) * (-770.398) (-775.365) [-770.954] (-772.929) -- 0:00:18
705000 -- (-772.179) (-771.171) (-770.794) [-772.388] * [-771.258] (-772.696) (-774.035) (-775.344) -- 0:00:17
Average standard deviation of split frequencies: 0.008602
705500 -- [-770.938] (-771.813) (-770.930) (-771.441) * [-773.053] (-772.118) (-775.355) (-774.031) -- 0:00:17
706000 -- [-772.733] (-777.662) (-770.850) (-771.553) * [-773.290] (-772.177) (-775.075) (-772.321) -- 0:00:17
706500 -- (-778.718) (-779.617) [-770.890] (-772.842) * (-773.742) (-772.313) [-771.998] (-772.893) -- 0:00:17
707000 -- (-775.070) (-776.158) (-772.142) [-772.712] * [-778.387] (-773.707) (-773.423) (-771.968) -- 0:00:17
707500 -- (-770.948) (-773.433) (-772.883) [-775.586] * (-773.547) (-773.047) (-774.642) [-773.338] -- 0:00:17
708000 -- [-771.065] (-771.833) (-776.044) (-775.610) * (-772.931) (-773.649) (-771.299) [-771.932] -- 0:00:17
708500 -- (-771.226) [-771.227] (-771.892) (-771.364) * (-773.273) (-773.986) [-772.384] (-773.149) -- 0:00:17
709000 -- [-773.049] (-772.359) (-772.466) (-770.532) * (-773.792) (-772.802) (-775.548) [-772.012] -- 0:00:17
709500 -- [-772.585] (-773.480) (-771.312) (-772.499) * (-773.014) (-771.883) (-774.200) [-775.750] -- 0:00:17
710000 -- [-770.946] (-776.373) (-771.451) (-771.082) * (-773.157) (-774.572) [-772.914] (-773.729) -- 0:00:17
Average standard deviation of split frequencies: 0.008375
710500 -- (-772.808) (-771.694) [-771.460] (-773.687) * [-770.775] (-779.990) (-772.055) (-773.691) -- 0:00:17
711000 -- [-775.359] (-772.551) (-771.320) (-772.077) * (-774.249) (-771.902) (-774.655) [-772.368] -- 0:00:17
711500 -- [-774.437] (-772.455) (-771.240) (-774.701) * (-772.991) (-773.859) (-773.019) [-774.122] -- 0:00:17
712000 -- (-773.027) (-775.950) [-776.218] (-771.873) * (-775.355) (-773.213) (-772.784) [-772.871] -- 0:00:17
712500 -- (-771.119) (-771.901) (-774.068) [-771.079] * (-778.138) (-772.267) (-771.357) [-772.850] -- 0:00:17
713000 -- (-772.822) [-771.835] (-771.862) (-771.050) * [-775.112] (-771.845) (-775.538) (-777.885) -- 0:00:17
713500 -- (-772.428) [-771.665] (-772.940) (-772.345) * (-774.512) (-772.556) (-773.259) [-771.643] -- 0:00:17
714000 -- (-773.652) (-772.957) [-772.427] (-770.996) * [-771.383] (-771.332) (-773.553) (-771.859) -- 0:00:17
714500 -- (-771.066) (-772.426) [-776.683] (-770.970) * (-772.931) (-771.365) (-770.998) [-772.036] -- 0:00:17
715000 -- [-771.260] (-779.122) (-775.156) (-772.891) * (-773.896) (-771.507) [-770.907] (-773.764) -- 0:00:17
Average standard deviation of split frequencies: 0.008559
715500 -- (-775.494) [-774.756] (-773.384) (-773.261) * (-772.712) [-771.916] (-773.164) (-772.354) -- 0:00:17
716000 -- (-774.056) [-772.803] (-771.980) (-771.805) * (-775.924) (-771.743) (-771.905) [-770.466] -- 0:00:17
716500 -- (-773.712) (-778.916) (-772.037) [-775.892] * [-776.696] (-776.270) (-773.666) (-772.733) -- 0:00:17
717000 -- (-771.692) (-780.525) [-771.219] (-776.195) * [-772.557] (-777.676) (-772.901) (-771.244) -- 0:00:16
717500 -- (-773.939) (-772.188) (-772.485) [-782.042] * (-774.123) (-773.522) (-772.348) [-770.647] -- 0:00:16
718000 -- (-771.070) [-773.602] (-773.934) (-770.881) * [-770.796] (-776.961) (-774.107) (-771.230) -- 0:00:16
718500 -- (-771.418) (-775.994) (-774.601) [-773.099] * (-773.701) (-773.741) [-774.163] (-771.843) -- 0:00:16
719000 -- (-770.755) [-774.445] (-772.644) (-772.062) * (-775.881) [-771.158] (-773.469) (-775.814) -- 0:00:17
719500 -- [-770.982] (-773.580) (-780.270) (-773.497) * (-772.961) [-773.601] (-772.010) (-772.515) -- 0:00:17
720000 -- (-771.357) [-773.301] (-772.643) (-773.317) * (-774.749) (-772.058) [-771.600] (-773.378) -- 0:00:17
Average standard deviation of split frequencies: 0.008790
720500 -- (-771.724) [-772.232] (-772.873) (-772.760) * [-773.173] (-775.922) (-771.546) (-773.900) -- 0:00:17
721000 -- (-774.076) (-772.054) [-771.456] (-776.286) * (-771.870) (-773.570) (-771.365) [-775.547] -- 0:00:17
721500 -- (-777.486) [-773.331] (-773.230) (-776.323) * (-774.099) (-774.133) [-771.620] (-775.047) -- 0:00:16
722000 -- (-774.152) (-771.420) (-775.272) [-772.357] * (-775.041) (-773.648) (-773.456) [-771.126] -- 0:00:16
722500 -- (-773.953) (-775.567) [-770.475] (-771.533) * (-772.444) (-771.700) [-774.722] (-771.500) -- 0:00:16
723000 -- [-773.013] (-772.220) (-771.863) (-772.284) * [-771.794] (-771.053) (-773.788) (-770.432) -- 0:00:16
723500 -- (-773.689) (-773.472) (-771.399) [-775.096] * (-771.473) (-772.022) [-771.567] (-771.897) -- 0:00:16
724000 -- [-775.099] (-773.555) (-773.366) (-778.263) * [-771.113] (-771.270) (-773.045) (-771.204) -- 0:00:16
724500 -- [-774.356] (-772.605) (-772.451) (-776.864) * [-774.924] (-772.793) (-773.311) (-770.992) -- 0:00:16
725000 -- (-772.032) (-771.416) (-776.482) [-771.383] * (-771.290) (-775.408) (-770.951) [-775.686] -- 0:00:16
Average standard deviation of split frequencies: 0.009050
725500 -- [-775.538] (-771.329) (-773.652) (-773.179) * (-772.383) [-773.798] (-774.932) (-771.197) -- 0:00:16
726000 -- (-774.668) (-772.039) [-772.441] (-773.650) * [-771.606] (-771.927) (-772.671) (-773.413) -- 0:00:16
726500 -- [-773.965] (-771.846) (-771.931) (-777.878) * [-770.744] (-770.889) (-777.922) (-773.581) -- 0:00:16
727000 -- (-773.925) (-772.038) [-773.087] (-772.721) * (-774.172) [-770.930] (-775.192) (-773.781) -- 0:00:16
727500 -- (-770.653) [-770.966] (-772.037) (-770.945) * [-772.879] (-773.055) (-772.676) (-775.683) -- 0:00:16
728000 -- [-771.226] (-770.677) (-775.500) (-773.203) * [-772.212] (-772.870) (-770.858) (-774.354) -- 0:00:16
728500 -- (-774.339) [-771.046] (-773.085) (-772.464) * (-771.554) (-772.007) (-774.598) [-776.697] -- 0:00:16
729000 -- (-776.900) (-770.560) [-774.795] (-774.198) * (-771.547) (-774.096) [-770.926] (-771.049) -- 0:00:16
729500 -- (-772.925) [-772.120] (-774.151) (-776.625) * [-776.095] (-771.808) (-772.432) (-774.396) -- 0:00:16
730000 -- [-775.638] (-772.271) (-771.978) (-773.849) * (-772.151) [-771.806] (-776.551) (-773.092) -- 0:00:16
Average standard deviation of split frequencies: 0.009260
730500 -- (-771.864) [-772.956] (-770.945) (-770.632) * (-772.341) [-771.224] (-773.423) (-771.877) -- 0:00:16
731000 -- (-772.892) [-776.723] (-772.124) (-771.251) * (-771.849) (-771.044) (-775.156) [-770.761] -- 0:00:16
731500 -- (-772.957) [-778.900] (-773.020) (-776.249) * [-773.561] (-773.825) (-772.560) (-772.135) -- 0:00:16
732000 -- [-773.796] (-779.671) (-772.917) (-771.072) * (-773.571) (-775.769) (-773.292) [-773.098] -- 0:00:16
732500 -- (-773.851) (-773.095) (-777.358) [-772.861] * (-776.626) (-773.829) (-776.238) [-771.784] -- 0:00:16
733000 -- (-772.130) [-771.670] (-775.144) (-770.538) * (-771.705) (-777.424) (-774.346) [-776.240] -- 0:00:16
733500 -- (-772.647) [-773.194] (-779.621) (-773.139) * (-771.012) (-772.045) (-772.708) [-773.722] -- 0:00:15
734000 -- [-772.629] (-773.087) (-774.811) (-773.034) * (-771.214) (-772.807) [-771.898] (-773.999) -- 0:00:15
734500 -- (-776.092) (-775.674) (-777.069) [-772.802] * (-773.599) (-772.231) [-771.516] (-774.027) -- 0:00:15
735000 -- (-772.461) (-775.337) (-771.212) [-772.724] * [-771.031] (-774.746) (-771.150) (-773.671) -- 0:00:16
Average standard deviation of split frequencies: 0.009327
735500 -- [-772.488] (-774.354) (-771.984) (-773.644) * (-772.740) [-775.038] (-773.628) (-772.693) -- 0:00:16
736000 -- (-775.348) (-772.935) (-770.931) [-772.196] * (-776.283) (-773.582) (-772.076) [-772.345] -- 0:00:16
736500 -- (-772.574) (-771.683) (-773.347) [-772.942] * [-772.120] (-771.706) (-772.660) (-771.341) -- 0:00:16
737000 -- (-770.975) (-772.282) (-772.111) [-771.298] * (-773.082) (-771.248) [-771.560] (-773.173) -- 0:00:16
737500 -- [-770.862] (-773.908) (-771.415) (-771.342) * (-773.556) (-771.063) [-772.667] (-773.553) -- 0:00:16
738000 -- [-775.553] (-770.669) (-771.066) (-773.782) * (-775.576) (-773.532) (-771.068) [-775.486] -- 0:00:15
738500 -- [-773.494] (-774.309) (-771.176) (-772.479) * (-773.231) [-772.662] (-771.636) (-774.382) -- 0:00:15
739000 -- (-772.014) (-770.697) [-772.705] (-773.029) * (-773.213) [-771.538] (-774.532) (-774.048) -- 0:00:15
739500 -- (-773.764) (-774.889) [-771.906] (-771.163) * [-771.853] (-773.264) (-772.464) (-771.141) -- 0:00:15
740000 -- [-771.922] (-771.792) (-771.662) (-772.774) * (-770.918) (-772.404) (-774.273) [-770.940] -- 0:00:15
Average standard deviation of split frequencies: 0.009189
740500 -- (-773.300) (-772.096) [-771.258] (-772.392) * (-770.931) [-771.708] (-774.620) (-773.542) -- 0:00:15
741000 -- (-772.445) [-771.185] (-773.395) (-773.270) * (-775.747) (-772.222) [-774.382] (-773.875) -- 0:00:15
741500 -- (-783.779) (-771.246) [-775.048] (-771.566) * [-774.769] (-773.284) (-773.203) (-771.660) -- 0:00:15
742000 -- (-772.641) [-770.825] (-773.414) (-773.653) * [-777.297] (-773.137) (-773.409) (-770.929) -- 0:00:15
742500 -- (-773.728) [-770.813] (-771.229) (-774.092) * (-774.470) (-774.594) (-772.388) [-770.488] -- 0:00:15
743000 -- [-773.270] (-770.516) (-772.016) (-772.109) * (-775.464) (-772.035) (-772.567) [-773.401] -- 0:00:15
743500 -- (-770.709) [-771.086] (-772.695) (-771.337) * (-771.389) (-772.574) [-770.848] (-778.217) -- 0:00:15
744000 -- (-775.901) (-770.860) (-772.138) [-770.527] * (-774.110) [-773.191] (-772.224) (-775.070) -- 0:00:15
744500 -- [-770.726] (-770.988) (-773.225) (-771.415) * (-773.295) (-771.149) (-779.628) [-775.562] -- 0:00:15
745000 -- [-771.714] (-770.962) (-776.612) (-772.077) * (-774.558) [-772.600] (-775.188) (-772.316) -- 0:00:15
Average standard deviation of split frequencies: 0.009181
745500 -- [-771.934] (-772.285) (-773.676) (-775.088) * [-772.040] (-770.558) (-771.377) (-773.158) -- 0:00:15
746000 -- [-772.848] (-773.677) (-772.771) (-773.363) * (-772.184) (-777.070) [-770.805] (-773.032) -- 0:00:15
746500 -- (-770.935) (-774.718) [-771.603] (-772.637) * (-771.679) (-773.391) (-770.774) [-770.568] -- 0:00:15
747000 -- (-771.726) (-774.838) [-771.217] (-774.536) * [-771.533] (-774.247) (-770.775) (-770.944) -- 0:00:15
747500 -- (-770.863) (-773.371) [-772.349] (-776.306) * [-771.381] (-772.658) (-772.001) (-774.487) -- 0:00:15
748000 -- (-773.974) (-773.778) (-771.284) [-774.029] * [-771.869] (-771.308) (-772.311) (-774.019) -- 0:00:15
748500 -- (-774.754) (-774.280) [-772.168] (-772.818) * [-771.838] (-773.962) (-772.067) (-780.492) -- 0:00:15
749000 -- (-775.138) [-771.812] (-772.591) (-771.657) * [-771.741] (-770.974) (-771.911) (-772.799) -- 0:00:15
749500 -- (-774.496) (-774.445) [-772.082] (-776.499) * (-772.507) [-771.180] (-774.032) (-772.039) -- 0:00:15
750000 -- (-780.763) (-773.048) [-775.259] (-775.032) * (-772.949) (-772.030) (-776.444) [-773.204] -- 0:00:15
Average standard deviation of split frequencies: 0.009457
750500 -- (-779.404) [-774.419] (-772.628) (-775.823) * (-773.821) (-772.747) [-771.740] (-773.157) -- 0:00:14
751000 -- [-772.594] (-772.284) (-773.110) (-772.371) * [-772.075] (-772.192) (-776.866) (-772.296) -- 0:00:14
751500 -- (-773.086) (-774.382) (-773.644) [-774.086] * (-773.307) [-773.032] (-775.807) (-770.835) -- 0:00:15
752000 -- (-771.216) (-774.172) (-773.935) [-772.065] * (-771.543) (-774.694) (-774.164) [-770.713] -- 0:00:15
752500 -- (-774.581) (-772.231) (-770.560) [-773.721] * (-772.038) [-773.417] (-774.404) (-770.516) -- 0:00:15
753000 -- (-773.151) [-772.448] (-772.330) (-771.576) * (-772.648) (-776.859) [-770.673] (-772.594) -- 0:00:15
753500 -- [-770.566] (-771.185) (-773.530) (-774.216) * (-773.347) (-775.935) [-773.630] (-773.412) -- 0:00:15
754000 -- [-772.802] (-772.443) (-772.489) (-773.038) * (-772.897) (-774.282) (-773.071) [-772.729] -- 0:00:15
754500 -- (-772.853) [-772.937] (-773.788) (-774.770) * (-776.960) [-772.412] (-771.023) (-771.655) -- 0:00:14
755000 -- (-773.326) (-776.319) (-771.218) [-773.160] * (-773.620) [-773.660] (-774.216) (-772.744) -- 0:00:14
Average standard deviation of split frequencies: 0.009390
755500 -- [-772.207] (-773.180) (-773.323) (-779.123) * (-771.826) (-775.754) (-776.464) [-772.732] -- 0:00:14
756000 -- (-770.815) [-771.763] (-771.941) (-772.174) * (-771.840) (-773.876) [-772.964] (-774.391) -- 0:00:14
756500 -- [-771.430] (-771.847) (-771.561) (-774.782) * (-772.116) [-773.404] (-772.749) (-771.536) -- 0:00:14
757000 -- (-771.390) [-771.707] (-771.686) (-771.111) * (-771.937) [-774.111] (-775.263) (-771.810) -- 0:00:14
757500 -- [-772.953] (-778.531) (-771.553) (-771.720) * (-774.401) (-773.968) (-773.844) [-772.649] -- 0:00:14
758000 -- [-771.629] (-771.640) (-772.297) (-772.749) * (-772.031) (-772.665) (-773.880) [-771.993] -- 0:00:14
758500 -- (-771.386) (-773.638) (-771.747) [-771.638] * [-771.310] (-771.766) (-776.357) (-772.677) -- 0:00:14
759000 -- (-772.470) (-771.273) [-772.535] (-773.370) * (-776.229) [-771.535] (-772.949) (-773.245) -- 0:00:14
759500 -- (-772.838) [-771.960] (-771.626) (-772.343) * [-772.908] (-773.217) (-773.265) (-772.740) -- 0:00:14
760000 -- (-772.425) [-771.324] (-771.667) (-771.264) * (-772.861) (-773.091) [-776.559] (-771.069) -- 0:00:14
Average standard deviation of split frequencies: 0.008444
760500 -- (-771.779) (-772.551) [-771.983] (-776.376) * (-772.603) (-774.227) (-774.122) [-771.046] -- 0:00:14
761000 -- (-770.691) (-772.230) (-771.785) [-772.888] * (-774.807) (-772.402) (-772.223) [-771.644] -- 0:00:14
761500 -- [-770.549] (-776.091) (-771.754) (-772.814) * (-772.984) [-771.482] (-772.710) (-772.333) -- 0:00:14
762000 -- (-773.183) [-771.245] (-770.790) (-774.182) * (-774.390) [-772.324] (-775.557) (-775.134) -- 0:00:14
762500 -- (-775.043) (-771.312) [-772.458] (-771.948) * (-773.397) (-772.209) [-775.915] (-775.661) -- 0:00:14
763000 -- (-774.794) (-771.971) (-774.755) [-770.358] * [-774.190] (-774.571) (-778.013) (-776.020) -- 0:00:14
763500 -- (-771.220) [-773.391] (-774.302) (-774.092) * (-771.322) [-773.097] (-773.391) (-772.022) -- 0:00:14
764000 -- (-773.407) (-775.918) [-772.896] (-776.207) * [-773.073] (-774.142) (-771.049) (-775.742) -- 0:00:14
764500 -- (-776.981) (-776.636) [-774.126] (-773.487) * (-772.943) (-777.533) [-771.740] (-773.273) -- 0:00:14
765000 -- (-771.395) (-775.087) [-771.662] (-784.251) * [-773.246] (-772.318) (-771.589) (-771.841) -- 0:00:14
Average standard deviation of split frequencies: 0.008347
765500 -- (-773.863) (-772.215) (-771.257) [-783.747] * (-772.565) (-772.313) (-774.759) [-771.626] -- 0:00:14
766000 -- [-772.707] (-773.174) (-772.956) (-773.525) * (-772.184) (-772.100) [-774.510] (-770.882) -- 0:00:14
766500 -- (-771.833) [-773.317] (-771.639) (-772.172) * (-773.212) (-771.358) [-771.179] (-772.644) -- 0:00:14
767000 -- (-771.427) (-776.965) (-771.973) [-772.800] * (-775.012) [-772.421] (-773.539) (-776.932) -- 0:00:13
767500 -- (-772.133) [-770.707] (-773.730) (-771.143) * (-773.682) (-772.340) [-774.878] (-774.907) -- 0:00:14
768000 -- (-773.849) [-773.139] (-774.254) (-771.247) * (-772.861) (-771.787) [-772.042] (-774.375) -- 0:00:14
768500 -- [-772.574] (-774.957) (-771.576) (-772.996) * (-771.613) (-772.429) (-773.059) [-771.828] -- 0:00:14
769000 -- (-770.983) (-771.880) (-772.705) [-770.720] * (-770.499) [-771.444] (-771.449) (-772.515) -- 0:00:14
769500 -- [-772.727] (-771.298) (-773.477) (-771.781) * (-772.758) (-774.314) (-774.661) [-773.736] -- 0:00:14
770000 -- (-771.882) (-772.812) [-779.958] (-773.449) * [-772.588] (-777.190) (-774.508) (-774.265) -- 0:00:14
Average standard deviation of split frequencies: 0.007990
770500 -- [-773.498] (-773.238) (-773.791) (-773.106) * (-772.854) (-773.178) [-771.073] (-775.289) -- 0:00:13
771000 -- (-773.938) (-772.976) (-771.139) [-773.929] * (-771.255) (-771.828) [-770.891] (-772.868) -- 0:00:13
771500 -- (-771.215) (-771.687) (-771.374) [-772.917] * (-771.768) (-774.879) [-771.321] (-772.394) -- 0:00:13
772000 -- [-771.253] (-771.347) (-772.881) (-771.842) * [-773.329] (-770.865) (-771.089) (-771.956) -- 0:00:13
772500 -- [-776.502] (-772.807) (-774.667) (-775.064) * (-771.134) [-771.690] (-773.371) (-772.030) -- 0:00:13
773000 -- (-774.310) (-770.594) [-772.848] (-773.285) * (-772.483) (-770.750) (-775.066) [-771.262] -- 0:00:13
773500 -- [-774.143] (-772.035) (-780.598) (-772.310) * (-774.290) (-773.622) (-774.588) [-771.312] -- 0:00:13
774000 -- (-772.985) [-772.882] (-773.891) (-772.633) * (-774.727) [-771.085] (-773.762) (-772.606) -- 0:00:13
774500 -- (-773.751) (-774.025) (-773.397) [-772.261] * (-776.680) [-774.621] (-774.245) (-771.198) -- 0:00:13
775000 -- (-773.213) [-776.786] (-774.328) (-771.576) * (-775.523) (-772.215) (-770.799) [-778.086] -- 0:00:13
Average standard deviation of split frequencies: 0.007783
775500 -- [-773.241] (-774.629) (-772.669) (-774.177) * (-775.308) (-774.194) [-771.722] (-771.211) -- 0:00:13
776000 -- (-774.054) (-771.038) [-771.983] (-772.370) * (-772.021) [-774.147] (-771.435) (-772.956) -- 0:00:13
776500 -- (-774.712) (-771.148) (-771.606) [-773.105] * (-778.699) [-771.388] (-773.461) (-775.647) -- 0:00:13
777000 -- (-773.557) (-771.515) [-771.727] (-773.226) * (-771.501) (-771.026) [-772.251] (-775.074) -- 0:00:13
777500 -- (-772.894) (-770.822) (-771.529) [-771.024] * (-773.358) [-775.620] (-772.984) (-781.126) -- 0:00:13
778000 -- [-772.258] (-771.056) (-773.640) (-774.138) * (-771.225) (-774.109) (-771.946) [-774.816] -- 0:00:13
778500 -- [-772.013] (-776.449) (-772.634) (-777.173) * (-772.120) (-772.668) (-774.698) [-773.266] -- 0:00:13
779000 -- (-770.848) (-772.100) [-774.146] (-777.559) * (-775.722) [-772.678] (-771.793) (-773.502) -- 0:00:13
779500 -- (-771.995) (-773.451) [-772.250] (-773.704) * (-772.776) [-772.475] (-771.505) (-771.948) -- 0:00:13
780000 -- (-772.124) (-773.279) [-773.135] (-773.136) * (-773.185) (-771.710) [-771.974] (-770.881) -- 0:00:13
Average standard deviation of split frequencies: 0.007850
780500 -- (-772.141) (-772.170) [-777.085] (-771.379) * (-772.785) (-771.316) [-770.923] (-770.899) -- 0:00:13
781000 -- (-772.269) (-772.876) (-775.119) [-771.783] * (-773.099) [-772.596] (-770.790) (-771.016) -- 0:00:13
781500 -- (-771.047) (-778.945) (-773.951) [-773.113] * (-771.621) [-772.146] (-771.414) (-772.108) -- 0:00:13
782000 -- (-771.210) [-772.605] (-771.992) (-774.527) * (-772.628) (-773.847) (-773.849) [-773.504] -- 0:00:13
782500 -- (-773.420) (-772.533) (-773.357) [-773.055] * (-772.880) [-772.893] (-771.911) (-775.493) -- 0:00:13
783000 -- [-774.378] (-775.286) (-774.073) (-771.283) * (-772.292) [-773.679] (-773.919) (-772.240) -- 0:00:13
783500 -- (-774.003) (-777.495) (-773.470) [-771.432] * (-772.042) [-771.497] (-773.330) (-771.935) -- 0:00:13
784000 -- [-773.249] (-772.497) (-771.702) (-772.836) * (-772.430) (-771.290) (-774.424) [-773.682] -- 0:00:13
784500 -- (-771.931) (-770.839) (-774.391) [-772.110] * [-773.333] (-775.284) (-771.535) (-772.283) -- 0:00:13
785000 -- (-773.158) (-773.318) (-772.682) [-772.302] * (-773.921) [-773.703] (-771.541) (-774.494) -- 0:00:13
Average standard deviation of split frequencies: 0.007572
785500 -- (-771.005) [-771.966] (-773.034) (-771.025) * (-773.305) (-772.248) (-774.813) [-772.855] -- 0:00:13
786000 -- [-772.851] (-773.235) (-773.941) (-772.183) * [-773.194] (-775.827) (-773.771) (-772.857) -- 0:00:13
786500 -- (-774.796) (-774.139) [-774.451] (-775.074) * (-775.594) (-774.253) [-772.535] (-773.204) -- 0:00:13
787000 -- (-772.072) [-775.325] (-774.538) (-773.926) * (-772.165) (-772.602) [-775.086] (-777.792) -- 0:00:12
787500 -- [-771.317] (-772.329) (-773.390) (-774.837) * [-770.723] (-775.648) (-771.718) (-775.898) -- 0:00:12
788000 -- (-779.075) [-770.720] (-774.721) (-771.817) * [-771.601] (-773.288) (-773.526) (-778.229) -- 0:00:12
788500 -- (-775.919) (-779.589) (-779.286) [-770.844] * (-772.691) [-772.226] (-772.118) (-774.127) -- 0:00:12
789000 -- (-772.268) (-771.679) [-775.427] (-771.253) * (-772.987) (-771.146) [-772.752] (-771.995) -- 0:00:12
789500 -- (-771.460) (-772.083) [-771.748] (-776.340) * (-773.841) (-771.189) [-771.597] (-773.172) -- 0:00:12
790000 -- (-771.106) (-775.227) (-777.176) [-772.755] * (-775.312) [-770.623] (-770.993) (-774.002) -- 0:00:12
Average standard deviation of split frequencies: 0.007266
790500 -- (-774.327) (-772.138) (-775.378) [-772.658] * (-776.206) (-770.829) [-771.447] (-770.559) -- 0:00:12
791000 -- (-773.494) (-772.622) (-772.420) [-772.289] * (-776.609) [-771.437] (-772.414) (-770.539) -- 0:00:12
791500 -- (-774.374) (-772.317) [-771.149] (-771.667) * [-772.735] (-771.424) (-775.541) (-772.421) -- 0:00:12
792000 -- (-773.882) (-772.298) [-771.803] (-771.693) * [-777.700] (-770.954) (-774.556) (-772.668) -- 0:00:12
792500 -- (-771.045) [-773.674] (-772.184) (-774.127) * (-775.775) (-772.185) (-771.659) [-771.318] -- 0:00:12
793000 -- (-773.195) (-772.582) (-771.989) [-771.895] * (-775.003) (-776.335) [-773.222] (-772.487) -- 0:00:12
793500 -- (-772.598) [-773.945] (-772.609) (-774.185) * [-772.012] (-772.142) (-772.047) (-772.062) -- 0:00:12
794000 -- (-772.258) [-771.599] (-772.151) (-773.693) * [-776.728] (-773.779) (-773.507) (-774.488) -- 0:00:12
794500 -- (-776.477) (-772.199) [-772.415] (-771.383) * [-775.142] (-772.218) (-776.185) (-773.150) -- 0:00:12
795000 -- (-779.999) (-771.867) (-775.338) [-771.383] * [-772.188] (-774.016) (-773.458) (-771.904) -- 0:00:12
Average standard deviation of split frequencies: 0.007255
795500 -- (-775.839) (-772.191) [-776.404] (-773.330) * [-772.670] (-771.242) (-770.900) (-771.559) -- 0:00:12
796000 -- (-772.211) [-771.839] (-772.237) (-771.682) * (-772.495) [-771.346] (-773.324) (-770.922) -- 0:00:12
796500 -- (-775.819) (-773.693) [-773.326] (-773.231) * (-771.807) (-771.482) (-772.967) [-771.219] -- 0:00:12
797000 -- (-772.236) (-771.539) [-771.695] (-773.005) * (-773.782) (-772.133) (-773.059) [-771.215] -- 0:00:12
797500 -- (-772.379) [-771.897] (-773.123) (-775.400) * [-773.347] (-771.832) (-770.580) (-774.417) -- 0:00:12
798000 -- [-772.199] (-770.953) (-775.998) (-773.560) * (-773.667) (-771.314) (-772.648) [-774.001] -- 0:00:12
798500 -- [-773.142] (-772.263) (-775.519) (-774.198) * (-771.525) (-771.826) [-772.221] (-774.095) -- 0:00:12
799000 -- (-772.748) [-771.914] (-772.284) (-771.509) * [-771.630] (-771.762) (-773.780) (-774.978) -- 0:00:12
799500 -- [-773.315] (-771.441) (-775.237) (-770.983) * [-773.996] (-771.898) (-775.681) (-771.386) -- 0:00:12
800000 -- (-771.582) (-771.465) (-771.501) [-771.982] * (-772.388) (-772.682) [-775.521] (-771.919) -- 0:00:12
Average standard deviation of split frequencies: 0.006808
800500 -- [-770.835] (-775.241) (-772.424) (-774.637) * (-771.182) [-775.901] (-771.579) (-773.602) -- 0:00:12
801000 -- (-770.916) (-777.000) [-771.208] (-772.187) * (-771.287) (-775.731) [-771.293] (-771.514) -- 0:00:12
801500 -- (-772.325) (-775.063) (-778.587) [-774.102] * [-772.317] (-773.692) (-772.434) (-770.847) -- 0:00:12
802000 -- [-773.813] (-772.514) (-773.781) (-774.114) * [-773.144] (-773.021) (-773.096) (-773.048) -- 0:00:12
802500 -- (-771.749) (-775.750) (-773.991) [-775.203] * (-771.205) (-770.998) [-773.201] (-773.615) -- 0:00:12
803000 -- [-773.090] (-773.045) (-772.263) (-772.562) * (-772.998) (-771.720) [-775.103] (-771.891) -- 0:00:12
803500 -- (-773.341) (-775.314) [-775.441] (-771.830) * [-773.415] (-771.801) (-776.156) (-772.623) -- 0:00:11
804000 -- (-770.742) (-776.845) (-775.653) [-772.232] * (-773.637) [-776.144] (-773.387) (-774.945) -- 0:00:11
804500 -- (-774.745) [-771.512] (-771.483) (-774.887) * (-774.716) (-771.556) (-772.229) [-775.755] -- 0:00:11
805000 -- (-776.155) (-771.403) (-770.972) [-773.755] * (-771.609) [-772.396] (-772.141) (-773.879) -- 0:00:11
Average standard deviation of split frequencies: 0.007128
805500 -- [-772.973] (-771.412) (-775.841) (-774.028) * [-771.587] (-777.971) (-771.761) (-772.595) -- 0:00:11
806000 -- (-771.916) (-771.288) [-773.321] (-773.203) * (-771.974) (-772.482) (-775.018) [-771.754] -- 0:00:11
806500 -- (-772.303) (-772.505) [-776.744] (-772.130) * [-772.816] (-772.482) (-776.544) (-775.362) -- 0:00:11
807000 -- [-775.154] (-772.918) (-775.619) (-772.706) * [-773.382] (-775.680) (-772.986) (-772.077) -- 0:00:11
807500 -- (-775.670) (-771.952) (-770.432) [-771.658] * (-770.599) (-771.847) [-773.659] (-773.223) -- 0:00:11
808000 -- (-777.669) (-772.619) [-773.830] (-772.551) * [-772.055] (-772.777) (-774.742) (-771.042) -- 0:00:11
808500 -- (-771.638) (-775.959) [-770.917] (-773.376) * (-772.916) (-771.921) [-772.380] (-770.889) -- 0:00:11
809000 -- (-774.062) (-776.721) (-771.792) [-774.301] * (-775.375) (-773.674) (-777.677) [-772.286] -- 0:00:11
809500 -- [-772.117] (-772.046) (-775.873) (-771.283) * (-772.812) (-771.820) [-774.904] (-774.447) -- 0:00:11
810000 -- (-772.763) (-772.062) [-772.378] (-771.008) * (-773.570) (-772.233) [-777.976] (-775.649) -- 0:00:11
Average standard deviation of split frequencies: 0.007196
810500 -- (-773.459) [-771.316] (-773.894) (-775.033) * [-772.697] (-775.266) (-773.638) (-771.126) -- 0:00:11
811000 -- (-771.026) (-770.781) (-772.820) [-772.963] * (-770.847) (-774.561) [-772.130] (-773.748) -- 0:00:11
811500 -- (-772.297) (-775.644) [-772.251] (-773.589) * (-775.472) (-778.661) [-774.054] (-773.177) -- 0:00:11
812000 -- [-773.771] (-773.413) (-771.814) (-771.731) * (-774.055) [-772.013] (-772.917) (-772.936) -- 0:00:11
812500 -- (-771.387) (-771.253) [-771.590] (-773.349) * [-771.448] (-771.626) (-772.877) (-772.981) -- 0:00:11
813000 -- [-772.858] (-778.793) (-774.042) (-772.023) * (-776.412) (-777.913) [-773.001] (-772.145) -- 0:00:11
813500 -- (-771.612) (-773.119) (-771.744) [-771.589] * (-772.634) (-774.427) [-772.144] (-775.552) -- 0:00:11
814000 -- [-771.583] (-772.889) (-772.025) (-773.476) * (-771.526) (-772.789) [-773.747] (-772.615) -- 0:00:11
814500 -- [-771.386] (-773.286) (-774.821) (-773.491) * [-771.015] (-771.979) (-773.089) (-773.640) -- 0:00:11
815000 -- (-770.878) (-772.898) (-773.344) [-775.428] * (-772.511) (-776.371) [-772.987] (-780.525) -- 0:00:11
Average standard deviation of split frequencies: 0.007474
815500 -- (-771.663) (-772.051) [-772.235] (-776.601) * (-772.809) [-776.755] (-773.708) (-775.372) -- 0:00:11
816000 -- (-772.740) [-771.588] (-771.598) (-774.726) * (-778.716) (-776.001) [-772.966] (-775.587) -- 0:00:11
816500 -- (-772.714) (-772.530) (-771.133) [-775.167] * (-778.621) (-772.656) (-773.620) [-772.815] -- 0:00:11
817000 -- (-774.921) [-773.399] (-771.885) (-771.595) * (-771.062) (-770.632) (-773.700) [-773.940] -- 0:00:11
817500 -- (-774.312) (-773.350) (-771.426) [-771.641] * (-776.137) [-773.858] (-774.011) (-771.466) -- 0:00:11
818000 -- (-771.507) (-771.559) (-771.087) [-771.929] * [-772.044] (-773.047) (-773.774) (-770.997) -- 0:00:11
818500 -- (-770.613) (-771.445) [-771.239] (-771.069) * (-772.455) [-775.582] (-773.640) (-776.386) -- 0:00:11
819000 -- (-775.538) [-773.227] (-772.003) (-774.482) * (-772.309) [-774.973] (-772.017) (-776.950) -- 0:00:11
819500 -- [-772.175] (-772.540) (-771.768) (-773.075) * [-772.256] (-774.238) (-772.147) (-771.705) -- 0:00:11
820000 -- (-772.142) [-771.563] (-771.817) (-772.262) * (-776.128) (-772.630) [-772.220] (-774.031) -- 0:00:10
Average standard deviation of split frequencies: 0.007647
820500 -- (-773.424) [-774.159] (-773.375) (-771.448) * (-771.974) (-773.467) [-774.632] (-771.823) -- 0:00:10
821000 -- [-773.940] (-776.205) (-772.497) (-771.367) * (-778.475) [-770.967] (-774.289) (-770.987) -- 0:00:10
821500 -- (-773.242) (-774.066) [-771.552] (-773.937) * (-771.765) (-773.522) [-771.055] (-773.873) -- 0:00:10
822000 -- (-770.408) (-773.409) (-773.979) [-772.996] * (-772.923) [-771.099] (-772.809) (-775.326) -- 0:00:10
822500 -- (-770.615) (-774.157) [-778.108] (-771.625) * (-772.920) (-771.922) [-778.160] (-773.546) -- 0:00:10
823000 -- (-773.622) (-774.201) (-776.649) [-770.743] * [-773.422] (-771.000) (-772.625) (-776.236) -- 0:00:10
823500 -- (-775.137) (-772.546) (-774.763) [-772.603] * (-772.823) (-772.996) (-774.134) [-772.501] -- 0:00:10
824000 -- (-771.561) [-771.305] (-772.179) (-773.479) * (-772.891) (-778.922) [-771.813] (-771.507) -- 0:00:10
824500 -- [-772.983] (-774.235) (-776.855) (-773.878) * (-773.172) (-773.899) (-775.613) [-776.429] -- 0:00:10
825000 -- (-771.065) (-773.434) [-772.874] (-771.166) * [-772.775] (-779.877) (-773.589) (-776.223) -- 0:00:10
Average standard deviation of split frequencies: 0.007562
825500 -- (-772.705) (-774.033) [-771.146] (-773.179) * (-771.279) (-771.661) [-774.192] (-775.599) -- 0:00:10
826000 -- (-773.269) (-773.884) [-771.227] (-772.351) * (-774.927) [-771.653] (-774.509) (-773.220) -- 0:00:10
826500 -- [-773.626] (-771.523) (-773.645) (-775.037) * (-772.443) (-771.646) [-774.394] (-777.806) -- 0:00:10
827000 -- [-772.904] (-772.707) (-773.419) (-771.475) * (-771.727) (-772.561) (-773.805) [-777.487] -- 0:00:10
827500 -- (-772.385) (-771.597) [-774.056] (-772.400) * (-771.430) (-773.616) (-770.392) [-771.789] -- 0:00:10
828000 -- [-772.652] (-773.652) (-774.313) (-774.060) * [-773.099] (-775.028) (-773.548) (-772.177) -- 0:00:10
828500 -- (-774.637) (-775.925) [-772.044] (-774.568) * (-772.256) (-777.456) [-772.759] (-773.795) -- 0:00:10
829000 -- (-772.244) (-773.573) [-781.081] (-775.161) * (-773.518) (-774.748) (-772.055) [-772.035] -- 0:00:10
829500 -- (-771.627) (-772.709) (-775.478) [-771.230] * [-770.741] (-775.199) (-773.556) (-771.808) -- 0:00:10
830000 -- [-772.533] (-772.372) (-770.574) (-770.871) * [-770.432] (-776.241) (-773.266) (-773.104) -- 0:00:10
Average standard deviation of split frequencies: 0.007910
830500 -- (-770.986) [-779.516] (-771.313) (-776.654) * (-772.367) (-772.635) [-770.643] (-771.822) -- 0:00:10
831000 -- (-773.678) [-771.334] (-773.250) (-774.077) * (-773.991) (-771.187) (-771.113) [-772.199] -- 0:00:10
831500 -- (-771.309) (-770.915) (-773.739) [-773.439] * [-771.662] (-772.983) (-772.727) (-772.585) -- 0:00:10
832000 -- (-771.429) (-775.508) [-771.687] (-770.558) * [-771.747] (-772.945) (-773.663) (-773.907) -- 0:00:10
832500 -- (-773.828) [-772.219] (-772.653) (-771.089) * (-772.526) (-774.362) (-776.458) [-770.637] -- 0:00:10
833000 -- (-771.841) [-773.444] (-776.948) (-770.887) * [-771.455] (-775.134) (-773.586) (-771.795) -- 0:00:10
833500 -- (-772.511) [-774.279] (-775.312) (-773.950) * (-774.730) (-771.706) [-771.704] (-771.061) -- 0:00:10
834000 -- (-772.259) (-771.401) [-776.500] (-775.041) * (-770.536) [-773.579] (-771.546) (-772.686) -- 0:00:10
834500 -- (-774.008) (-771.849) [-771.956] (-773.293) * (-770.721) (-775.540) (-771.504) [-771.154] -- 0:00:10
835000 -- [-772.261] (-774.754) (-774.813) (-773.308) * [-771.076] (-772.601) (-771.809) (-776.889) -- 0:00:10
Average standard deviation of split frequencies: 0.008035
835500 -- [-774.047] (-772.335) (-776.433) (-773.880) * (-776.532) (-773.920) (-771.465) [-772.757] -- 0:00:10
836000 -- (-773.205) (-771.937) [-775.655] (-772.323) * (-774.189) (-772.982) [-774.179] (-771.334) -- 0:00:10
836500 -- (-772.499) (-773.017) (-773.071) [-772.757] * (-775.385) (-775.179) [-780.099] (-773.341) -- 0:00:09
837000 -- (-773.782) (-771.480) [-773.427] (-770.995) * (-774.857) (-775.023) (-773.863) [-772.377] -- 0:00:09
837500 -- (-771.856) [-771.614] (-771.227) (-772.236) * (-774.127) (-776.432) (-775.004) [-774.203] -- 0:00:09
838000 -- (-773.268) (-772.761) [-771.126] (-772.032) * (-772.400) [-771.548] (-772.290) (-771.211) -- 0:00:09
838500 -- (-772.336) [-772.533] (-772.119) (-772.304) * (-774.583) [-770.865] (-773.718) (-771.452) -- 0:00:09
839000 -- (-772.702) (-773.129) (-771.175) [-774.290] * (-774.249) [-772.975] (-774.291) (-771.860) -- 0:00:09
839500 -- (-775.445) [-773.425] (-772.676) (-771.553) * (-771.505) (-774.563) [-772.792] (-774.757) -- 0:00:09
840000 -- (-776.965) (-771.680) [-776.495] (-771.889) * [-772.262] (-773.641) (-771.747) (-771.696) -- 0:00:09
Average standard deviation of split frequencies: 0.007500
840500 -- (-773.728) (-772.700) (-771.836) [-771.482] * [-773.452] (-772.367) (-772.319) (-771.465) -- 0:00:09
841000 -- (-771.582) (-770.680) [-771.964] (-774.496) * [-772.859] (-771.257) (-771.608) (-770.970) -- 0:00:09
841500 -- (-771.820) (-771.238) (-771.730) [-772.002] * (-774.228) [-771.373] (-780.420) (-771.233) -- 0:00:09
842000 -- (-772.580) [-772.066] (-771.489) (-774.014) * [-773.147] (-772.669) (-775.883) (-774.638) -- 0:00:09
842500 -- (-773.127) [-772.538] (-771.137) (-773.444) * [-773.200] (-772.503) (-773.290) (-773.350) -- 0:00:09
843000 -- [-772.430] (-773.062) (-771.268) (-771.796) * [-773.026] (-771.253) (-773.906) (-774.010) -- 0:00:09
843500 -- (-771.924) [-771.894] (-771.185) (-773.561) * (-772.161) (-773.404) (-771.758) [-773.969] -- 0:00:09
844000 -- (-772.008) (-770.949) [-772.591] (-776.086) * [-772.167] (-772.529) (-772.542) (-772.645) -- 0:00:09
844500 -- [-772.975] (-772.327) (-779.299) (-774.324) * (-773.343) (-773.453) [-771.015] (-772.255) -- 0:00:09
845000 -- (-771.833) (-773.137) [-773.239] (-774.836) * (-771.579) [-773.769] (-771.828) (-774.305) -- 0:00:09
Average standard deviation of split frequencies: 0.007488
845500 -- [-771.118] (-772.088) (-775.561) (-772.466) * (-778.174) [-773.225] (-773.495) (-771.454) -- 0:00:09
846000 -- (-771.205) (-775.038) [-771.724] (-771.954) * (-775.728) (-777.658) [-771.172] (-771.369) -- 0:00:09
846500 -- (-770.942) (-773.314) (-771.941) [-771.851] * [-773.219] (-773.585) (-770.893) (-776.295) -- 0:00:09
847000 -- (-772.763) (-771.615) [-771.162] (-771.922) * (-775.001) (-777.080) (-770.715) [-771.357] -- 0:00:09
847500 -- (-778.815) (-772.818) (-774.348) [-773.819] * (-773.177) (-775.628) [-773.910] (-774.107) -- 0:00:09
848000 -- [-776.330] (-771.821) (-771.167) (-774.597) * (-773.830) (-772.777) [-771.024] (-773.005) -- 0:00:09
848500 -- (-774.494) (-771.509) (-772.987) [-773.816] * (-771.669) (-773.090) (-771.279) [-773.630] -- 0:00:09
849000 -- (-771.256) (-770.689) (-773.227) [-771.120] * [-771.651] (-772.325) (-773.773) (-771.699) -- 0:00:09
849500 -- [-772.819] (-776.487) (-771.308) (-772.517) * (-772.189) [-771.639] (-773.278) (-772.969) -- 0:00:09
850000 -- (-772.068) (-772.677) [-771.926] (-772.580) * [-772.051] (-772.161) (-771.524) (-771.289) -- 0:00:09
Average standard deviation of split frequencies: 0.007343
850500 -- (-771.294) (-774.257) (-771.690) [-771.703] * [-773.947] (-771.804) (-773.768) (-771.499) -- 0:00:09
851000 -- (-771.169) (-771.846) (-774.319) [-773.277] * (-771.026) [-771.891] (-772.662) (-771.914) -- 0:00:09
851500 -- (-770.724) (-775.138) (-773.519) [-773.061] * (-773.574) [-775.973] (-774.847) (-774.609) -- 0:00:09
852000 -- (-771.316) (-773.864) (-775.722) [-775.202] * [-773.381] (-775.378) (-774.263) (-771.443) -- 0:00:09
852500 -- (-772.100) [-771.131] (-774.161) (-772.475) * (-775.367) (-779.088) (-774.108) [-772.391] -- 0:00:08
853000 -- (-773.696) (-771.673) [-773.488] (-771.579) * (-771.394) (-777.748) (-773.856) [-774.635] -- 0:00:08
853500 -- (-773.270) (-771.227) (-771.374) [-771.833] * [-773.131] (-775.365) (-772.179) (-775.653) -- 0:00:08
854000 -- (-772.072) (-771.694) (-771.631) [-770.816] * (-777.480) (-774.881) [-773.363] (-777.624) -- 0:00:08
854500 -- [-771.150] (-771.565) (-771.245) (-774.244) * [-771.351] (-773.946) (-771.404) (-773.993) -- 0:00:08
855000 -- (-773.225) (-771.953) (-772.170) [-772.691] * (-776.353) (-772.603) (-771.583) [-770.730] -- 0:00:08
Average standard deviation of split frequencies: 0.007435
855500 -- (-774.333) (-774.018) [-770.895] (-775.226) * (-778.490) (-771.606) [-773.400] (-771.261) -- 0:00:08
856000 -- (-771.097) (-777.262) (-770.836) [-771.369] * (-772.926) [-771.992] (-776.697) (-773.995) -- 0:00:08
856500 -- (-773.281) [-774.128] (-773.911) (-773.118) * (-773.871) [-771.927] (-772.690) (-770.946) -- 0:00:08
857000 -- (-773.932) [-773.987] (-772.064) (-772.048) * (-772.584) [-770.630] (-775.612) (-773.435) -- 0:00:08
857500 -- (-773.409) [-774.025] (-773.565) (-772.185) * (-771.240) (-772.059) (-771.379) [-771.547] -- 0:00:08
858000 -- (-774.306) [-774.944] (-773.816) (-772.930) * (-771.541) (-771.300) [-771.941] (-770.950) -- 0:00:08
858500 -- (-771.960) (-771.370) (-772.304) [-773.537] * (-771.672) [-771.655] (-772.730) (-773.968) -- 0:00:08
859000 -- (-776.237) (-775.453) [-773.275] (-771.205) * [-771.358] (-771.793) (-773.752) (-774.302) -- 0:00:08
859500 -- [-776.896] (-774.610) (-773.052) (-771.535) * (-771.004) [-771.322] (-773.560) (-772.633) -- 0:00:08
860000 -- (-773.513) [-772.772] (-772.649) (-771.551) * (-774.360) (-772.763) [-773.540] (-771.369) -- 0:00:08
Average standard deviation of split frequencies: 0.007531
860500 -- [-772.560] (-772.853) (-773.602) (-771.927) * (-772.975) [-771.016] (-772.804) (-773.867) -- 0:00:08
861000 -- (-774.233) (-773.869) (-772.058) [-771.051] * [-773.895] (-771.135) (-774.833) (-770.662) -- 0:00:08
861500 -- (-775.664) (-774.295) [-771.669] (-773.989) * (-775.155) [-771.249] (-773.666) (-770.616) -- 0:00:08
862000 -- (-772.361) (-774.118) (-774.107) [-773.900] * [-771.458] (-774.818) (-773.488) (-774.698) -- 0:00:08
862500 -- [-771.660] (-775.954) (-773.245) (-773.719) * [-771.526] (-773.519) (-775.478) (-775.158) -- 0:00:08
863000 -- (-775.966) (-774.318) (-772.779) [-774.790] * [-773.432] (-771.628) (-772.113) (-774.207) -- 0:00:08
863500 -- (-773.194) [-772.428] (-774.990) (-773.904) * (-774.456) [-774.462] (-772.479) (-771.870) -- 0:00:08
864000 -- (-773.006) (-772.987) [-771.257] (-776.172) * (-770.499) [-771.783] (-773.407) (-771.775) -- 0:00:08
864500 -- (-772.821) [-774.448] (-774.359) (-773.227) * (-770.534) (-774.017) (-776.176) [-771.041] -- 0:00:08
865000 -- (-775.333) (-771.823) (-772.592) [-773.071] * (-770.843) (-773.967) [-772.546] (-773.320) -- 0:00:08
Average standard deviation of split frequencies: 0.007723
865500 -- (-772.535) (-770.702) [-771.893] (-772.561) * [-778.252] (-777.239) (-772.895) (-775.371) -- 0:00:08
866000 -- [-771.449] (-770.928) (-776.319) (-776.441) * (-773.973) (-771.121) [-772.021] (-772.189) -- 0:00:08
866500 -- (-771.473) (-772.893) [-771.226] (-772.007) * [-771.380] (-773.000) (-770.362) (-771.410) -- 0:00:08
867000 -- (-774.584) [-771.749] (-772.679) (-773.243) * (-771.838) (-776.394) [-770.396] (-774.076) -- 0:00:08
867500 -- (-771.531) (-771.792) (-771.156) [-773.938] * (-775.073) (-772.986) (-775.897) [-772.341] -- 0:00:08
868000 -- (-779.400) [-772.177] (-774.734) (-772.472) * (-773.337) (-770.760) (-773.577) [-771.533] -- 0:00:08
868500 -- (-773.250) (-772.861) (-777.193) [-771.313] * [-771.879] (-771.309) (-776.043) (-771.830) -- 0:00:08
869000 -- [-771.479] (-773.378) (-777.211) (-771.337) * [-771.113] (-771.089) (-771.049) (-772.683) -- 0:00:07
869500 -- (-772.662) (-771.054) [-773.617] (-771.323) * (-773.685) [-771.340] (-771.357) (-771.542) -- 0:00:07
870000 -- (-772.917) (-771.411) (-772.097) [-771.986] * [-774.871] (-771.634) (-772.680) (-772.457) -- 0:00:07
Average standard deviation of split frequencies: 0.007544
870500 -- (-773.272) (-770.738) [-772.222] (-771.743) * (-773.074) (-777.984) [-772.523] (-772.244) -- 0:00:07
871000 -- (-773.284) [-770.749] (-772.877) (-771.663) * (-773.670) (-772.113) (-772.619) [-771.774] -- 0:00:07
871500 -- (-771.049) (-770.658) [-772.249] (-772.172) * (-776.278) [-771.960] (-771.334) (-773.571) -- 0:00:07
872000 -- [-771.805] (-770.741) (-770.751) (-772.434) * (-773.112) [-773.361] (-772.576) (-771.389) -- 0:00:07
872500 -- (-773.014) (-773.865) [-771.765] (-772.296) * (-775.056) (-771.702) (-772.291) [-771.855] -- 0:00:07
873000 -- (-772.870) (-771.695) (-771.674) [-771.911] * (-775.137) [-771.406] (-773.780) (-772.027) -- 0:00:07
873500 -- (-772.401) (-771.578) (-773.232) [-776.317] * (-770.874) (-770.786) [-774.731] (-773.580) -- 0:00:07
874000 -- (-771.949) (-773.625) (-771.797) [-777.793] * (-772.416) [-776.225] (-779.831) (-774.017) -- 0:00:07
874500 -- (-777.908) [-773.765] (-771.937) (-772.196) * (-773.114) (-775.814) (-772.304) [-771.980] -- 0:00:07
875000 -- (-775.422) [-774.029] (-771.731) (-773.912) * (-772.914) (-780.382) (-772.253) [-771.570] -- 0:00:07
Average standard deviation of split frequencies: 0.007498
875500 -- (-774.393) (-774.714) (-773.907) [-776.029] * (-775.960) [-771.902] (-772.362) (-772.059) -- 0:00:07
876000 -- (-772.506) (-774.663) (-772.625) [-774.047] * (-773.842) (-778.881) (-772.670) [-771.205] -- 0:00:07
876500 -- (-771.094) [-772.360] (-771.895) (-775.771) * (-774.116) (-777.981) [-773.999] (-773.968) -- 0:00:07
877000 -- [-775.348] (-772.259) (-771.757) (-771.485) * (-773.398) (-775.103) [-773.625] (-773.357) -- 0:00:07
877500 -- (-773.535) [-774.276] (-773.921) (-772.290) * (-772.770) [-774.971] (-771.262) (-772.568) -- 0:00:07
878000 -- (-773.638) [-772.210] (-771.164) (-771.084) * (-773.838) (-770.815) [-770.784] (-776.947) -- 0:00:07
878500 -- (-771.613) (-770.617) [-773.011] (-770.962) * [-773.832] (-773.413) (-771.492) (-776.959) -- 0:00:07
879000 -- (-770.904) (-773.278) (-775.423) [-772.582] * (-774.417) (-772.565) (-771.030) [-772.448] -- 0:00:07
879500 -- (-771.823) (-773.031) [-771.169] (-771.244) * (-776.809) (-771.859) (-772.993) [-771.412] -- 0:00:07
880000 -- (-776.180) (-772.649) (-774.928) [-771.825] * [-770.798] (-773.863) (-773.425) (-774.691) -- 0:00:07
Average standard deviation of split frequencies: 0.007779
880500 -- (-775.321) (-772.806) (-772.659) [-771.164] * (-772.212) (-772.790) [-772.707] (-772.789) -- 0:00:07
881000 -- (-772.071) [-772.652] (-772.009) (-773.041) * (-770.971) (-776.053) [-770.759] (-771.412) -- 0:00:07
881500 -- [-776.281] (-772.155) (-771.481) (-775.512) * (-771.473) (-771.936) (-775.058) [-776.072] -- 0:00:07
882000 -- [-775.185] (-773.731) (-772.077) (-773.430) * (-772.912) (-773.278) [-774.459] (-773.118) -- 0:00:07
882500 -- (-773.890) (-774.963) [-772.476] (-772.200) * (-775.616) (-773.116) (-772.200) [-771.918] -- 0:00:07
883000 -- (-771.557) [-773.349] (-775.029) (-772.920) * (-776.282) (-776.428) (-771.173) [-773.387] -- 0:00:07
883500 -- (-771.687) [-772.072] (-772.181) (-774.922) * [-773.693] (-774.097) (-771.717) (-773.473) -- 0:00:07
884000 -- (-771.296) [-772.447] (-772.770) (-772.832) * (-772.118) [-770.774] (-770.413) (-770.685) -- 0:00:07
884500 -- (-770.651) (-770.997) [-772.392] (-773.481) * (-776.126) (-773.763) (-771.583) [-773.053] -- 0:00:07
885000 -- (-772.490) [-774.508] (-772.158) (-773.023) * [-771.290] (-771.445) (-774.188) (-773.992) -- 0:00:07
Average standard deviation of split frequencies: 0.007682
885500 -- [-773.897] (-772.227) (-772.643) (-773.867) * (-773.017) (-771.205) [-770.646] (-775.410) -- 0:00:06
886000 -- (-777.175) [-775.669] (-774.297) (-772.760) * (-772.763) [-774.129] (-770.705) (-771.435) -- 0:00:06
886500 -- [-771.542] (-772.598) (-772.017) (-773.193) * (-771.369) (-775.307) [-770.685] (-772.926) -- 0:00:06
887000 -- [-770.788] (-776.356) (-771.928) (-774.727) * (-772.045) (-771.941) [-770.859] (-771.862) -- 0:00:06
887500 -- (-776.763) [-773.997] (-772.915) (-772.320) * (-775.258) [-771.454] (-773.345) (-776.312) -- 0:00:06
888000 -- (-770.723) (-776.663) (-771.898) [-774.011] * (-772.172) (-770.618) [-775.480] (-775.967) -- 0:00:06
888500 -- (-774.119) [-772.667] (-772.226) (-773.404) * (-775.965) (-771.807) [-773.791] (-777.122) -- 0:00:06
889000 -- (-776.203) [-772.071] (-772.182) (-774.120) * (-772.336) (-778.684) (-773.304) [-775.420] -- 0:00:06
889500 -- (-776.272) [-771.370] (-772.209) (-774.445) * (-772.899) [-774.767] (-770.949) (-775.982) -- 0:00:06
890000 -- (-774.543) (-773.083) (-771.936) [-771.727] * (-772.402) (-771.789) (-775.428) [-775.532] -- 0:00:06
Average standard deviation of split frequencies: 0.007344
890500 -- (-773.113) (-771.048) [-772.879] (-777.666) * (-771.553) [-770.745] (-775.525) (-774.566) -- 0:00:06
891000 -- (-772.955) [-773.084] (-770.664) (-772.498) * (-776.352) (-773.733) (-775.873) [-771.292] -- 0:00:06
891500 -- (-774.233) (-772.170) [-771.847] (-772.182) * [-772.936] (-770.613) (-772.995) (-771.777) -- 0:00:06
892000 -- (-773.545) [-773.529] (-771.597) (-779.832) * (-773.551) (-774.242) (-771.511) [-770.851] -- 0:00:06
892500 -- (-772.340) (-772.509) [-776.385] (-773.092) * [-774.542] (-775.032) (-771.668) (-773.755) -- 0:00:06
893000 -- (-772.585) (-771.607) [-772.312] (-774.277) * (-773.160) (-773.388) [-774.044] (-771.592) -- 0:00:06
893500 -- (-775.996) (-774.686) [-773.177] (-772.152) * [-772.659] (-772.332) (-772.259) (-772.058) -- 0:00:06
894000 -- [-775.017] (-772.935) (-772.020) (-771.118) * (-774.145) [-771.641] (-771.679) (-772.835) -- 0:00:06
894500 -- (-774.027) (-775.351) (-773.142) [-774.002] * (-771.892) (-772.719) [-772.188] (-773.667) -- 0:00:06
895000 -- (-772.922) (-771.464) (-774.237) [-774.115] * (-772.906) [-776.591] (-772.208) (-771.848) -- 0:00:06
Average standard deviation of split frequencies: 0.007234
895500 -- [-772.945] (-770.955) (-773.080) (-774.552) * (-771.458) (-776.760) (-771.258) [-775.787] -- 0:00:06
896000 -- (-774.100) [-770.670] (-772.603) (-772.425) * (-773.264) [-771.319] (-772.238) (-771.609) -- 0:00:06
896500 -- (-772.268) [-770.557] (-772.466) (-772.554) * (-774.520) (-773.096) [-771.665] (-773.608) -- 0:00:06
897000 -- (-773.255) (-770.990) [-770.553] (-772.567) * [-772.374] (-774.189) (-777.714) (-774.240) -- 0:00:06
897500 -- (-773.919) (-770.819) [-772.246] (-770.557) * [-773.168] (-773.376) (-773.066) (-770.832) -- 0:00:06
898000 -- (-772.555) [-775.927] (-774.998) (-772.131) * (-772.257) (-772.549) (-772.626) [-774.971] -- 0:00:06
898500 -- (-774.109) [-771.881] (-775.301) (-772.598) * [-771.422] (-776.129) (-772.994) (-774.179) -- 0:00:06
899000 -- (-775.257) (-773.206) [-772.551] (-772.145) * (-773.146) [-772.556] (-771.602) (-775.070) -- 0:00:06
899500 -- (-772.546) (-774.512) (-772.440) [-771.543] * (-773.045) (-774.289) [-770.818] (-771.526) -- 0:00:06
900000 -- (-773.463) (-777.012) (-770.795) [-771.565] * [-770.818] (-772.021) (-772.866) (-773.484) -- 0:00:06
Average standard deviation of split frequencies: 0.007066
900500 -- (-771.956) (-772.916) [-772.829] (-772.412) * [-771.383] (-772.280) (-771.532) (-773.491) -- 0:00:06
901000 -- (-773.949) (-772.273) (-772.568) [-773.446] * (-772.720) (-773.640) (-771.502) [-772.927] -- 0:00:06
901500 -- (-772.397) (-773.378) [-771.966] (-772.410) * [-773.028] (-772.453) (-772.258) (-773.760) -- 0:00:06
902000 -- (-771.862) (-771.917) [-772.780] (-776.625) * (-773.580) [-771.051] (-771.029) (-773.875) -- 0:00:05
902500 -- (-770.665) (-772.918) (-772.615) [-775.290] * (-776.658) (-772.209) (-771.252) [-771.681] -- 0:00:05
903000 -- (-770.668) (-771.155) [-772.147] (-770.963) * [-778.491] (-772.547) (-771.171) (-773.907) -- 0:00:05
903500 -- (-770.546) [-775.814] (-775.467) (-770.807) * (-774.639) (-775.099) (-771.367) [-779.804] -- 0:00:05
904000 -- (-771.820) (-772.853) (-772.941) [-771.345] * (-771.912) (-772.675) (-771.309) [-772.353] -- 0:00:05
904500 -- [-770.972] (-774.441) (-773.318) (-771.049) * (-771.129) (-772.264) [-770.986] (-775.093) -- 0:00:05
905000 -- (-771.898) (-772.118) (-771.743) [-772.376] * (-773.380) (-774.635) (-772.702) [-772.485] -- 0:00:05
Average standard deviation of split frequencies: 0.007219
905500 -- (-772.823) (-779.835) [-774.053] (-772.348) * [-773.451] (-774.764) (-772.425) (-774.309) -- 0:00:05
906000 -- (-774.885) (-779.563) (-772.952) [-772.947] * (-775.486) [-773.755] (-770.533) (-771.624) -- 0:00:05
906500 -- (-772.544) (-775.033) [-773.058] (-771.277) * (-771.800) (-771.176) (-773.625) [-772.672] -- 0:00:05
907000 -- [-772.095] (-772.609) (-772.692) (-772.809) * (-777.557) (-772.323) [-771.094] (-773.095) -- 0:00:05
907500 -- [-771.059] (-772.003) (-771.787) (-772.726) * (-774.038) (-771.103) [-771.566] (-775.186) -- 0:00:05
908000 -- [-772.955] (-773.078) (-770.763) (-775.758) * (-772.359) (-772.139) [-770.898] (-773.069) -- 0:00:05
908500 -- [-773.944] (-772.169) (-772.155) (-774.016) * (-771.244) [-773.892] (-771.789) (-774.086) -- 0:00:05
909000 -- (-774.626) (-772.659) [-778.304] (-775.271) * (-776.524) (-772.468) (-775.556) [-771.158] -- 0:00:05
909500 -- (-773.025) (-772.601) [-774.779] (-772.585) * (-774.350) (-772.373) (-772.909) [-773.902] -- 0:00:05
910000 -- [-770.935] (-771.476) (-773.770) (-775.243) * (-777.829) (-778.324) [-775.569] (-772.333) -- 0:00:05
Average standard deviation of split frequencies: 0.007085
910500 -- (-771.721) (-772.584) (-773.066) [-772.324] * (-775.884) [-775.755] (-773.926) (-770.854) -- 0:00:05
911000 -- (-774.458) (-772.633) (-771.737) [-771.809] * [-771.391] (-775.651) (-772.251) (-771.579) -- 0:00:05
911500 -- [-771.699] (-776.442) (-771.830) (-772.029) * [-771.044] (-774.689) (-770.903) (-772.897) -- 0:00:05
912000 -- (-772.679) (-779.389) (-773.949) [-774.917] * (-773.331) (-771.372) (-774.006) [-775.254] -- 0:00:05
912500 -- (-774.557) (-773.712) [-775.708] (-773.685) * (-772.500) (-771.813) (-773.783) [-772.959] -- 0:00:05
913000 -- (-783.266) (-775.772) (-771.791) [-776.842] * (-771.970) [-771.944] (-773.206) (-772.734) -- 0:00:05
913500 -- (-774.657) (-774.126) [-771.718] (-777.915) * (-771.545) [-772.330] (-771.707) (-773.695) -- 0:00:05
914000 -- (-773.875) (-773.274) [-771.378] (-778.763) * (-770.757) (-770.864) [-773.648] (-773.761) -- 0:00:05
914500 -- (-773.165) [-770.484] (-771.476) (-771.576) * (-772.019) (-770.764) (-772.807) [-775.107] -- 0:00:05
915000 -- (-773.011) (-770.372) [-771.553] (-772.773) * [-771.957] (-772.526) (-773.967) (-772.548) -- 0:00:05
Average standard deviation of split frequencies: 0.007334
915500 -- (-776.348) (-771.047) [-771.253] (-772.764) * [-771.499] (-772.203) (-772.430) (-773.245) -- 0:00:05
916000 -- (-774.537) [-770.966] (-773.043) (-771.587) * (-771.620) (-770.955) [-772.311] (-772.954) -- 0:00:05
916500 -- [-771.905] (-775.950) (-775.278) (-772.200) * (-771.652) (-773.196) [-771.515] (-772.160) -- 0:00:05
917000 -- (-780.752) (-774.681) [-772.349] (-775.120) * [-771.249] (-775.109) (-772.371) (-772.735) -- 0:00:05
917500 -- (-775.886) [-772.730] (-771.518) (-772.978) * (-774.909) [-770.774] (-771.712) (-775.335) -- 0:00:05
918000 -- (-774.602) (-773.213) (-775.224) [-777.448] * (-772.330) [-770.615] (-773.875) (-772.539) -- 0:00:05
918500 -- (-771.020) (-771.775) (-774.630) [-771.634] * (-771.605) (-774.476) [-772.230] (-770.783) -- 0:00:04
919000 -- (-773.631) (-773.387) (-774.701) [-774.186] * (-774.360) (-772.907) [-771.167] (-772.825) -- 0:00:04
919500 -- (-772.892) (-773.742) (-772.923) [-773.131] * [-771.845] (-772.878) (-775.072) (-772.392) -- 0:00:04
920000 -- (-775.120) (-773.073) (-776.132) [-771.944] * (-775.565) (-771.165) (-775.319) [-774.640] -- 0:00:04
Average standard deviation of split frequencies: 0.007296
920500 -- (-774.320) [-773.315] (-772.651) (-772.052) * [-773.147] (-771.408) (-772.737) (-772.752) -- 0:00:04
921000 -- [-776.342] (-772.036) (-772.064) (-773.191) * (-772.475) (-771.118) [-772.231] (-773.422) -- 0:00:04
921500 -- (-771.932) (-773.123) [-775.952] (-771.212) * (-773.365) [-772.433] (-773.821) (-772.839) -- 0:00:04
922000 -- (-772.136) (-772.129) [-773.763] (-771.331) * (-777.629) [-771.636] (-773.654) (-773.275) -- 0:00:04
922500 -- (-772.363) (-771.750) (-774.900) [-773.547] * (-773.052) [-776.441] (-771.868) (-773.640) -- 0:00:04
923000 -- (-773.861) (-774.090) (-772.957) [-771.504] * (-772.025) [-771.891] (-771.760) (-771.345) -- 0:00:04
923500 -- (-771.505) [-775.221] (-773.885) (-771.401) * (-775.119) (-772.083) (-775.353) [-772.137] -- 0:00:04
924000 -- (-772.539) [-772.387] (-775.168) (-770.745) * [-774.378] (-778.804) (-772.472) (-772.767) -- 0:00:04
924500 -- (-772.846) (-770.985) (-771.822) [-771.711] * (-773.083) [-771.716] (-771.920) (-773.021) -- 0:00:04
925000 -- (-771.933) [-772.032] (-773.543) (-772.884) * (-772.638) (-771.110) (-773.943) [-771.013] -- 0:00:04
Average standard deviation of split frequencies: 0.007032
925500 -- (-771.880) [-775.315] (-772.368) (-771.712) * (-771.701) [-773.263] (-774.800) (-772.225) -- 0:00:04
926000 -- (-771.889) [-774.179] (-777.031) (-771.353) * (-776.729) (-772.440) [-775.053] (-772.266) -- 0:00:04
926500 -- (-773.464) (-772.313) (-773.490) [-775.037] * [-771.149] (-771.686) (-773.963) (-772.123) -- 0:00:04
927000 -- (-771.221) (-771.876) [-771.754] (-771.116) * (-774.033) [-771.612] (-777.233) (-770.719) -- 0:00:04
927500 -- (-771.892) [-770.987] (-773.021) (-771.154) * (-773.306) [-770.687] (-772.128) (-771.934) -- 0:00:04
928000 -- (-774.467) [-770.940] (-772.334) (-773.043) * (-777.586) [-773.400] (-774.162) (-773.839) -- 0:00:04
928500 -- [-774.357] (-770.942) (-774.348) (-772.932) * (-772.764) (-772.087) [-776.323] (-774.179) -- 0:00:04
929000 -- (-774.739) (-775.341) (-772.113) [-771.316] * (-772.058) (-772.860) (-773.409) [-771.446] -- 0:00:04
929500 -- (-772.421) (-771.760) [-777.633] (-777.534) * (-775.339) [-773.987] (-772.623) (-770.852) -- 0:00:04
930000 -- (-775.520) (-773.512) (-777.822) [-772.859] * (-775.402) (-775.582) (-771.338) [-772.249] -- 0:00:04
Average standard deviation of split frequencies: 0.006933
930500 -- (-771.964) (-773.175) [-772.199] (-771.003) * (-773.679) (-774.227) [-771.370] (-772.600) -- 0:00:04
931000 -- (-772.100) [-772.861] (-774.769) (-770.811) * (-772.895) [-772.172] (-771.957) (-771.760) -- 0:00:04
931500 -- (-779.012) [-772.060] (-775.020) (-772.496) * (-774.576) [-772.033] (-778.222) (-772.517) -- 0:00:04
932000 -- (-773.417) [-772.388] (-775.077) (-772.945) * (-773.987) [-771.186] (-772.250) (-775.331) -- 0:00:04
932500 -- (-773.431) (-771.601) (-770.858) [-772.528] * [-772.011] (-771.641) (-775.736) (-771.722) -- 0:00:04
933000 -- (-771.354) (-772.712) (-771.263) [-773.971] * (-773.606) [-774.587] (-775.085) (-770.768) -- 0:00:04
933500 -- [-772.457] (-771.797) (-771.310) (-774.245) * (-778.476) (-774.379) (-773.166) [-770.835] -- 0:00:04
934000 -- (-772.056) (-773.803) (-771.730) [-778.103] * (-772.620) [-771.741] (-777.647) (-772.769) -- 0:00:04
934500 -- (-771.535) (-770.453) (-770.894) [-771.447] * (-773.065) (-771.057) [-773.669] (-776.723) -- 0:00:03
935000 -- (-775.684) (-772.980) (-771.443) [-771.951] * (-773.171) (-773.795) (-772.875) [-771.845] -- 0:00:03
Average standard deviation of split frequencies: 0.006516
935500 -- (-776.184) (-773.568) [-771.488] (-771.958) * (-781.795) [-771.956] (-774.613) (-772.171) -- 0:00:03
936000 -- (-773.079) (-774.157) (-777.393) [-771.959] * (-773.272) (-775.012) (-771.748) [-772.989] -- 0:00:03
936500 -- (-772.832) [-774.566] (-773.290) (-772.475) * (-772.905) [-775.540] (-776.656) (-779.902) -- 0:00:03
937000 -- (-771.011) [-774.084] (-772.847) (-774.035) * (-772.341) (-776.205) (-777.313) [-773.380] -- 0:00:03
937500 -- (-775.815) (-772.533) [-773.874] (-780.833) * [-773.408] (-777.813) (-776.016) (-773.794) -- 0:00:03
938000 -- (-775.174) (-775.791) [-775.264] (-780.321) * (-772.502) (-773.217) [-772.056] (-774.097) -- 0:00:03
938500 -- [-771.882] (-773.958) (-774.588) (-774.051) * [-777.202] (-772.378) (-774.131) (-773.279) -- 0:00:03
939000 -- (-771.414) [-773.517] (-773.107) (-771.180) * (-773.354) (-771.757) [-775.399] (-773.052) -- 0:00:03
939500 -- (-772.551) (-774.094) (-772.039) [-772.707] * (-775.142) [-771.998] (-779.600) (-775.045) -- 0:00:03
940000 -- (-774.172) (-772.956) (-770.579) [-770.717] * (-772.142) (-771.471) [-773.241] (-772.314) -- 0:00:03
Average standard deviation of split frequencies: 0.006953
940500 -- (-771.924) (-774.581) [-772.496] (-774.623) * (-771.317) (-772.572) (-771.624) [-771.064] -- 0:00:03
941000 -- [-773.699] (-774.628) (-777.797) (-772.716) * (-771.619) (-774.803) [-771.256] (-772.917) -- 0:00:03
941500 -- (-774.029) [-771.898] (-774.354) (-779.116) * (-770.952) [-775.349] (-772.792) (-771.193) -- 0:00:03
942000 -- [-771.897] (-771.571) (-774.836) (-773.955) * (-771.811) [-773.278] (-771.862) (-772.506) -- 0:00:03
942500 -- (-772.173) (-770.357) (-775.046) [-772.937] * (-771.980) [-772.066] (-771.205) (-772.430) -- 0:00:03
943000 -- [-771.844] (-770.360) (-778.262) (-773.160) * (-771.267) (-772.827) [-771.229] (-772.296) -- 0:00:03
943500 -- [-772.563] (-770.587) (-777.564) (-776.746) * (-775.987) [-773.282] (-771.827) (-772.768) -- 0:00:03
944000 -- (-770.773) (-772.565) [-775.544] (-775.877) * (-770.795) (-775.708) (-773.248) [-773.484] -- 0:00:03
944500 -- (-772.848) (-773.141) [-773.109] (-775.296) * [-772.302] (-772.295) (-770.329) (-772.958) -- 0:00:03
945000 -- (-772.409) (-772.360) (-774.774) [-773.541] * (-775.176) [-771.964] (-773.789) (-771.208) -- 0:00:03
Average standard deviation of split frequencies: 0.007132
945500 -- (-772.586) [-770.489] (-778.220) (-771.776) * [-776.968] (-770.319) (-775.943) (-775.003) -- 0:00:03
946000 -- (-772.556) [-774.767] (-776.826) (-775.132) * (-772.502) [-770.897] (-776.331) (-771.545) -- 0:00:03
946500 -- (-774.074) [-773.271] (-774.785) (-773.708) * (-774.456) [-771.484] (-777.599) (-774.419) -- 0:00:03
947000 -- (-772.892) (-771.918) (-777.849) [-772.227] * (-773.297) (-770.841) (-772.140) [-774.653] -- 0:00:03
947500 -- (-773.423) (-775.040) (-777.543) [-772.476] * (-777.343) (-772.881) [-771.853] (-773.457) -- 0:00:03
948000 -- (-773.231) [-772.561] (-772.786) (-773.664) * (-775.155) [-771.854] (-771.265) (-775.198) -- 0:00:03
948500 -- (-776.020) (-775.289) [-771.748] (-773.179) * [-775.124] (-776.923) (-771.236) (-772.753) -- 0:00:03
949000 -- (-774.644) (-778.804) [-774.230] (-772.895) * (-773.241) (-776.056) [-771.927] (-774.667) -- 0:00:03
949500 -- (-772.516) [-775.946] (-777.060) (-774.541) * (-771.541) [-770.801] (-773.178) (-773.077) -- 0:00:03
950000 -- [-776.828] (-773.940) (-780.583) (-773.237) * (-772.519) (-777.316) [-776.356] (-772.699) -- 0:00:03
Average standard deviation of split frequencies: 0.007376
950500 -- [-771.845] (-773.826) (-772.629) (-774.452) * [-772.561] (-774.650) (-774.819) (-773.798) -- 0:00:03
951000 -- (-774.562) (-773.860) [-772.457] (-773.087) * (-772.812) (-771.563) [-773.696] (-772.183) -- 0:00:02
951500 -- (-770.901) (-772.349) (-773.963) [-776.327] * (-777.220) [-773.203] (-773.700) (-771.444) -- 0:00:02
952000 -- (-774.208) (-771.075) (-771.994) [-772.895] * (-772.206) [-772.954] (-776.304) (-772.254) -- 0:00:02
952500 -- [-771.589] (-771.450) (-774.304) (-774.438) * (-772.965) [-773.217] (-773.898) (-771.896) -- 0:00:02
953000 -- [-772.381] (-773.525) (-773.427) (-772.880) * (-772.548) (-774.174) [-770.636] (-772.681) -- 0:00:02
953500 -- (-779.102) (-772.607) (-771.776) [-772.441] * (-775.346) (-776.211) (-771.685) [-771.315] -- 0:00:02
954000 -- (-771.628) (-776.132) [-772.425] (-770.680) * (-776.043) (-772.286) (-771.869) [-773.095] -- 0:00:02
954500 -- [-772.264] (-772.014) (-773.922) (-772.823) * (-773.729) [-771.742] (-770.671) (-772.127) -- 0:00:02
955000 -- (-771.402) (-772.175) [-770.463] (-771.411) * (-777.233) (-771.699) (-771.472) [-772.793] -- 0:00:02
Average standard deviation of split frequencies: 0.006965
955500 -- (-773.009) (-772.193) (-772.966) [-772.366] * (-773.769) (-773.893) (-774.494) [-771.116] -- 0:00:02
956000 -- (-772.525) [-777.753] (-774.315) (-774.725) * [-770.962] (-772.207) (-775.829) (-772.092) -- 0:00:02
956500 -- [-771.422] (-774.463) (-773.089) (-774.481) * [-772.933] (-773.767) (-778.561) (-771.006) -- 0:00:02
957000 -- (-773.330) (-773.025) (-774.126) [-776.946] * (-772.163) (-772.092) (-771.710) [-771.676] -- 0:00:02
957500 -- (-776.943) (-776.682) [-771.274] (-773.966) * (-773.996) (-774.029) [-771.474] (-774.744) -- 0:00:02
958000 -- [-774.014] (-772.806) (-770.541) (-771.056) * (-771.665) (-772.824) (-771.731) [-771.378] -- 0:00:02
958500 -- (-776.789) (-772.292) [-772.858] (-773.128) * (-774.205) (-772.931) (-772.390) [-771.202] -- 0:00:02
959000 -- (-772.141) (-781.332) [-772.436] (-771.072) * (-774.156) [-771.885] (-771.116) (-771.621) -- 0:00:02
959500 -- (-773.029) (-773.912) [-770.527] (-772.283) * (-774.236) [-772.255] (-771.783) (-771.531) -- 0:00:02
960000 -- [-772.644] (-776.341) (-774.408) (-776.306) * (-774.798) (-771.480) (-776.209) [-771.145] -- 0:00:02
Average standard deviation of split frequencies: 0.006471
960500 -- (-776.278) (-773.963) [-771.156] (-773.649) * (-772.226) (-771.709) (-780.747) [-774.082] -- 0:00:02
961000 -- (-775.362) [-771.923] (-770.816) (-776.556) * [-771.184] (-773.726) (-774.419) (-775.358) -- 0:00:02
961500 -- (-773.337) [-770.635] (-770.510) (-771.886) * [-771.626] (-772.146) (-771.898) (-773.567) -- 0:00:02
962000 -- [-771.737] (-773.915) (-772.958) (-772.933) * (-773.194) (-773.485) (-772.342) [-770.314] -- 0:00:02
962500 -- (-770.876) (-774.003) (-775.423) [-770.884] * (-770.757) (-773.416) [-771.968] (-770.769) -- 0:00:02
963000 -- (-774.299) (-772.992) [-771.027] (-771.496) * (-770.757) (-773.580) (-773.594) [-773.257] -- 0:00:02
963500 -- (-776.427) (-773.395) [-778.024] (-771.588) * (-770.610) (-773.651) [-771.817] (-772.571) -- 0:00:02
964000 -- (-774.232) [-773.248] (-774.255) (-771.712) * (-771.107) (-775.037) (-771.330) [-773.895] -- 0:00:02
964500 -- (-770.723) (-772.588) (-771.931) [-772.314] * (-771.216) (-774.163) [-771.300] (-771.032) -- 0:00:02
965000 -- (-772.518) (-773.376) [-771.489] (-774.632) * [-771.640] (-773.377) (-770.821) (-772.691) -- 0:00:02
Average standard deviation of split frequencies: 0.006618
965500 -- (-773.149) [-772.525] (-771.089) (-776.590) * (-771.604) [-771.154] (-774.137) (-773.119) -- 0:00:02
966000 -- (-772.207) (-772.624) (-771.115) [-771.156] * (-773.092) (-773.011) (-778.279) [-772.496] -- 0:00:02
966500 -- (-773.186) (-773.075) (-777.247) [-772.719] * (-773.065) (-774.293) (-773.180) [-773.324] -- 0:00:02
967000 -- [-772.564] (-771.634) (-772.819) (-772.111) * (-772.944) (-772.614) [-772.003] (-772.562) -- 0:00:02
967500 -- (-771.750) (-771.263) (-774.834) [-771.100] * (-776.196) (-773.400) (-780.679) [-771.980] -- 0:00:01
968000 -- [-771.080] (-770.942) (-774.018) (-774.256) * [-773.417] (-776.739) (-778.304) (-775.778) -- 0:00:01
968500 -- (-771.831) (-770.666) [-772.817] (-771.427) * [-771.590] (-771.925) (-776.865) (-773.459) -- 0:00:01
969000 -- (-772.235) [-771.803] (-773.774) (-772.597) * (-772.247) (-774.212) [-773.167] (-773.463) -- 0:00:01
969500 -- (-771.566) [-770.844] (-771.862) (-774.183) * (-771.164) (-773.405) (-772.673) [-771.906] -- 0:00:01
970000 -- (-770.411) [-773.184] (-779.839) (-772.623) * (-773.410) (-771.077) [-774.747] (-772.546) -- 0:00:01
Average standard deviation of split frequencies: 0.006860
970500 -- (-771.368) (-771.238) [-773.294] (-772.390) * (-774.401) [-772.498] (-775.464) (-773.880) -- 0:00:01
971000 -- (-773.564) (-771.393) [-772.667] (-771.744) * [-772.459] (-773.946) (-777.256) (-772.040) -- 0:00:01
971500 -- (-770.896) (-772.276) [-774.470] (-771.813) * (-771.929) (-775.371) (-777.417) [-774.655] -- 0:00:01
972000 -- (-772.345) (-771.617) [-773.735] (-772.672) * (-777.130) [-771.062] (-773.437) (-770.950) -- 0:00:01
972500 -- (-773.159) [-773.272] (-771.728) (-773.288) * (-774.443) (-772.358) [-771.684] (-772.472) -- 0:00:01
973000 -- (-774.349) (-774.657) [-774.562] (-773.830) * (-770.696) (-772.478) [-770.648] (-774.675) -- 0:00:01
973500 -- (-774.523) [-772.215] (-772.555) (-775.433) * (-775.299) (-775.525) (-771.659) [-771.993] -- 0:00:01
974000 -- (-771.246) (-776.868) (-771.917) [-773.478] * (-771.836) [-771.128] (-771.801) (-773.549) -- 0:00:01
974500 -- [-771.952] (-773.180) (-771.412) (-772.937) * (-774.094) [-772.135] (-775.322) (-771.904) -- 0:00:01
975000 -- (-772.026) (-774.534) [-771.077] (-771.618) * (-774.435) (-774.078) (-772.712) [-773.095] -- 0:00:01
Average standard deviation of split frequencies: 0.007245
975500 -- [-775.203] (-772.088) (-774.717) (-772.072) * (-772.376) (-776.150) (-772.740) [-771.502] -- 0:00:01
976000 -- (-774.625) (-771.969) (-771.896) [-774.259] * (-772.199) (-777.984) [-774.741] (-772.167) -- 0:00:01
976500 -- (-774.176) (-772.923) [-778.511] (-771.525) * (-774.278) (-773.850) (-777.095) [-772.138] -- 0:00:01
977000 -- [-773.412] (-773.023) (-775.524) (-772.937) * (-773.161) (-772.875) [-772.123] (-770.871) -- 0:00:01
977500 -- [-771.382] (-771.770) (-772.268) (-771.206) * [-774.260] (-774.824) (-772.174) (-771.552) -- 0:00:01
978000 -- [-771.454] (-771.057) (-773.466) (-772.077) * (-774.482) [-775.056] (-771.299) (-774.826) -- 0:00:01
978500 -- [-772.257] (-771.398) (-772.156) (-777.119) * (-777.792) (-773.163) (-773.257) [-777.683] -- 0:00:01
979000 -- (-772.323) (-771.215) (-772.679) [-771.472] * (-776.892) (-773.877) (-772.641) [-772.984] -- 0:00:01
979500 -- (-771.859) (-772.635) [-774.232] (-771.674) * (-772.081) [-770.769] (-772.353) (-771.024) -- 0:00:01
980000 -- (-773.686) [-774.766] (-774.654) (-772.072) * (-771.446) (-774.680) (-772.291) [-776.598] -- 0:00:01
Average standard deviation of split frequencies: 0.007210
980500 -- [-772.377] (-775.612) (-773.927) (-772.086) * (-778.122) (-771.423) (-772.732) [-771.166] -- 0:00:01
981000 -- (-773.265) [-770.650] (-775.512) (-774.711) * (-771.789) [-771.995] (-775.960) (-772.998) -- 0:00:01
981500 -- (-775.180) (-771.463) (-779.342) [-773.919] * (-772.341) (-774.825) (-775.469) [-772.957] -- 0:00:01
982000 -- (-778.973) (-771.663) [-772.131] (-773.501) * (-774.223) (-771.631) [-772.447] (-772.436) -- 0:00:01
982500 -- (-778.242) (-771.239) [-772.168] (-775.670) * [-772.230] (-771.840) (-774.476) (-773.287) -- 0:00:01
983000 -- (-771.629) (-771.495) [-775.630] (-774.868) * (-773.468) [-774.594] (-774.889) (-774.818) -- 0:00:01
983500 -- (-775.710) [-771.795] (-772.782) (-771.764) * (-775.876) (-772.357) [-772.943] (-774.835) -- 0:00:01
984000 -- (-772.379) [-773.292] (-772.731) (-771.631) * [-772.195] (-776.235) (-775.838) (-776.401) -- 0:00:00
984500 -- (-773.191) (-773.298) (-774.940) [-771.227] * [-775.388] (-775.065) (-778.573) (-773.047) -- 0:00:00
985000 -- (-774.652) (-772.706) (-771.442) [-771.877] * [-770.800] (-775.437) (-773.848) (-774.848) -- 0:00:00
Average standard deviation of split frequencies: 0.007082
985500 -- (-771.719) [-773.556] (-771.055) (-776.897) * [-772.693] (-773.440) (-777.359) (-772.613) -- 0:00:00
986000 -- (-772.989) [-771.596] (-771.009) (-778.883) * [-771.599] (-772.640) (-771.667) (-771.787) -- 0:00:00
986500 -- (-771.938) [-771.722] (-771.853) (-771.301) * (-776.229) [-772.080] (-770.713) (-771.491) -- 0:00:00
987000 -- [-773.918] (-770.754) (-773.656) (-772.880) * [-772.927] (-771.963) (-770.828) (-772.329) -- 0:00:00
987500 -- (-773.920) (-773.676) (-773.177) [-771.717] * (-773.898) (-772.559) [-773.332] (-771.856) -- 0:00:00
988000 -- (-772.621) (-775.741) (-774.638) [-771.640] * (-776.825) (-771.847) [-771.949] (-772.705) -- 0:00:00
988500 -- (-775.216) (-771.066) (-771.953) [-771.622] * (-776.076) (-773.370) (-772.577) [-776.125] -- 0:00:00
989000 -- (-773.895) (-771.189) (-772.012) [-772.623] * (-774.025) (-771.668) [-772.816] (-773.468) -- 0:00:00
989500 -- (-777.499) (-770.917) [-772.770] (-772.553) * (-772.930) [-773.357] (-771.328) (-775.255) -- 0:00:00
990000 -- [-773.778] (-770.794) (-775.179) (-774.412) * (-774.421) (-772.105) (-772.018) [-773.541] -- 0:00:00
Average standard deviation of split frequencies: 0.007286
990500 -- (-773.820) [-770.566] (-774.306) (-772.787) * (-772.892) (-771.848) [-771.981] (-773.113) -- 0:00:00
991000 -- (-774.243) (-771.669) (-773.674) [-772.183] * (-771.267) [-772.164] (-772.035) (-771.033) -- 0:00:00
991500 -- (-772.063) (-772.250) [-774.156] (-771.782) * (-773.302) (-773.361) (-772.424) [-772.176] -- 0:00:00
992000 -- (-772.064) (-776.285) (-772.700) [-771.926] * [-772.296] (-773.292) (-770.740) (-774.246) -- 0:00:00
992500 -- (-772.772) (-774.220) [-772.267] (-774.681) * (-773.336) (-773.003) [-774.442] (-771.831) -- 0:00:00
993000 -- (-774.176) (-772.488) [-771.349] (-773.866) * (-773.309) [-772.087] (-771.706) (-772.102) -- 0:00:00
993500 -- (-770.884) (-774.039) [-772.537] (-772.868) * (-774.595) (-772.796) (-773.133) [-771.054] -- 0:00:00
994000 -- (-774.705) [-773.874] (-774.454) (-773.302) * (-773.386) [-771.895] (-771.320) (-772.599) -- 0:00:00
994500 -- [-771.681] (-772.238) (-774.131) (-773.143) * (-771.030) [-771.415] (-773.512) (-773.261) -- 0:00:00
995000 -- (-773.005) (-772.396) (-772.106) [-772.230] * (-771.030) [-773.207] (-772.744) (-775.404) -- 0:00:00
Average standard deviation of split frequencies: 0.007514
995500 -- (-773.997) (-773.670) [-772.836] (-772.980) * (-773.766) (-773.516) [-772.982] (-774.462) -- 0:00:00
996000 -- (-772.919) (-773.126) [-773.331] (-773.667) * (-772.679) [-771.532] (-770.447) (-773.790) -- 0:00:00
996500 -- (-771.852) (-772.575) (-771.214) [-774.277] * [-773.024] (-772.694) (-770.444) (-777.752) -- 0:00:00
997000 -- (-774.810) [-772.735] (-770.897) (-774.788) * (-772.045) [-772.334] (-771.808) (-778.139) -- 0:00:00
997500 -- [-770.550] (-774.168) (-771.846) (-773.182) * (-773.404) (-772.174) (-774.511) [-774.840] -- 0:00:00
998000 -- (-772.294) (-776.560) [-771.640] (-775.252) * (-773.862) [-772.551] (-775.408) (-771.057) -- 0:00:00
998500 -- [-772.294] (-772.966) (-772.321) (-772.189) * (-771.733) (-772.930) [-771.504] (-773.021) -- 0:00:00
999000 -- (-773.448) (-775.939) [-771.947] (-771.900) * [-775.818] (-772.949) (-775.024) (-771.557) -- 0:00:00
999500 -- (-774.106) [-771.663] (-773.068) (-775.187) * (-773.602) [-772.429] (-773.496) (-773.187) -- 0:00:00
1000000 -- (-774.158) (-773.476) (-772.656) [-777.056] * (-772.637) [-771.029] (-772.603) (-773.106) -- 0:00:00
Average standard deviation of split frequencies: 0.007596
Analysis completed in 1 mins 1 seconds
Analysis used 59.83 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -770.30
Likelihood of best state for "cold" chain of run 2 was -770.30
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
30.0 % ( 28 %) Dirichlet(Pi{all})
31.8 % ( 25 %) Slider(Pi{all})
78.6 % ( 50 %) Multiplier(Alpha{1,2})
77.6 % ( 51 %) Multiplier(Alpha{3})
22.5 % ( 25 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.6 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 63 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.7 % ( 22 %) Dirichlet(Pi{all})
31.9 % ( 19 %) Slider(Pi{all})
78.8 % ( 53 %) Multiplier(Alpha{1,2})
78.0 % ( 54 %) Multiplier(Alpha{3})
22.2 % ( 25 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 22 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.4 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166440 0.82 0.67
3 | 166918 166333 0.84
4 | 166939 167054 166316
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166927 0.82 0.67
3 | 165997 166694 0.84
4 | 167382 165688 167312
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -772.11
| 2 1 2 |
| 2 |
| 1 2 2 |
| 21 1 1 2 1 1 2 2 |
| 22 2 1 2 2 2 222 2 1|
| 2 2 2 2 2 2 2 2 21 2 2 1 |
| 1 1 21 1 1 1 1 2|
|121 12 1 2 21 22 2 1 1 1 |
| 11 21* 1 1 2 2 2 1 |
|2 121 22 1 21 1 * 1 |
| 1 2 1 1 1 22 1 2 |
| 1 2 1 2 1 1 2 1 |
| 1 1 2 1 |
| 2 1 1 1 1 |
| 1 1 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -773.52
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -772.07 -776.85
2 -771.98 -775.03
--------------------------------------
TOTAL -772.03 -776.31
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888668 0.090100 0.317611 1.473466 0.853784 1456.07 1478.53 1.000
r(A<->C){all} 0.167957 0.019420 0.000036 0.450100 0.131533 184.38 293.45 1.000
r(A<->G){all} 0.154876 0.017861 0.000038 0.427707 0.117871 225.84 250.03 1.001
r(A<->T){all} 0.167281 0.020221 0.000005 0.451999 0.130182 217.11 288.24 1.000
r(C<->G){all} 0.163303 0.020077 0.000036 0.456347 0.124657 259.92 262.98 1.000
r(C<->T){all} 0.170107 0.020117 0.000006 0.459217 0.134360 241.46 266.79 1.003
r(G<->T){all} 0.176477 0.020387 0.000055 0.461141 0.141827 301.37 337.96 1.000
pi(A){all} 0.213873 0.000305 0.179248 0.247491 0.213323 1387.11 1421.23 1.000
pi(C){all} 0.265178 0.000345 0.228314 0.301784 0.264802 991.33 1246.16 1.000
pi(G){all} 0.310156 0.000391 0.272678 0.350496 0.309840 1333.61 1361.10 1.000
pi(T){all} 0.210792 0.000294 0.178225 0.244682 0.210259 1299.50 1360.55 1.000
alpha{1,2} 0.416892 0.231304 0.000146 1.363616 0.254704 1230.62 1355.07 1.000
alpha{3} 0.442476 0.235897 0.000236 1.446649 0.274803 1318.49 1335.55 1.000
pinvar{all} 0.997171 0.000012 0.990828 1.000000 0.998298 1352.90 1373.25 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- .**...
9 -- ...**.
10 -- ...*.*
11 -- .****.
12 -- ..**..
13 -- .***.*
14 -- ..****
15 -- .**.**
16 -- ....**
17 -- .*.***
18 -- .*...*
19 -- ..*.*.
20 -- ..*..*
21 -- .*.*..
22 -- ..**.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 474 0.157895 0.011306 0.149900 0.165889 2
8 456 0.151899 0.004711 0.148568 0.155230 2
9 452 0.150566 0.001884 0.149234 0.151899 2
10 450 0.149900 0.008480 0.143904 0.155896 2
11 441 0.146902 0.004240 0.143904 0.149900 2
12 441 0.146902 0.007066 0.141905 0.151899 2
13 433 0.144237 0.001413 0.143238 0.145237 2
14 430 0.143238 0.009422 0.136576 0.149900 2
15 420 0.139907 0.000942 0.139241 0.140573 2
16 417 0.138907 0.011777 0.130580 0.147235 2
17 416 0.138574 0.010364 0.131246 0.145903 2
18 405 0.134910 0.024968 0.117255 0.152565 2
19 403 0.134244 0.003298 0.131912 0.136576 2
20 402 0.133911 0.001884 0.132578 0.135243 2
21 393 0.130913 0.005182 0.127249 0.134577 2
22 293 0.097602 0.014604 0.087275 0.107928 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098732 0.009377 0.000069 0.286171 0.070182 1.000 2
length{all}[2] 0.101397 0.010255 0.000013 0.309156 0.070038 1.000 2
length{all}[3] 0.099161 0.009680 0.000051 0.299623 0.068418 1.000 2
length{all}[4] 0.095702 0.008779 0.000028 0.278573 0.068394 1.000 2
length{all}[5] 0.100219 0.009949 0.000014 0.296137 0.069640 1.000 2
length{all}[6] 0.098230 0.009878 0.000003 0.302930 0.066369 1.000 2
length{all}[7] 0.103393 0.010096 0.000344 0.302785 0.074664 1.003 2
length{all}[8] 0.103300 0.009834 0.000148 0.279682 0.073899 1.002 2
length{all}[9] 0.100579 0.010082 0.000019 0.309122 0.064065 0.998 2
length{all}[10] 0.096601 0.009170 0.000063 0.292064 0.066444 1.000 2
length{all}[11] 0.100484 0.008657 0.000987 0.292394 0.070935 0.998 2
length{all}[12] 0.094869 0.007888 0.000996 0.280516 0.065437 0.998 2
length{all}[13] 0.103519 0.011046 0.000085 0.308125 0.068376 0.998 2
length{all}[14] 0.093489 0.007690 0.000022 0.259426 0.064828 0.998 2
length{all}[15] 0.100171 0.009284 0.000143 0.272433 0.072071 1.001 2
length{all}[16] 0.094954 0.009056 0.000089 0.272076 0.070776 1.007 2
length{all}[17] 0.098057 0.009448 0.000538 0.281622 0.066431 0.998 2
length{all}[18] 0.094375 0.007498 0.000163 0.275210 0.066157 0.998 2
length{all}[19] 0.095312 0.011198 0.000245 0.294903 0.056117 1.001 2
length{all}[20] 0.086278 0.007503 0.000742 0.252078 0.061372 1.002 2
length{all}[21] 0.100439 0.009358 0.000482 0.279968 0.071954 1.007 2
length{all}[22] 0.102241 0.011275 0.000230 0.297233 0.070404 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007596
Maximum standard deviation of split frequencies = 0.024968
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 561
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 187 / 187 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 187 / 187 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.031425 0.103394 0.073192 0.042178 0.084259 0.031167 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -798.757100
Iterating by ming2
Initial: fx= 798.757100
x= 0.03142 0.10339 0.07319 0.04218 0.08426 0.03117 0.30000 1.30000
1 h-m-p 0.0000 0.0002 449.9797 +++ 764.501176 m 0.0002 14 | 1/8
2 h-m-p 0.0160 8.0000 26.9742 -------------.. | 1/8
3 h-m-p 0.0000 0.0000 412.7191 ++ 764.263152 m 0.0000 47 | 2/8
4 h-m-p 0.0160 8.0000 23.7479 -------------.. | 2/8
5 h-m-p 0.0000 0.0001 368.5453 ++ 756.332908 m 0.0001 80 | 3/8
6 h-m-p 0.0160 8.0000 18.8873 -------------.. | 3/8
7 h-m-p 0.0000 0.0002 319.1374 +++ 739.046999 m 0.0002 114 | 4/8
8 h-m-p 0.0160 8.0000 15.3790 -------------.. | 4/8
9 h-m-p 0.0000 0.0001 261.7627 ++ 734.896247 m 0.0001 147 | 5/8
10 h-m-p 0.0160 8.0000 11.8226 -------------.. | 5/8
11 h-m-p 0.0000 0.0001 185.1454 ++ 731.289939 m 0.0001 180 | 6/8
12 h-m-p 0.7647 8.0000 0.0000 ++ 731.289939 m 8.0000 191 | 6/8
13 h-m-p 0.1132 8.0000 0.0002 ---------------.. | 6/8
14 h-m-p 0.0160 8.0000 0.0000 +++++ 731.289939 m 8.0000 233 | 6/8
15 h-m-p 0.0160 8.0000 0.5046 +++++ 731.289887 m 8.0000 249 | 6/8
16 h-m-p 1.6000 8.0000 0.9622 ++ 731.289866 m 8.0000 262 | 6/8
17 h-m-p 1.6000 8.0000 2.4881 ++ 731.289854 m 8.0000 275 | 6/8
18 h-m-p 1.6000 8.0000 9.4484 ++ 731.289847 m 8.0000 286 | 6/8
19 h-m-p 1.6000 8.0000 7.3070 ++ 731.289846 m 8.0000 297 | 6/8
20 h-m-p 1.6000 8.0000 10.5187 ++ 731.289846 m 8.0000 308 | 6/8
21 h-m-p 1.1911 5.9553 42.0114 --------------Y 731.289846 0 0.0000 333 | 6/8
22 h-m-p 0.1985 8.0000 0.0000 --------N 731.289846 0 0.0000 352 | 6/8
23 h-m-p 0.0160 8.0000 0.0000 -----N 731.289846 0 0.0000 370
Out..
lnL = -731.289846
371 lfun, 371 eigenQcodon, 2226 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.074929 0.079597 0.104662 0.041720 0.048149 0.025513 209.070658 0.506591 0.131870
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.120115
np = 9
lnL0 = -795.943984
Iterating by ming2
Initial: fx= 795.943984
x= 0.07493 0.07960 0.10466 0.04172 0.04815 0.02551 209.07066 0.50659 0.13187
1 h-m-p 0.0000 0.0002 398.2329 ++ 770.973526 m 0.0002 14 | 1/9
2 h-m-p 0.0001 0.0006 166.6508 ++ 756.166312 m 0.0006 26 | 2/9
3 h-m-p 0.0000 0.0000 18557.0270 ++ 751.842148 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 10756.3240 ++ 751.136157 m 0.0000 50 | 4/9
5 h-m-p 0.0001 0.0014 56.0708 +++ 747.969576 m 0.0014 63 | 5/9
6 h-m-p 0.0001 0.0004 162.2511 ++ 742.571677 m 0.0004 75 | 6/9
7 h-m-p 0.0001 0.0009 511.9336 ++ 731.730117 m 0.0009 87 | 6/9
8 h-m-p 0.0406 0.2032 4.9941 --------------.. | 6/9
9 h-m-p 0.0000 0.0000 187.5165 ++ 731.289995 m 0.0000 123 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 731.289995 m 8.0000 135 | 6/9
11 h-m-p 0.0001 0.0116 0.0004 ++++ 731.289995 m 0.0116 151 | 6/9
12 h-m-p 0.0000 0.0000 0.0106
h-m-p: 0.00000000e+00 0.00000000e+00 1.06249225e-02 731.289995
.. | 6/9
13 h-m-p 0.0160 8.0000 0.0005 +++++ 731.289992 m 8.0000 181 | 6/9
14 h-m-p 0.0345 8.0000 0.1249 ++++ 731.289890 m 8.0000 198 | 6/9
15 h-m-p 1.6000 8.0000 0.0277 ++ 731.289888 m 8.0000 213 | 6/9
16 h-m-p 0.2376 1.1878 0.1589 ++ 731.289887 m 1.1878 228 | 7/9
17 h-m-p 1.6000 8.0000 0.0000 +Y 731.289887 0 6.4000 244 | 7/9
18 h-m-p 1.6000 8.0000 0.0001 --Y 731.289887 0 0.0250 260 | 7/9
19 h-m-p 0.5001 8.0000 0.0000 --------Y 731.289887 0 0.0000 282
Out..
lnL = -731.289887
283 lfun, 849 eigenQcodon, 3396 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.061308 0.024994 0.024692 0.043556 0.056685 0.015350 209.070688 1.102151 0.218887 0.417264 158.227529
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.003690
np = 11
lnL0 = -755.643870
Iterating by ming2
Initial: fx= 755.643870
x= 0.06131 0.02499 0.02469 0.04356 0.05669 0.01535 209.07069 1.10215 0.21889 0.41726 158.22753
1 h-m-p 0.0000 0.0002 150.1660 +++ 749.171776 m 0.0002 17 | 1/11
2 h-m-p 0.0022 0.0341 14.5424 ++ 742.251433 m 0.0341 31 | 2/11
3 h-m-p 0.0000 0.0000 22911.6880 ++ 741.955212 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0002 454.0499 ++ 740.482379 m 0.0002 59 | 4/11
5 h-m-p 0.0011 0.0066 86.0531 ++ 732.319111 m 0.0066 73 | 5/11
6 h-m-p 0.0000 0.0001 3930.5606 ++ 731.289850 m 0.0001 87 | 6/11
7 h-m-p 1.6000 8.0000 0.0000 ++ 731.289850 m 8.0000 101 | 6/11
8 h-m-p 0.0552 8.0000 0.0027 ++++ 731.289850 m 8.0000 122 | 6/11
9 h-m-p 0.0171 8.0000 1.2531 +++++ 731.289846 m 8.0000 144 | 6/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 731.289846 m 8.0000 158 | 6/11
11 h-m-p 0.9974 8.0000 0.0002 ------Y 731.289846 0 0.0001 183
Out..
lnL = -731.289846
184 lfun, 736 eigenQcodon, 3312 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -731.285563 S = -731.285492 -0.000027
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:02
did 20 / 54 patterns 0:02
did 30 / 54 patterns 0:02
did 40 / 54 patterns 0:02
did 50 / 54 patterns 0:02
did 54 / 54 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.056017 0.039215 0.081846 0.047193 0.098342 0.088809 209.072010 0.474892 1.486538
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.181049
np = 9
lnL0 = -803.214674
Iterating by ming2
Initial: fx= 803.214674
x= 0.05602 0.03922 0.08185 0.04719 0.09834 0.08881 209.07201 0.47489 1.48654
1 h-m-p 0.0000 0.0002 405.5363 +++ 763.892726 m 0.0002 15 | 1/9
2 h-m-p 0.0047 0.0312 18.3439 ------------.. | 1/9
3 h-m-p 0.0000 0.0000 392.5942 ++ 756.787279 m 0.0000 49 | 2/9
4 h-m-p 0.0018 0.0714 8.9799 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 353.6356 ++ 750.408544 m 0.0001 83 | 3/9
6 h-m-p 0.0024 0.0982 6.4580 ------------.. | 3/9
7 h-m-p 0.0000 0.0002 308.0461 ++ 735.889134 m 0.0002 117 | 4/9
8 h-m-p 0.0133 0.5505 2.8400 -------------.. | 4/9
9 h-m-p 0.0000 0.0000 259.2170 ++ 733.174497 m 0.0000 152 | 5/9
10 h-m-p 0.0024 1.0362 3.0020 ------------.. | 5/9
11 h-m-p 0.0000 0.0001 184.0623 ++ 731.289938 m 0.0001 186 | 6/9
12 h-m-p 0.2778 8.0000 0.0000 +++ 731.289938 m 8.0000 199 | 6/9
13 h-m-p 0.1320 8.0000 0.0002 +++ 731.289938 m 8.0000 215 | 6/9
14 h-m-p 0.0160 8.0000 0.8024 +++++ 731.289933 m 8.0000 233 | 6/9
15 h-m-p 1.6000 8.0000 0.2659 ++ 731.289933 m 8.0000 248 | 6/9
16 h-m-p 0.6000 8.0000 3.5455 ++ 731.289933 m 8.0000 263 | 6/9
17 h-m-p 1.2554 6.2769 6.0869 ---------C 731.289933 0 0.0000 284 | 6/9
18 h-m-p 0.6425 8.0000 0.0000 ---------------Y 731.289933 0 0.0000 311 | 6/9
19 h-m-p 0.0160 8.0000 0.0000 ------------Y 731.289933 0 0.0000 338
Out..
lnL = -731.289933
339 lfun, 3729 eigenQcodon, 20340 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.081275 0.024826 0.028277 0.070555 0.103147 0.101835 209.078676 0.900000 0.607902 1.362847 138.525441
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.007872
np = 11
lnL0 = -752.427474
Iterating by ming2
Initial: fx= 752.427474
x= 0.08128 0.02483 0.02828 0.07056 0.10315 0.10183 209.07868 0.90000 0.60790 1.36285 138.52544
1 h-m-p 0.0000 0.0008 127.8028 +++YYCYCCC 745.989577 6 0.0005 28 | 0/11
2 h-m-p 0.0001 0.0005 68.8194 ++ 743.835946 m 0.0005 42 | 1/11
3 h-m-p 0.0032 0.0285 10.1811 ++ 740.150359 m 0.0285 56 | 2/11
4 h-m-p 0.0017 0.0086 22.8136 ++ 735.734285 m 0.0086 70 | 3/11
5 h-m-p 0.0003 0.0015 21.9073 ++ 733.937317 m 0.0015 84 | 4/11
6 h-m-p 0.0002 0.0008 34.4142 ++ 732.821710 m 0.0008 98 | 5/11
7 h-m-p 0.0025 0.0219 8.4101 ++ 731.289860 m 0.0219 112 | 6/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 731.289860 m 8.0000 126 | 6/11
9 h-m-p 0.0160 8.0000 0.0133 +++++ 731.289856 m 8.0000 148 | 6/11
10 h-m-p 0.8116 8.0000 0.1314 ++ 731.289848 m 8.0000 167 | 6/11
11 h-m-p 1.6000 8.0000 0.0919 ++ 731.289847 m 8.0000 186 | 6/11
12 h-m-p 0.7620 3.8099 0.5928 +
QuantileBeta(0.85, 4.22557, 0.00500) = 1.000000e+00 2000 rounds
+ 731.289846 m 3.8099 205
QuantileBeta(0.85, 4.22557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.22557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.22557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.22557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.22557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.22557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.22557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.22557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.22557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.22557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.22574, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.22540, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.22557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.22557, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
13 h-m-p 1.6000 8.0000 0.6882
QuantileBeta(0.85, 5.32295, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.61509, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 9.71247, 0.00500) = 1.000000e+00 2000 rounds
+ 731.289846 m 8.0000 224
QuantileBeta(0.85, 9.71247, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.71247, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.71247, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.71247, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.71247, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.71247, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.71247, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.71247, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.71247, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.71247, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.71275, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.71220, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.71247, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.71247, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.71247, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
14 h-m-p 0.3680 1.8398 1.2902
QuantileBeta(0.85, 10.18557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.60486, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
+ 731.289846 m 1.8398 242
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07796, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
15 h-m-p 1.6000 8.0000 0.7546
QuantileBeta(0.85, 10.87486, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.77718, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.00276, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.05916, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07326, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07678, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07766, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07788, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07794, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
C 731.289846 0 0.0000 266
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07827, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07764, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
16 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
N 731.289846 0 0.0000 292
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -731.289846
293 lfun, 3516 eigenQcodon, 19338 P(t)
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -731.285594 S = -731.285493 -0.000044
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:13
did 20 / 54 patterns 0:13
did 30 / 54 patterns 0:13
did 40 / 54 patterns 0:13
did 50 / 54 patterns 0:13
did 54 / 54 patterns 0:14
QuantileBeta(0.85, 12.07795, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=187
NC_011896_1_WP_010907771_1_539_MLBR_RS02555 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
NC_002677_1_NP_301447_1_319_efp VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
NZ_LVXE01000008_1_WP_010907771_1_2743_A3216_RS04510 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
NZ_LYPH01000055_1_WP_010907771_1_2070_A8144_RS09915 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
NZ_CP029543_1_WP_010907771_1_553_efp VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
NZ_AP014567_1_WP_010907771_1_571_efp VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV
**************************************************
NC_011896_1_WP_010907771_1_539_MLBR_RS02555 DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
NC_002677_1_NP_301447_1_319_efp DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
NZ_LVXE01000008_1_WP_010907771_1_2743_A3216_RS04510 DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
NZ_LYPH01000055_1_WP_010907771_1_2070_A8144_RS09915 DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
NZ_CP029543_1_WP_010907771_1_553_efp DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
NZ_AP014567_1_WP_010907771_1_571_efp DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD
**************************************************
NC_011896_1_WP_010907771_1_539_MLBR_RS02555 TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
NC_002677_1_NP_301447_1_319_efp TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
NZ_LVXE01000008_1_WP_010907771_1_2743_A3216_RS04510 TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
NZ_LYPH01000055_1_WP_010907771_1_2070_A8144_RS09915 TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
NZ_CP029543_1_WP_010907771_1_553_efp TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
NZ_AP014567_1_WP_010907771_1_571_efp TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK
**************************************************
NC_011896_1_WP_010907771_1_539_MLBR_RS02555 PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
NC_002677_1_NP_301447_1_319_efp PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
NZ_LVXE01000008_1_WP_010907771_1_2743_A3216_RS04510 PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
NZ_LYPH01000055_1_WP_010907771_1_2070_A8144_RS09915 PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
NZ_CP029543_1_WP_010907771_1_553_efp PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
NZ_AP014567_1_WP_010907771_1_571_efp PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
*************************************
>NC_011896_1_WP_010907771_1_539_MLBR_RS02555 GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC GTGTGAACGTC >NC_002677_1_NP_301447_1_319_efp GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC GTGTGAACGTC >NZ_LVXE01000008_1_WP_010907771_1_2743_A3216_RS04510 GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC GTGTGAACGTC >NZ_LYPH01000055_1_WP_010907771_1_2070_A8144_RS09915 GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC GTGTGAACGTC >NZ_CP029543_1_WP_010907771_1_553_efp GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC GTGTGAACGTC >NZ_AP014567_1_WP_010907771_1_571_efp GTGGCGACCACTGCCGACTTCAAGAATGGGCTTGTGCTGGTAATCGATGG ACAGCTTTGGACAATCATCGGGTTCCAGCACGTCAAACCTGGCAAAGGCC CGGCCTTCGTGCGTACTAAGCTTAAAAATGTCCTGTCCGGCAAGGTCGTC GACAAGACGTATAACGCTGGGGTGAAGGTGGATACGGCCACCGTTGACCG GCGTGACACGACCTATCTGTACCGCGATGGTGCTAACTTTGTGTTCATGG ACAGCCAAGACTACGAGCAGCATCCGCTGCCGGAGTCTCTGGTTGGCGAT ACTGCCCGGTTTCTGTTGGAGGGCATGTCGGTGCAGGTGGCGTTCCACAA CGGTGTGCCATTGTACGTCGAGCTGCCGGTGACCGTCGAACTAGAGGTCA CGCACACCGAGCCGGGATTGCAGGGTGACCGGTCCAGTGCCGGAACCAAG CCGGCAACTTTGGAGACCGGCGCTCAGATAAATGTTCCGCTGTTCATTAA TACCGGCGACAAGCTCAAGGTGGATTCACGCGACGGCAGCTACCTGGGAC GTGTGAACGTC
>NC_011896_1_WP_010907771_1_539_MLBR_RS02555 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV >NC_002677_1_NP_301447_1_319_efp VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV >NZ_LVXE01000008_1_WP_010907771_1_2743_A3216_RS04510 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV >NZ_LYPH01000055_1_WP_010907771_1_2070_A8144_RS09915 VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV >NZ_CP029543_1_WP_010907771_1_553_efp VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV >NZ_AP014567_1_WP_010907771_1_571_efp VATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVV DKTYNAGVKVDTATVDRRDTTYLYRDGANFVFMDSQDYEQHPLPESLVGD TARFLLEGMSVQVAFHNGVPLYVELPVTVELEVTHTEPGLQGDRSSAGTK PATLETGAQINVPLFINTGDKLKVDSRDGSYLGRVNV
#NEXUS
[ID: 9508928428]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907771_1_539_MLBR_RS02555
NC_002677_1_NP_301447_1_319_efp
NZ_LVXE01000008_1_WP_010907771_1_2743_A3216_RS04510
NZ_LYPH01000055_1_WP_010907771_1_2070_A8144_RS09915
NZ_CP029543_1_WP_010907771_1_553_efp
NZ_AP014567_1_WP_010907771_1_571_efp
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907771_1_539_MLBR_RS02555,
2 NC_002677_1_NP_301447_1_319_efp,
3 NZ_LVXE01000008_1_WP_010907771_1_2743_A3216_RS04510,
4 NZ_LYPH01000055_1_WP_010907771_1_2070_A8144_RS09915,
5 NZ_CP029543_1_WP_010907771_1_553_efp,
6 NZ_AP014567_1_WP_010907771_1_571_efp
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07018172,2:0.07003808,3:0.06841848,4:0.06839352,5:0.06964031,6:0.06636871);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07018172,2:0.07003808,3:0.06841848,4:0.06839352,5:0.06964031,6:0.06636871);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -772.07 -776.85
2 -771.98 -775.03
--------------------------------------
TOTAL -772.03 -776.31
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/efp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888668 0.090100 0.317611 1.473466 0.853784 1456.07 1478.53 1.000
r(A<->C){all} 0.167957 0.019420 0.000036 0.450100 0.131533 184.38 293.45 1.000
r(A<->G){all} 0.154876 0.017861 0.000038 0.427707 0.117871 225.84 250.03 1.001
r(A<->T){all} 0.167281 0.020221 0.000005 0.451999 0.130182 217.11 288.24 1.000
r(C<->G){all} 0.163303 0.020077 0.000036 0.456347 0.124657 259.92 262.98 1.000
r(C<->T){all} 0.170107 0.020117 0.000006 0.459217 0.134360 241.46 266.79 1.003
r(G<->T){all} 0.176477 0.020387 0.000055 0.461141 0.141827 301.37 337.96 1.000
pi(A){all} 0.213873 0.000305 0.179248 0.247491 0.213323 1387.11 1421.23 1.000
pi(C){all} 0.265178 0.000345 0.228314 0.301784 0.264802 991.33 1246.16 1.000
pi(G){all} 0.310156 0.000391 0.272678 0.350496 0.309840 1333.61 1361.10 1.000
pi(T){all} 0.210792 0.000294 0.178225 0.244682 0.210259 1299.50 1360.55 1.000
alpha{1,2} 0.416892 0.231304 0.000146 1.363616 0.254704 1230.62 1355.07 1.000
alpha{3} 0.442476 0.235897 0.000236 1.446649 0.274803 1318.49 1335.55 1.000
pinvar{all} 0.997171 0.000012 0.990828 1.000000 0.998298 1352.90 1373.25 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/efp/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 187
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 6 6 6 6 6 6 | TCC 2 2 2 2 2 2 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 3 3 3 3 3 3 | CGC 2 2 2 2 2 2
CTA 1 1 1 1 1 1 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 9 9 9 9 9 9 | CCG 7 7 7 7 7 7 | CAG 6 6 6 6 6 6 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 4 4 4 4 4 4 | Asn AAT 4 4 4 4 4 4 | Ser AGT 1 1 1 1 1 1
ATC 3 3 3 3 3 3 | ACC 8 8 8 8 8 8 | AAC 4 4 4 4 4 4 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 4 4 4 4 4 4 | AAG 8 8 8 8 8 8 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 3 3 3 3 3 3 | Asp GAT 5 5 5 5 5 5 | Gly GGT 3 3 3 3 3 3
GTC 8 8 8 8 8 8 | GCC 5 5 5 5 5 5 | GAC 9 9 9 9 9 9 | GGC 8 8 8 8 8 8
GTA 1 1 1 1 1 1 | GCA 1 1 1 1 1 1 | Glu GAA 1 1 1 1 1 1 | GGA 4 4 4 4 4 4
GTG 12 12 12 12 12 12 | GCG 2 2 2 2 2 2 | GAG 7 7 7 7 7 7 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907771_1_539_MLBR_RS02555
position 1: T:0.12834 C:0.22460 A:0.24599 G:0.40107
position 2: T:0.30481 C:0.22460 A:0.31016 G:0.16043
position 3: T:0.19786 C:0.34759 A:0.08556 G:0.36898
Average T:0.21034 C:0.26560 A:0.21390 G:0.31016
#2: NC_002677_1_NP_301447_1_319_efp
position 1: T:0.12834 C:0.22460 A:0.24599 G:0.40107
position 2: T:0.30481 C:0.22460 A:0.31016 G:0.16043
position 3: T:0.19786 C:0.34759 A:0.08556 G:0.36898
Average T:0.21034 C:0.26560 A:0.21390 G:0.31016
#3: NZ_LVXE01000008_1_WP_010907771_1_2743_A3216_RS04510
position 1: T:0.12834 C:0.22460 A:0.24599 G:0.40107
position 2: T:0.30481 C:0.22460 A:0.31016 G:0.16043
position 3: T:0.19786 C:0.34759 A:0.08556 G:0.36898
Average T:0.21034 C:0.26560 A:0.21390 G:0.31016
#4: NZ_LYPH01000055_1_WP_010907771_1_2070_A8144_RS09915
position 1: T:0.12834 C:0.22460 A:0.24599 G:0.40107
position 2: T:0.30481 C:0.22460 A:0.31016 G:0.16043
position 3: T:0.19786 C:0.34759 A:0.08556 G:0.36898
Average T:0.21034 C:0.26560 A:0.21390 G:0.31016
#5: NZ_CP029543_1_WP_010907771_1_553_efp
position 1: T:0.12834 C:0.22460 A:0.24599 G:0.40107
position 2: T:0.30481 C:0.22460 A:0.31016 G:0.16043
position 3: T:0.19786 C:0.34759 A:0.08556 G:0.36898
Average T:0.21034 C:0.26560 A:0.21390 G:0.31016
#6: NZ_AP014567_1_WP_010907771_1_571_efp
position 1: T:0.12834 C:0.22460 A:0.24599 G:0.40107
position 2: T:0.30481 C:0.22460 A:0.31016 G:0.16043
position 3: T:0.19786 C:0.34759 A:0.08556 G:0.36898
Average T:0.21034 C:0.26560 A:0.21390 G:0.31016
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 12 | Cys C TGT 0
TTC 36 | TCC 12 | TAC 24 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 6 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 18
CTC 6 | CCC 0 | CAC 18 | CGC 12
CTA 6 | CCA 6 | Gln Q CAA 6 | CGA 0
CTG 54 | CCG 42 | CAG 36 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 24 | Asn N AAT 24 | Ser S AGT 6
ATC 18 | ACC 48 | AAC 24 | AGC 12
ATA 6 | ACA 6 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 12 | ACG 24 | AAG 48 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 18 | Asp D GAT 30 | Gly G GGT 18
GTC 48 | GCC 30 | GAC 54 | GGC 48
GTA 6 | GCA 6 | Glu E GAA 6 | GGA 24
GTG 72 | GCG 12 | GAG 42 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12834 C:0.22460 A:0.24599 G:0.40107
position 2: T:0.30481 C:0.22460 A:0.31016 G:0.16043
position 3: T:0.19786 C:0.34759 A:0.08556 G:0.36898
Average T:0.21034 C:0.26560 A:0.21390 G:0.31016
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -731.289846 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 209.070658 138.525441
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907771_1_539_MLBR_RS02555: 0.000004, NC_002677_1_NP_301447_1_319_efp: 0.000004, NZ_LVXE01000008_1_WP_010907771_1_2743_A3216_RS04510: 0.000004, NZ_LYPH01000055_1_WP_010907771_1_2070_A8144_RS09915: 0.000004, NZ_CP029543_1_WP_010907771_1_553_efp: 0.000004, NZ_AP014567_1_WP_010907771_1_571_efp: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 209.07066
omega (dN/dS) = 138.52544
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 403.2 157.8 138.5254 0.0000 0.0000 0.0 0.0
7..2 0.000 403.2 157.8 138.5254 0.0000 0.0000 0.0 0.0
7..3 0.000 403.2 157.8 138.5254 0.0000 0.0000 0.0 0.0
7..4 0.000 403.2 157.8 138.5254 0.0000 0.0000 0.0 0.0
7..5 0.000 403.2 157.8 138.5254 0.0000 0.0000 0.0 0.0
7..6 0.000 403.2 157.8 138.5254 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -731.289887 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 209.070688 0.000010 0.999063
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907771_1_539_MLBR_RS02555: 0.000004, NC_002677_1_NP_301447_1_319_efp: 0.000004, NZ_LVXE01000008_1_WP_010907771_1_2743_A3216_RS04510: 0.000004, NZ_LYPH01000055_1_WP_010907771_1_2070_A8144_RS09915: 0.000004, NZ_CP029543_1_WP_010907771_1_553_efp: 0.000004, NZ_AP014567_1_WP_010907771_1_571_efp: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 209.07069
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.99906 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 403.2 157.8 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 403.2 157.8 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 403.2 157.8 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 403.2 157.8 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 403.2 157.8 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 403.2 157.8 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -731.289846 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 209.072010 0.001007 0.046899 0.963649 158.235989
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907771_1_539_MLBR_RS02555: 0.000004, NC_002677_1_NP_301447_1_319_efp: 0.000004, NZ_LVXE01000008_1_WP_010907771_1_2743_A3216_RS04510: 0.000004, NZ_LYPH01000055_1_WP_010907771_1_2070_A8144_RS09915: 0.000004, NZ_CP029543_1_WP_010907771_1_553_efp: 0.000004, NZ_AP014567_1_WP_010907771_1_571_efp: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 209.07201
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00101 0.04690 0.95209
w: 0.96365 1.00000 158.23599
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 403.2 157.8 150.7034 0.0000 0.0000 0.0 0.0
7..2 0.000 403.2 157.8 150.7034 0.0000 0.0000 0.0 0.0
7..3 0.000 403.2 157.8 150.7034 0.0000 0.0000 0.0 0.0
7..4 0.000 403.2 157.8 150.7034 0.0000 0.0000 0.0 0.0
7..5 0.000 403.2 157.8 150.7034 0.0000 0.0000 0.0 0.0
7..6 0.000 403.2 157.8 150.7034 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907771_1_539_MLBR_RS02555)
Pr(w>1) post mean +- SE for w
1 V 0.952* 150.703
2 A 0.952* 150.703
3 T 0.952* 150.703
4 T 0.952* 150.703
5 A 0.952* 150.703
6 D 0.952* 150.703
7 F 0.952* 150.703
8 K 0.952* 150.703
9 N 0.952* 150.703
10 G 0.952* 150.703
11 L 0.952* 150.703
12 V 0.952* 150.703
13 L 0.952* 150.703
14 V 0.952* 150.703
15 I 0.952* 150.703
16 D 0.952* 150.703
17 G 0.952* 150.703
18 Q 0.952* 150.703
19 L 0.952* 150.703
20 W 0.952* 150.703
21 T 0.952* 150.703
22 I 0.952* 150.703
23 I 0.952* 150.703
24 G 0.952* 150.703
25 F 0.952* 150.703
26 Q 0.952* 150.703
27 H 0.952* 150.703
28 V 0.952* 150.703
29 K 0.952* 150.703
30 P 0.952* 150.703
31 G 0.952* 150.703
32 K 0.952* 150.703
33 G 0.952* 150.703
34 P 0.952* 150.703
35 A 0.952* 150.703
36 F 0.952* 150.703
37 V 0.952* 150.703
38 R 0.952* 150.703
39 T 0.952* 150.703
40 K 0.952* 150.703
41 L 0.952* 150.703
42 K 0.952* 150.703
43 N 0.952* 150.703
44 V 0.952* 150.703
45 L 0.952* 150.703
46 S 0.952* 150.703
47 G 0.952* 150.703
48 K 0.952* 150.703
49 V 0.952* 150.703
50 V 0.952* 150.703
51 D 0.952* 150.703
52 K 0.952* 150.703
53 T 0.952* 150.703
54 Y 0.952* 150.703
55 N 0.952* 150.703
56 A 0.952* 150.703
57 G 0.952* 150.703
58 V 0.952* 150.703
59 K 0.952* 150.703
60 V 0.952* 150.703
61 D 0.952* 150.703
62 T 0.952* 150.703
63 A 0.952* 150.703
64 T 0.952* 150.703
65 V 0.952* 150.703
66 D 0.952* 150.703
67 R 0.952* 150.703
68 R 0.952* 150.703
69 D 0.952* 150.703
70 T 0.952* 150.703
71 T 0.952* 150.703
72 Y 0.952* 150.703
73 L 0.952* 150.703
74 Y 0.952* 150.703
75 R 0.952* 150.703
76 D 0.952* 150.703
77 G 0.952* 150.703
78 A 0.952* 150.703
79 N 0.952* 150.703
80 F 0.952* 150.703
81 V 0.952* 150.703
82 F 0.952* 150.703
83 M 0.952* 150.703
84 D 0.952* 150.703
85 S 0.952* 150.703
86 Q 0.952* 150.703
87 D 0.952* 150.703
88 Y 0.952* 150.703
89 E 0.952* 150.703
90 Q 0.952* 150.703
91 H 0.952* 150.703
92 P 0.952* 150.703
93 L 0.952* 150.703
94 P 0.952* 150.703
95 E 0.952* 150.703
96 S 0.952* 150.703
97 L 0.952* 150.703
98 V 0.952* 150.703
99 G 0.952* 150.703
100 D 0.952* 150.703
101 T 0.952* 150.703
102 A 0.952* 150.703
103 R 0.952* 150.703
104 F 0.952* 150.703
105 L 0.952* 150.703
106 L 0.952* 150.703
107 E 0.952* 150.703
108 G 0.952* 150.703
109 M 0.952* 150.703
110 S 0.952* 150.703
111 V 0.952* 150.703
112 Q 0.952* 150.703
113 V 0.952* 150.703
114 A 0.952* 150.703
115 F 0.952* 150.703
116 H 0.952* 150.703
117 N 0.952* 150.703
118 G 0.952* 150.703
119 V 0.952* 150.703
120 P 0.952* 150.703
121 L 0.952* 150.703
122 Y 0.952* 150.703
123 V 0.952* 150.703
124 E 0.952* 150.703
125 L 0.952* 150.703
126 P 0.952* 150.703
127 V 0.952* 150.703
128 T 0.952* 150.703
129 V 0.952* 150.703
130 E 0.952* 150.703
131 L 0.952* 150.703
132 E 0.952* 150.703
133 V 0.952* 150.703
134 T 0.952* 150.703
135 H 0.952* 150.703
136 T 0.952* 150.703
137 E 0.952* 150.703
138 P 0.952* 150.703
139 G 0.952* 150.703
140 L 0.952* 150.703
141 Q 0.952* 150.703
142 G 0.952* 150.703
143 D 0.952* 150.703
144 R 0.952* 150.703
145 S 0.952* 150.703
146 S 0.952* 150.703
147 A 0.952* 150.703
148 G 0.952* 150.703
149 T 0.952* 150.703
150 K 0.952* 150.703
151 P 0.952* 150.703
152 A 0.952* 150.703
153 T 0.952* 150.703
154 L 0.952* 150.703
155 E 0.952* 150.703
156 T 0.952* 150.703
157 G 0.952* 150.703
158 A 0.952* 150.703
159 Q 0.952* 150.703
160 I 0.952* 150.703
161 N 0.952* 150.703
162 V 0.952* 150.703
163 P 0.952* 150.703
164 L 0.952* 150.703
165 F 0.952* 150.703
166 I 0.952* 150.703
167 N 0.952* 150.703
168 T 0.952* 150.703
169 G 0.952* 150.703
170 D 0.952* 150.703
171 K 0.952* 150.703
172 L 0.952* 150.703
173 K 0.952* 150.703
174 V 0.952* 150.703
175 D 0.952* 150.703
176 S 0.952* 150.703
177 R 0.952* 150.703
178 D 0.952* 150.703
179 G 0.952* 150.703
180 S 0.952* 150.703
181 Y 0.952* 150.703
182 L 0.952* 150.703
183 G 0.952* 150.703
184 R 0.952* 150.703
185 V 0.952* 150.703
186 N 0.952* 150.703
187 V 0.952* 150.703
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907771_1_539_MLBR_RS02555)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -731.289933 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 209.078676 13.868022 35.883276
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907771_1_539_MLBR_RS02555: 0.000004, NC_002677_1_NP_301447_1_319_efp: 0.000004, NZ_LVXE01000008_1_WP_010907771_1_2743_A3216_RS04510: 0.000004, NZ_LYPH01000055_1_WP_010907771_1_2070_A8144_RS09915: 0.000004, NZ_CP029543_1_WP_010907771_1_553_efp: 0.000004, NZ_AP014567_1_WP_010907771_1_571_efp: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 209.07868
Parameters in M7 (beta):
p = 13.86802 q = 35.88328
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.18043 0.21337 0.23430 0.25171 0.26781 0.28381 0.30072 0.31998 0.34465 0.38727
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 403.2 157.8 0.2784 0.0000 0.0000 0.0 0.0
7..2 0.000 403.2 157.8 0.2784 0.0000 0.0000 0.0 0.0
7..3 0.000 403.2 157.8 0.2784 0.0000 0.0000 0.0 0.0
7..4 0.000 403.2 157.8 0.2784 0.0000 0.0000 0.0 0.0
7..5 0.000 403.2 157.8 0.2784 0.0000 0.0000 0.0 0.0
7..6 0.000 403.2 157.8 0.2784 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -731.289846 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 209.085632 0.000010 12.077954 0.005000 138.512520
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907771_1_539_MLBR_RS02555: 0.000004, NC_002677_1_NP_301447_1_319_efp: 0.000004, NZ_LVXE01000008_1_WP_010907771_1_2743_A3216_RS04510: 0.000004, NZ_LYPH01000055_1_WP_010907771_1_2070_A8144_RS09915: 0.000004, NZ_CP029543_1_WP_010907771_1_553_efp: 0.000004, NZ_AP014567_1_WP_010907771_1_571_efp: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 209.08563
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 12.07795 q = 0.00500
(p1 = 0.99999) w = 138.51252
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 138.51252
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 403.2 157.8 138.5111 0.0000 0.0000 0.0 0.0
7..2 0.000 403.2 157.8 138.5111 0.0000 0.0000 0.0 0.0
7..3 0.000 403.2 157.8 138.5111 0.0000 0.0000 0.0 0.0
7..4 0.000 403.2 157.8 138.5111 0.0000 0.0000 0.0 0.0
7..5 0.000 403.2 157.8 138.5111 0.0000 0.0000 0.0 0.0
7..6 0.000 403.2 157.8 138.5111 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907771_1_539_MLBR_RS02555)
Pr(w>1) post mean +- SE for w
1 V 1.000** 138.511
2 A 1.000** 138.511
3 T 1.000** 138.511
4 T 1.000** 138.511
5 A 1.000** 138.511
6 D 1.000** 138.511
7 F 1.000** 138.511
8 K 1.000** 138.511
9 N 1.000** 138.511
10 G 1.000** 138.511
11 L 1.000** 138.511
12 V 1.000** 138.511
13 L 1.000** 138.511
14 V 1.000** 138.511
15 I 1.000** 138.511
16 D 1.000** 138.511
17 G 1.000** 138.511
18 Q 1.000** 138.511
19 L 1.000** 138.511
20 W 1.000** 138.511
21 T 1.000** 138.511
22 I 1.000** 138.511
23 I 1.000** 138.511
24 G 1.000** 138.511
25 F 1.000** 138.511
26 Q 1.000** 138.511
27 H 1.000** 138.511
28 V 1.000** 138.511
29 K 1.000** 138.511
30 P 1.000** 138.511
31 G 1.000** 138.511
32 K 1.000** 138.511
33 G 1.000** 138.511
34 P 1.000** 138.511
35 A 1.000** 138.511
36 F 1.000** 138.511
37 V 1.000** 138.511
38 R 1.000** 138.511
39 T 1.000** 138.511
40 K 1.000** 138.511
41 L 1.000** 138.511
42 K 1.000** 138.511
43 N 1.000** 138.511
44 V 1.000** 138.511
45 L 1.000** 138.511
46 S 1.000** 138.511
47 G 1.000** 138.511
48 K 1.000** 138.511
49 V 1.000** 138.511
50 V 1.000** 138.511
51 D 1.000** 138.511
52 K 1.000** 138.511
53 T 1.000** 138.511
54 Y 1.000** 138.511
55 N 1.000** 138.511
56 A 1.000** 138.511
57 G 1.000** 138.511
58 V 1.000** 138.511
59 K 1.000** 138.511
60 V 1.000** 138.511
61 D 1.000** 138.511
62 T 1.000** 138.511
63 A 1.000** 138.511
64 T 1.000** 138.511
65 V 1.000** 138.511
66 D 1.000** 138.511
67 R 1.000** 138.511
68 R 1.000** 138.511
69 D 1.000** 138.511
70 T 1.000** 138.511
71 T 1.000** 138.511
72 Y 1.000** 138.511
73 L 1.000** 138.511
74 Y 1.000** 138.511
75 R 1.000** 138.511
76 D 1.000** 138.511
77 G 1.000** 138.511
78 A 1.000** 138.511
79 N 1.000** 138.511
80 F 1.000** 138.511
81 V 1.000** 138.511
82 F 1.000** 138.511
83 M 1.000** 138.511
84 D 1.000** 138.511
85 S 1.000** 138.511
86 Q 1.000** 138.511
87 D 1.000** 138.511
88 Y 1.000** 138.511
89 E 1.000** 138.511
90 Q 1.000** 138.511
91 H 1.000** 138.511
92 P 1.000** 138.511
93 L 1.000** 138.511
94 P 1.000** 138.511
95 E 1.000** 138.511
96 S 1.000** 138.511
97 L 1.000** 138.511
98 V 1.000** 138.511
99 G 1.000** 138.511
100 D 1.000** 138.511
101 T 1.000** 138.511
102 A 1.000** 138.511
103 R 1.000** 138.511
104 F 1.000** 138.511
105 L 1.000** 138.511
106 L 1.000** 138.511
107 E 1.000** 138.511
108 G 1.000** 138.511
109 M 1.000** 138.511
110 S 1.000** 138.511
111 V 1.000** 138.511
112 Q 1.000** 138.511
113 V 1.000** 138.511
114 A 1.000** 138.511
115 F 1.000** 138.511
116 H 1.000** 138.511
117 N 1.000** 138.511
118 G 1.000** 138.511
119 V 1.000** 138.511
120 P 1.000** 138.511
121 L 1.000** 138.511
122 Y 1.000** 138.511
123 V 1.000** 138.511
124 E 1.000** 138.511
125 L 1.000** 138.511
126 P 1.000** 138.511
127 V 1.000** 138.511
128 T 1.000** 138.511
129 V 1.000** 138.511
130 E 1.000** 138.511
131 L 1.000** 138.511
132 E 1.000** 138.511
133 V 1.000** 138.511
134 T 1.000** 138.511
135 H 1.000** 138.511
136 T 1.000** 138.511
137 E 1.000** 138.511
138 P 1.000** 138.511
139 G 1.000** 138.511
140 L 1.000** 138.511
141 Q 1.000** 138.511
142 G 1.000** 138.511
143 D 1.000** 138.511
144 R 1.000** 138.511
145 S 1.000** 138.511
146 S 1.000** 138.511
147 A 1.000** 138.511
148 G 1.000** 138.511
149 T 1.000** 138.511
150 K 1.000** 138.511
151 P 1.000** 138.511
152 A 1.000** 138.511
153 T 1.000** 138.511
154 L 1.000** 138.511
155 E 1.000** 138.511
156 T 1.000** 138.511
157 G 1.000** 138.511
158 A 1.000** 138.511
159 Q 1.000** 138.511
160 I 1.000** 138.511
161 N 1.000** 138.511
162 V 1.000** 138.511
163 P 1.000** 138.511
164 L 1.000** 138.511
165 F 1.000** 138.511
166 I 1.000** 138.511
167 N 1.000** 138.511
168 T 1.000** 138.511
169 G 1.000** 138.511
170 D 1.000** 138.511
171 K 1.000** 138.511
172 L 1.000** 138.511
173 K 1.000** 138.511
174 V 1.000** 138.511
175 D 1.000** 138.511
176 S 1.000** 138.511
177 R 1.000** 138.511
178 D 1.000** 138.511
179 G 1.000** 138.511
180 S 1.000** 138.511
181 Y 1.000** 138.511
182 L 1.000** 138.511
183 G 1.000** 138.511
184 R 1.000** 138.511
185 V 1.000** 138.511
186 N 1.000** 138.511
187 V 1.000** 138.511
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907771_1_539_MLBR_RS02555)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:14
Model 1: NearlyNeutral -731.289887 Model 2: PositiveSelection -731.289846 Model 0: one-ratio -731.289846 Model 7: beta -731.289933 Model 8: beta&w>1 -731.289846 Model 0 vs 1 8.200000002034358E-5 Model 2 vs 1 8.200000002034358E-5 Model 8 vs 7 1.7400000001543958E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
