--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 10:40:03 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/1res/eno/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/1res/eno/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/eno/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/eno/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1827.93 -1831.28 2 -1827.99 -1831.08 -------------------------------------- TOTAL -1827.96 -1831.18 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/eno/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/eno/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/eno/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896629 0.088719 0.395107 1.521656 0.864900 1466.64 1483.82 1.001 r(A<->C){all} 0.160502 0.018564 0.000037 0.434149 0.124873 294.17 440.92 1.001 r(A<->G){all} 0.171392 0.019082 0.000163 0.447350 0.138893 340.29 351.30 1.000 r(A<->T){all} 0.166728 0.021050 0.000325 0.464928 0.128839 194.48 201.16 1.008 r(C<->G){all} 0.161218 0.019557 0.000008 0.446551 0.121830 115.52 124.96 1.000 r(C<->T){all} 0.169505 0.018662 0.000155 0.436631 0.137979 126.00 220.10 1.000 r(G<->T){all} 0.170655 0.018955 0.000317 0.438130 0.139625 213.40 273.68 1.000 pi(A){all} 0.198253 0.000115 0.177123 0.219086 0.197967 1246.08 1373.54 1.000 pi(C){all} 0.273402 0.000142 0.248974 0.295320 0.273277 1209.95 1278.56 1.000 pi(G){all} 0.330196 0.000163 0.305301 0.354923 0.330262 1252.13 1269.68 1.000 pi(T){all} 0.198150 0.000117 0.177010 0.218596 0.197994 1174.12 1234.32 1.002 alpha{1,2} 0.430191 0.240826 0.000230 1.427157 0.256615 1197.72 1217.56 1.000 alpha{3} 0.467392 0.254039 0.000134 1.493464 0.296889 957.29 1062.38 1.000 pinvar{all} 0.998904 0.000002 0.996527 1.000000 0.999301 1011.96 1127.04 1.002 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1668.126514 Model 2: PositiveSelection -1668.126398 Model 0: one-ratio -1668.127094 Model 7: beta -1668.126398 Model 8: beta&w>1 -1668.127056 Model 0 vs 1 0.0011599999997997656 Model 2 vs 1 2.3199999986900366E-4 Model 8 vs 7 0.0013159999998606509
>C1 LSPPTGRPRLSHDYKENLVPVIEQVGAREILDSRGNPTVEVEVVLIDGTF ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETR >C2 LSPPTGRPRLSHDYKENLVPVIEQVGAREILDSRGNPTVEVEVVLIDGTF ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETR >C3 LSPPTGRPRLSHDYKENLVPVIEQVGAREILDSRGNPTVEVEVVLIDGTF ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETR >C4 LSPPTGRPRLSHDYKENLVPVIEQVGAREILDSRGNPTVEVEVVLIDGTF ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETR >C5 VPVIEQVGAREILDSRGNPTVEVEVVLIDGTFARAAVPSGASTGEYEAVE LRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLNANDQRLIDQELLDLDGTP DKSRLGGNAILGVSLAVAKAAADSAELPLFRYIGGSNAHILPVPMMNILN GGAHADTAVDVQEFMVAPIGAPSFVEALRWGAEVYHALKSVLKKKGLSTG LGDEGGFAPEVAGTTAALDLVTLAIEAAGFKPGADVALALDAAATEFYTD GIGYHFEGMTHTADQMTEFYADLLGSYPLVSIEDPLSEDDWDGWAALTAS IGEQVQIVGDDIFATNPERLEEGIGRGVANALLVKVNQIGTLTETLEAVA LAHHSGYRTMISHRSGETEDTMIADLVVALGSGQIKTGAPARSERVAKYN QLLRIEEELGDAARYAGDLAFLRYVVETRoooooooooooooooooo >C6 VPVIEQVGAREILDSRGNPTVEVEVVLIDGTFARAAVPSGASTGEYEAVE LRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLNANDQRLIDQELLDLDGTP DKSRLGGNAILGVSLAVAKAAADSAELPLFRYIGGSNAHILPVPMMNILN GGAHADTAVDVQEFMVAPIGAPSFVEALRWGAEVYHALKSVLKKKGLSTG LGDEGGFAPEVAGTTAALDLVTLAIEAAGFKPGADVALALDAAATEFYTD GIGYHFEGMTHTADQMTEFYADLLGSYPLVSIEDPLSEDDWDGWAALTAS IGEQVQIVGDDIFATNPERLEEGIGRGVANALLVKVNQIGTLTETLEAVA LAHHSGYRTMISHRSGETEDTMIADLVVALGSGQIKTGAPARSERVAKYN QLLRIEEELGDAARYAGDLAFLRYVVETRoooooooooooooooooo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=465 C1 LSPPTGRPRLSHDYKENLVPVIEQVGAREILDSRGNPTVEVEVVLIDGTF C2 LSPPTGRPRLSHDYKENLVPVIEQVGAREILDSRGNPTVEVEVVLIDGTF C3 LSPPTGRPRLSHDYKENLVPVIEQVGAREILDSRGNPTVEVEVVLIDGTF C4 LSPPTGRPRLSHDYKENLVPVIEQVGAREILDSRGNPTVEVEVVLIDGTF C5 ------------------VPVIEQVGAREILDSRGNPTVEVEVVLIDGTF C6 ------------------VPVIEQVGAREILDSRGNPTVEVEVVLIDGTF ******************************** C1 ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN C2 ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN C3 ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN C4 ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN C5 ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN C6 ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN ************************************************** C1 ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY C2 ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY C3 ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY C4 ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY C5 ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY C6 ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY ************************************************** C1 IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA C2 IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA C3 IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA C4 IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA C5 IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA C6 IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA ************************************************** C1 EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP C2 EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP C3 EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP C4 EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP C5 EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP C6 EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP ************************************************** C1 GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI C2 GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI C3 GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI C4 GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI C5 GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI C6 GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI ************************************************** C1 EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL C2 EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL C3 EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL C4 EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL C5 EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL C6 EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL ************************************************** C1 LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS C2 LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS C3 LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS C4 LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS C5 LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS C6 LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS ************************************************** C1 GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETR--- C2 GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETR--- C3 GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETR--- C4 GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETR--- C5 GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETRooo C6 GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETRooo *********************************************** C1 --------------- C2 --------------- C3 --------------- C4 --------------- C5 ooooooooooooooo C6 ooooooooooooooo PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13966] Library Relaxation: Multi_proc [96] Relaxation Summary: [13966]--->[13502] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.539 Mb, Max= 31.038 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VPVIEQVGAREILDSRGNPTVEVEVVLIDGTFARAAVPSGASTGEYEAVE C2 VPVIEQVGAREILDSRGNPTVEVEVVLIDGTFARAAVPSGASTGEYEAVE C3 VPVIEQVGAREILDSRGNPTVEVEVVLIDGTFARAAVPSGASTGEYEAVE C4 VPVIEQVGAREILDSRGNPTVEVEVVLIDGTFARAAVPSGASTGEYEAVE C5 VPVIEQVGAREILDSRGNPTVEVEVVLIDGTFARAAVPSGASTGEYEAVE C6 VPVIEQVGAREILDSRGNPTVEVEVVLIDGTFARAAVPSGASTGEYEAVE ************************************************** C1 LRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLNANDQRLIDQELLDLDGTP C2 LRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLNANDQRLIDQELLDLDGTP C3 LRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLNANDQRLIDQELLDLDGTP C4 LRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLNANDQRLIDQELLDLDGTP C5 LRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLNANDQRLIDQELLDLDGTP C6 LRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLNANDQRLIDQELLDLDGTP ************************************************** C1 DKSRLGGNAILGVSLAVAKAAADSAELPLFRYIGGSNAHILPVPMMNILN C2 DKSRLGGNAILGVSLAVAKAAADSAELPLFRYIGGSNAHILPVPMMNILN C3 DKSRLGGNAILGVSLAVAKAAADSAELPLFRYIGGSNAHILPVPMMNILN C4 DKSRLGGNAILGVSLAVAKAAADSAELPLFRYIGGSNAHILPVPMMNILN C5 DKSRLGGNAILGVSLAVAKAAADSAELPLFRYIGGSNAHILPVPMMNILN C6 DKSRLGGNAILGVSLAVAKAAADSAELPLFRYIGGSNAHILPVPMMNILN ************************************************** C1 GGAHADTAVDVQEFMVAPIGAPSFVEALRWGAEVYHALKSVLKKKGLSTG C2 GGAHADTAVDVQEFMVAPIGAPSFVEALRWGAEVYHALKSVLKKKGLSTG C3 GGAHADTAVDVQEFMVAPIGAPSFVEALRWGAEVYHALKSVLKKKGLSTG C4 GGAHADTAVDVQEFMVAPIGAPSFVEALRWGAEVYHALKSVLKKKGLSTG C5 GGAHADTAVDVQEFMVAPIGAPSFVEALRWGAEVYHALKSVLKKKGLSTG C6 GGAHADTAVDVQEFMVAPIGAPSFVEALRWGAEVYHALKSVLKKKGLSTG ************************************************** C1 LGDEGGFAPEVAGTTAALDLVTLAIEAAGFKPGADVALALDAAATEFYTD C2 LGDEGGFAPEVAGTTAALDLVTLAIEAAGFKPGADVALALDAAATEFYTD C3 LGDEGGFAPEVAGTTAALDLVTLAIEAAGFKPGADVALALDAAATEFYTD C4 LGDEGGFAPEVAGTTAALDLVTLAIEAAGFKPGADVALALDAAATEFYTD C5 LGDEGGFAPEVAGTTAALDLVTLAIEAAGFKPGADVALALDAAATEFYTD C6 LGDEGGFAPEVAGTTAALDLVTLAIEAAGFKPGADVALALDAAATEFYTD ************************************************** C1 GIGYHFEGMTHTADQMTEFYADLLGSYPLVSIEDPLSEDDWDGWAALTAS C2 GIGYHFEGMTHTADQMTEFYADLLGSYPLVSIEDPLSEDDWDGWAALTAS C3 GIGYHFEGMTHTADQMTEFYADLLGSYPLVSIEDPLSEDDWDGWAALTAS C4 GIGYHFEGMTHTADQMTEFYADLLGSYPLVSIEDPLSEDDWDGWAALTAS C5 GIGYHFEGMTHTADQMTEFYADLLGSYPLVSIEDPLSEDDWDGWAALTAS C6 GIGYHFEGMTHTADQMTEFYADLLGSYPLVSIEDPLSEDDWDGWAALTAS ************************************************** C1 IGEQVQIVGDDIFATNPERLEEGIGRGVANALLVKVNQIGTLTETLEAVA C2 IGEQVQIVGDDIFATNPERLEEGIGRGVANALLVKVNQIGTLTETLEAVA C3 IGEQVQIVGDDIFATNPERLEEGIGRGVANALLVKVNQIGTLTETLEAVA C4 IGEQVQIVGDDIFATNPERLEEGIGRGVANALLVKVNQIGTLTETLEAVA C5 IGEQVQIVGDDIFATNPERLEEGIGRGVANALLVKVNQIGTLTETLEAVA C6 IGEQVQIVGDDIFATNPERLEEGIGRGVANALLVKVNQIGTLTETLEAVA ************************************************** C1 LAHHSGYRTMISHRSGETEDTMIADLVVALGSGQIKTGAPARSERVAKYN C2 LAHHSGYRTMISHRSGETEDTMIADLVVALGSGQIKTGAPARSERVAKYN C3 LAHHSGYRTMISHRSGETEDTMIADLVVALGSGQIKTGAPARSERVAKYN C4 LAHHSGYRTMISHRSGETEDTMIADLVVALGSGQIKTGAPARSERVAKYN C5 LAHHSGYRTMISHRSGETEDTMIADLVVALGSGQIKTGAPARSERVAKYN C6 LAHHSGYRTMISHRSGETEDTMIADLVVALGSGQIKTGAPARSERVAKYN ************************************************** C1 QLLRIEEELGDAARYAGDLAFLRYVVETR C2 QLLRIEEELGDAARYAGDLAFLRYVVETR C3 QLLRIEEELGDAARYAGDLAFLRYVVETR C4 QLLRIEEELGDAARYAGDLAFLRYVVETR C5 QLLRIEEELGDAARYAGDLAFLRYVVETR C6 QLLRIEEELGDAARYAGDLAFLRYVVETR ***************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:97 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 TTGAGCCCACCCACAGGACGTCCACGTCTCAGCCATGACTATAAGGAGAA C2 TTGAGCCCACCCACAGGACGTCCACGTCTCAGCCATGACTATAAGGAGAA C3 TTGAGCCCACCCACAGGACGTCCACGTCTCAGCCATGACTATAAGGAGAA C4 TTGAGCCCACCCACAGGACGTCCACGTCTCAGCCATGACTATAAGGAGAA C5 -------------------------------------------------- C6 -------------------------------------------------- C1 CTTGGTGCCGGTTATCGAGCAGGTCGGGGCCCGCGAGATCCTCGATTCCC C2 CTTGGTGCCGGTTATCGAGCAGGTCGGGGCCCGCGAGATCCTCGATTCCC C3 CTTGGTGCCGGTTATCGAGCAGGTCGGGGCCCGCGAGATCCTCGATTCCC C4 CTTGGTGCCGGTTATCGAGCAGGTCGGGGCCCGCGAGATCCTCGATTCCC C5 ----GTGCCGGTTATCGAGCAGGTCGGGGCCCGCGAGATCCTCGATTCCC C6 ----GTGCCGGTTATCGAGCAGGTCGGGGCCCGCGAGATCCTCGATTCCC ********************************************** C1 GCGGCAACCCCACGGTCGAAGTCGAGGTGGTGCTGATTGACGGAACCTTC C2 GCGGCAACCCCACGGTCGAAGTCGAGGTGGTGCTGATTGACGGAACCTTC C3 GCGGCAACCCCACGGTCGAAGTCGAGGTGGTGCTGATTGACGGAACCTTC C4 GCGGCAACCCCACGGTCGAAGTCGAGGTGGTGCTGATTGACGGAACCTTC C5 GCGGCAACCCCACGGTCGAAGTCGAGGTGGTGCTGATTGACGGAACCTTC C6 GCGGCAACCCCACGGTCGAAGTCGAGGTGGTGCTGATTGACGGAACCTTC ************************************************** C1 GCCCGCGCAGCGGTGCCTTCGGGCGCATCGACCGGCGAGTATGAGGCCGT C2 GCCCGCGCAGCGGTGCCTTCGGGCGCATCGACCGGCGAGTATGAGGCCGT C3 GCCCGCGCAGCGGTGCCTTCGGGCGCATCGACCGGCGAGTATGAGGCCGT C4 GCCCGCGCAGCGGTGCCTTCGGGCGCATCGACCGGCGAGTATGAGGCCGT C5 GCCCGCGCAGCGGTGCCTTCGGGCGCATCGACCGGCGAGTATGAGGCCGT C6 GCCCGCGCAGCGGTGCCTTCGGGCGCATCGACCGGCGAGTATGAGGCCGT ************************************************** C1 CGAGTTACGTGACGGCGACGGTCGTTACGGTGGCAAGGGTGTGAAAAGGG C2 CGAGTTACGTGACGGCGACGGTCGTTACGGTGGCAAGGGTGTGAAAAGGG C3 CGAGTTACGTGACGGCGACGGTCGTTACGGTGGCAAGGGTGTGAAAAGGG C4 CGAGTTACGTGACGGCGACGGTCGTTACGGTGGCAAGGGTGTGAAAAGGG C5 CGAGTTACGTGACGGCGACGGTCGTTACGGTGGCAAGGGTGTGAAAAGGG C6 CGAGTTACGTGACGGCGACGGTCGTTACGGTGGCAAGGGTGTGAAAAGGG ************************************************** C1 CCGTGGATGCTGTGCTCGACGAGATCGGTCCAGTGGTGATCGGCCTCAAC C2 CCGTGGATGCTGTGCTCGACGAGATCGGTCCAGTGGTGATCGGCCTCAAC C3 CCGTGGATGCTGTGCTCGACGAGATCGGTCCAGTGGTGATCGGCCTCAAC C4 CCGTGGATGCTGTGCTCGACGAGATCGGTCCAGTGGTGATCGGCCTCAAC C5 CCGTGGATGCTGTGCTCGACGAGATCGGTCCAGTGGTGATCGGCCTCAAC C6 CCGTGGATGCTGTGCTCGACGAGATCGGTCCAGTGGTGATCGGCCTCAAC ************************************************** C1 GCCAATGACCAGCGGCTGATCGATCAGGAGCTGCTGGACCTCGACGGCAC C2 GCCAATGACCAGCGGCTGATCGATCAGGAGCTGCTGGACCTCGACGGCAC C3 GCCAATGACCAGCGGCTGATCGATCAGGAGCTGCTGGACCTCGACGGCAC C4 GCCAATGACCAGCGGCTGATCGATCAGGAGCTGCTGGACCTCGACGGCAC C5 GCCAATGACCAGCGGCTGATCGATCAGGAGCTGCTGGACCTCGACGGCAC C6 GCCAATGACCAGCGGCTGATCGATCAGGAGCTGCTGGACCTCGACGGCAC ************************************************** C1 CCCCGACAAGTCCCGATTGGGTGGTAACGCGATCCTGGGTGTCTCGCTGG C2 CCCCGACAAGTCCCGATTGGGTGGTAACGCGATCCTGGGTGTCTCGCTGG C3 CCCCGACAAGTCCCGATTGGGTGGTAACGCGATCCTGGGTGTCTCGCTGG C4 CCCCGACAAGTCCCGATTGGGTGGTAACGCGATCCTGGGTGTCTCGCTGG C5 CCCCGACAAGTCCCGATTGGGTGGTAACGCGATCCTGGGTGTCTCGCTGG C6 CCCCGACAAGTCCCGATTGGGTGGTAACGCGATCCTGGGTGTCTCGCTGG ************************************************** C1 CCGTCGCCAAGGCAGCCGCCGATTCAGCGGAATTGCCGCTGTTCCGTTAT C2 CCGTCGCCAAGGCAGCCGCCGATTCAGCGGAATTGCCGCTGTTCCGTTAT C3 CCGTCGCCAAGGCAGCCGCCGATTCAGCGGAATTGCCGCTGTTCCGTTAT C4 CCGTCGCCAAGGCAGCCGCCGATTCAGCGGAATTGCCGCTGTTCCGTTAT C5 CCGTCGCCAAGGCAGCCGCCGATTCAGCGGAATTGCCGCTGTTCCGTTAT C6 CCGTCGCCAAGGCAGCCGCCGATTCAGCGGAATTGCCGCTGTTCCGTTAT ************************************************** C1 ATTGGAGGGTCTAACGCACATATCCTTCCGGTGCCTATGATGAACATTCT C2 ATTGGAGGGTCTAACGCACATATCCTTCCGGTGCCTATGATGAACATTCT C3 ATTGGAGGGTCTAACGCACATATCCTTCCGGTGCCTATGATGAACATTCT C4 ATTGGAGGGTCTAACGCACATATCCTTCCGGTGCCTATGATGAACATTCT C5 ATTGGAGGGTCTAACGCACATATCCTTCCGGTGCCTATGATGAACATTCT C6 ATTGGAGGGTCTAACGCACATATCCTTCCGGTGCCTATGATGAACATTCT ************************************************** C1 CAACGGCGGCGCGCACGCCGACACTGCTGTTGATGTGCAGGAGTTCATGG C2 CAACGGCGGCGCGCACGCCGACACTGCTGTTGATGTGCAGGAGTTCATGG C3 CAACGGCGGCGCGCACGCCGACACTGCTGTTGATGTGCAGGAGTTCATGG C4 CAACGGCGGCGCGCACGCCGACACTGCTGTTGATGTGCAGGAGTTCATGG C5 CAACGGCGGCGCGCACGCCGACACTGCTGTTGATGTGCAGGAGTTCATGG C6 CAACGGCGGCGCGCACGCCGACACTGCTGTTGATGTGCAGGAGTTCATGG ************************************************** C1 TGGCACCGATCGGGGCACCCAGTTTCGTTGAGGCGCTGCGTTGGGGCGCC C2 TGGCACCGATCGGGGCACCCAGTTTCGTTGAGGCGCTGCGTTGGGGCGCC C3 TGGCACCGATCGGGGCACCCAGTTTCGTTGAGGCGCTGCGTTGGGGCGCC C4 TGGCACCGATCGGGGCACCCAGTTTCGTTGAGGCGCTGCGTTGGGGCGCC C5 TGGCACCGATCGGGGCACCCAGTTTCGTTGAGGCGCTGCGTTGGGGCGCC C6 TGGCACCGATCGGGGCACCCAGTTTCGTTGAGGCGCTGCGTTGGGGCGCC ************************************************** C1 GAGGTATATCACGCTCTCAAATCGGTTCTGAAGAAAAAAGGGTTAAGCAC C2 GAGGTATATCACGCTCTCAAATCGGTTCTGAAGAAAAAAGGGTTAAGCAC C3 GAGGTATATCACGCTCTCAAATCGGTTCTGAAGAAAAAAGGGTTAAGCAC C4 GAGGTATATCACGCTCTCAAATCGGTTCTGAAGAAAAAAGGGTTAAGCAC C5 GAGGTATATCACGCTCTCAAATCGGTTCTGAAGAAAAAAGGGTTAAGCAC C6 GAGGTATATCACGCTCTCAAATCGGTTCTGAAGAAAAAAGGGTTAAGCAC ************************************************** C1 CGGCCTGGGTGATGAGGGTGGCTTTGCCCCTGAAGTGGCCGGAACCACCG C2 CGGCCTGGGTGATGAGGGTGGCTTTGCCCCTGAAGTGGCCGGAACCACCG C3 CGGCCTGGGTGATGAGGGTGGCTTTGCCCCTGAAGTGGCCGGAACCACCG C4 CGGCCTGGGTGATGAGGGTGGCTTTGCCCCTGAAGTGGCCGGAACCACCG C5 CGGCCTGGGTGATGAGGGTGGCTTTGCCCCTGAAGTGGCCGGAACCACCG C6 CGGCCTGGGTGATGAGGGTGGCTTTGCCCCTGAAGTGGCCGGAACCACCG ************************************************** C1 CGGCGCTGGACTTGGTCACCTTAGCTATTGAAGCGGCGGGTTTTAAGCCG C2 CGGCGCTGGACTTGGTCACCTTAGCTATTGAAGCGGCGGGTTTTAAGCCG C3 CGGCGCTGGACTTGGTCACCTTAGCTATTGAAGCGGCGGGTTTTAAGCCG C4 CGGCGCTGGACTTGGTCACCTTAGCTATTGAAGCGGCGGGTTTTAAGCCG C5 CGGCGCTGGACTTGGTCACCTTAGCTATTGAAGCGGCGGGTTTTAAGCCG C6 CGGCGCTGGACTTGGTCACCTTAGCTATTGAAGCGGCGGGTTTTAAGCCG ************************************************** C1 GGTGCCGATGTGGCATTGGCCCTTGATGCGGCAGCCACCGAGTTCTACAC C2 GGTGCCGATGTGGCATTGGCCCTTGATGCGGCAGCCACCGAGTTCTACAC C3 GGTGCCGATGTGGCATTGGCCCTTGATGCGGCAGCCACCGAGTTCTACAC C4 GGTGCCGATGTGGCATTGGCCCTTGATGCGGCAGCCACCGAGTTCTACAC C5 GGTGCCGATGTGGCATTGGCCCTTGATGCGGCAGCCACCGAGTTCTACAC C6 GGTGCCGATGTGGCATTGGCCCTTGATGCGGCAGCCACCGAGTTCTACAC ************************************************** C1 GGACGGCATCGGCTACCATTTCGAGGGCATGACCCACACTGCCGACCAGA C2 GGACGGCATCGGCTACCATTTCGAGGGCATGACCCACACTGCCGACCAGA C3 GGACGGCATCGGCTACCATTTCGAGGGCATGACCCACACTGCCGACCAGA C4 GGACGGCATCGGCTACCATTTCGAGGGCATGACCCACACTGCCGACCAGA C5 GGACGGCATCGGCTACCATTTCGAGGGCATGACCCACACTGCCGACCAGA C6 GGACGGCATCGGCTACCATTTCGAGGGCATGACCCACACTGCCGACCAGA ************************************************** C1 TGACTGAGTTTTATGCCGACTTGCTGGGTTCATACCCACTGGTGTCCATC C2 TGACTGAGTTTTATGCCGACTTGCTGGGTTCATACCCACTGGTGTCCATC C3 TGACTGAGTTTTATGCCGACTTGCTGGGTTCATACCCACTGGTGTCCATC C4 TGACTGAGTTTTATGCCGACTTGCTGGGTTCATACCCACTGGTGTCCATC C5 TGACTGAGTTTTATGCCGACTTGCTGGGTTCATACCCACTGGTGTCCATC C6 TGACTGAGTTTTATGCCGACTTGCTGGGTTCATACCCACTGGTGTCCATC ************************************************** C1 GAAGATCCGCTGTCCGAAGATGATTGGGACGGTTGGGCTGCTCTGACGGC C2 GAAGATCCGCTGTCCGAAGATGATTGGGACGGTTGGGCTGCTCTGACGGC C3 GAAGATCCGCTGTCCGAAGATGATTGGGACGGTTGGGCTGCTCTGACGGC C4 GAAGATCCGCTGTCCGAAGATGATTGGGACGGTTGGGCTGCTCTGACGGC C5 GAAGATCCGCTGTCCGAAGATGATTGGGACGGTTGGGCTGCTCTGACGGC C6 GAAGATCCGCTGTCCGAAGATGATTGGGACGGTTGGGCTGCTCTGACGGC ************************************************** C1 GTCGATAGGGGAACAGGTGCAGATCGTCGGGGACGACATCTTTGCCACCA C2 GTCGATAGGGGAACAGGTGCAGATCGTCGGGGACGACATCTTTGCCACCA C3 GTCGATAGGGGAACAGGTGCAGATCGTCGGGGACGACATCTTTGCCACCA C4 GTCGATAGGGGAACAGGTGCAGATCGTCGGGGACGACATCTTTGCCACCA C5 GTCGATAGGGGAACAGGTGCAGATCGTCGGGGACGACATCTTTGCCACCA C6 GTCGATAGGGGAACAGGTGCAGATCGTCGGGGACGACATCTTTGCCACCA ************************************************** C1 ATCCTGAGAGACTGGAGGAGGGCATCGGTCGCGGTGTGGCAAACGCGTTG C2 ATCCTGAGAGACTGGAGGAGGGCATCGGTCGCGGTGTGGCAAACGCGTTG C3 ATCCTGAGAGACTGGAGGAGGGCATCGGTCGCGGTGTGGCAAACGCGTTG C4 ATCCTGAGAGACTGGAGGAGGGCATCGGTCGCGGTGTGGCAAACGCGTTG C5 ATCCTGAGAGACTGGAGGAGGGCATCGGTCGCGGTGTGGCAAACGCGTTG C6 ATCCTGAGAGACTGGAGGAGGGCATCGGTCGCGGTGTGGCAAACGCGTTG ************************************************** C1 CTGGTCAAGGTGAACCAGATAGGCACGTTGACCGAGACGCTCGAAGCTGT C2 CTGGTCAAGGTGAACCAGATAGGCACGTTGACCGAGACGCTCGAAGCTGT C3 CTGGTCAAGGTGAACCAGATAGGCACGTTGACCGAGACGCTCGAAGCTGT C4 CTGGTCAAGGTGAACCAGATAGGCACGTTGACCGAGACGCTCGAAGCTGT C5 CTGGTCAAGGTGAACCAGATAGGCACGTTGACCGAGACGCTCGAAGCTGT C6 CTGGTCAAGGTGAACCAGATAGGCACGTTGACCGAGACGCTCGAAGCTGT ************************************************** C1 TGCGTTGGCACATCACAGCGGATATCGCACGATGATCAGCCACCGCAGTG C2 TGCGTTGGCACATCACAGCGGATATCGCACGATGATCAGCCACCGCAGTG C3 TGCGTTGGCACATCACAGCGGATATCGCACGATGATCAGCCACCGCAGTG C4 TGCGTTGGCACATCACAGCGGATATCGCACGATGATCAGCCACCGCAGTG C5 TGCGTTGGCACATCACAGCGGATATCGCACGATGATCAGCCACCGCAGTG C6 TGCGTTGGCACATCACAGCGGATATCGCACGATGATCAGCCACCGCAGTG ************************************************** C1 GCGAGACCGAGGACACGATGATCGCTGACCTGGTCGTGGCTCTCGGTAGC C2 GCGAGACCGAGGACACGATGATCGCTGACCTGGTCGTGGCTCTCGGTAGC C3 GCGAGACCGAGGACACGATGATCGCTGACCTGGTCGTGGCTCTCGGTAGC C4 GCGAGACCGAGGACACGATGATCGCTGACCTGGTCGTGGCTCTCGGTAGC C5 GCGAGACCGAGGACACGATGATCGCTGACCTGGTCGTGGCTCTCGGTAGC C6 GCGAGACCGAGGACACGATGATCGCTGACCTGGTCGTGGCTCTCGGTAGC ************************************************** C1 GGGCAAATTAAGACGGGAGCGCCCGCCCGCAGTGAGCGCGTCGCTAAATA C2 GGGCAAATTAAGACGGGAGCGCCCGCCCGCAGTGAGCGCGTCGCTAAATA C3 GGGCAAATTAAGACGGGAGCGCCCGCCCGCAGTGAGCGCGTCGCTAAATA C4 GGGCAAATTAAGACGGGAGCGCCCGCCCGCAGTGAGCGCGTCGCTAAATA C5 GGGCAAATTAAGACGGGAGCGCCCGCCCGCAGTGAGCGCGTCGCTAAATA C6 GGGCAAATTAAGACGGGAGCGCCCGCCCGCAGTGAGCGCGTCGCTAAATA ************************************************** C1 TAACCAGCTGCTGCGGATTGAAGAGGAGCTCGGCGACGCCGCCCGCTATG C2 TAACCAGCTGCTGCGGATTGAAGAGGAGCTCGGCGACGCCGCCCGCTATG C3 TAACCAGCTGCTGCGGATTGAAGAGGAGCTCGGCGACGCCGCCCGCTATG C4 TAACCAGCTGCTGCGGATTGAAGAGGAGCTCGGCGACGCCGCCCGCTATG C5 TAACCAGCTGCTGCGGATTGAAGAGGAGCTCGGCGACGCCGCCCGCTATG C6 TAACCAGCTGCTGCGGATTGAAGAGGAGCTCGGCGACGCCGCCCGCTATG ************************************************** C1 CCGGCGATCTGGCATTTCTGCGATACGTCGTGGAAACGAGA--------- C2 CCGGCGATCTGGCATTTCTGCGATACGTCGTGGAAACGAGA--------- C3 CCGGCGATCTGGCATTTCTGCGATACGTCGTGGAAACGAGA--------- C4 CCGGCGATCTGGCATTTCTGCGATACGTCGTGGAAACGAGA--------- C5 CCGGCGATCTGGCATTTCTGCGATACGTCGTGGAAACGAGA--------- C6 CCGGCGATCTGGCATTTCTGCGATACGTCGTGGAAACGAGA--------- ***************************************** C1 --------------------------------------------- C2 --------------------------------------------- C3 --------------------------------------------- C4 --------------------------------------------- C5 --------------------------------------------- C6 --------------------------------------------- >C1 TTGAGCCCACCCACAGGACGTCCACGTCTCAGCCATGACTATAAGGAGAA CTTGGTGCCGGTTATCGAGCAGGTCGGGGCCCGCGAGATCCTCGATTCCC GCGGCAACCCCACGGTCGAAGTCGAGGTGGTGCTGATTGACGGAACCTTC GCCCGCGCAGCGGTGCCTTCGGGCGCATCGACCGGCGAGTATGAGGCCGT CGAGTTACGTGACGGCGACGGTCGTTACGGTGGCAAGGGTGTGAAAAGGG CCGTGGATGCTGTGCTCGACGAGATCGGTCCAGTGGTGATCGGCCTCAAC GCCAATGACCAGCGGCTGATCGATCAGGAGCTGCTGGACCTCGACGGCAC CCCCGACAAGTCCCGATTGGGTGGTAACGCGATCCTGGGTGTCTCGCTGG CCGTCGCCAAGGCAGCCGCCGATTCAGCGGAATTGCCGCTGTTCCGTTAT ATTGGAGGGTCTAACGCACATATCCTTCCGGTGCCTATGATGAACATTCT CAACGGCGGCGCGCACGCCGACACTGCTGTTGATGTGCAGGAGTTCATGG TGGCACCGATCGGGGCACCCAGTTTCGTTGAGGCGCTGCGTTGGGGCGCC GAGGTATATCACGCTCTCAAATCGGTTCTGAAGAAAAAAGGGTTAAGCAC CGGCCTGGGTGATGAGGGTGGCTTTGCCCCTGAAGTGGCCGGAACCACCG CGGCGCTGGACTTGGTCACCTTAGCTATTGAAGCGGCGGGTTTTAAGCCG GGTGCCGATGTGGCATTGGCCCTTGATGCGGCAGCCACCGAGTTCTACAC GGACGGCATCGGCTACCATTTCGAGGGCATGACCCACACTGCCGACCAGA TGACTGAGTTTTATGCCGACTTGCTGGGTTCATACCCACTGGTGTCCATC GAAGATCCGCTGTCCGAAGATGATTGGGACGGTTGGGCTGCTCTGACGGC GTCGATAGGGGAACAGGTGCAGATCGTCGGGGACGACATCTTTGCCACCA ATCCTGAGAGACTGGAGGAGGGCATCGGTCGCGGTGTGGCAAACGCGTTG CTGGTCAAGGTGAACCAGATAGGCACGTTGACCGAGACGCTCGAAGCTGT TGCGTTGGCACATCACAGCGGATATCGCACGATGATCAGCCACCGCAGTG GCGAGACCGAGGACACGATGATCGCTGACCTGGTCGTGGCTCTCGGTAGC GGGCAAATTAAGACGGGAGCGCCCGCCCGCAGTGAGCGCGTCGCTAAATA TAACCAGCTGCTGCGGATTGAAGAGGAGCTCGGCGACGCCGCCCGCTATG CCGGCGATCTGGCATTTCTGCGATACGTCGTGGAAACGAGA--------- --------------------------------------------- >C2 TTGAGCCCACCCACAGGACGTCCACGTCTCAGCCATGACTATAAGGAGAA CTTGGTGCCGGTTATCGAGCAGGTCGGGGCCCGCGAGATCCTCGATTCCC GCGGCAACCCCACGGTCGAAGTCGAGGTGGTGCTGATTGACGGAACCTTC GCCCGCGCAGCGGTGCCTTCGGGCGCATCGACCGGCGAGTATGAGGCCGT CGAGTTACGTGACGGCGACGGTCGTTACGGTGGCAAGGGTGTGAAAAGGG CCGTGGATGCTGTGCTCGACGAGATCGGTCCAGTGGTGATCGGCCTCAAC GCCAATGACCAGCGGCTGATCGATCAGGAGCTGCTGGACCTCGACGGCAC CCCCGACAAGTCCCGATTGGGTGGTAACGCGATCCTGGGTGTCTCGCTGG CCGTCGCCAAGGCAGCCGCCGATTCAGCGGAATTGCCGCTGTTCCGTTAT ATTGGAGGGTCTAACGCACATATCCTTCCGGTGCCTATGATGAACATTCT CAACGGCGGCGCGCACGCCGACACTGCTGTTGATGTGCAGGAGTTCATGG TGGCACCGATCGGGGCACCCAGTTTCGTTGAGGCGCTGCGTTGGGGCGCC GAGGTATATCACGCTCTCAAATCGGTTCTGAAGAAAAAAGGGTTAAGCAC CGGCCTGGGTGATGAGGGTGGCTTTGCCCCTGAAGTGGCCGGAACCACCG CGGCGCTGGACTTGGTCACCTTAGCTATTGAAGCGGCGGGTTTTAAGCCG GGTGCCGATGTGGCATTGGCCCTTGATGCGGCAGCCACCGAGTTCTACAC GGACGGCATCGGCTACCATTTCGAGGGCATGACCCACACTGCCGACCAGA TGACTGAGTTTTATGCCGACTTGCTGGGTTCATACCCACTGGTGTCCATC GAAGATCCGCTGTCCGAAGATGATTGGGACGGTTGGGCTGCTCTGACGGC GTCGATAGGGGAACAGGTGCAGATCGTCGGGGACGACATCTTTGCCACCA ATCCTGAGAGACTGGAGGAGGGCATCGGTCGCGGTGTGGCAAACGCGTTG CTGGTCAAGGTGAACCAGATAGGCACGTTGACCGAGACGCTCGAAGCTGT TGCGTTGGCACATCACAGCGGATATCGCACGATGATCAGCCACCGCAGTG GCGAGACCGAGGACACGATGATCGCTGACCTGGTCGTGGCTCTCGGTAGC GGGCAAATTAAGACGGGAGCGCCCGCCCGCAGTGAGCGCGTCGCTAAATA TAACCAGCTGCTGCGGATTGAAGAGGAGCTCGGCGACGCCGCCCGCTATG CCGGCGATCTGGCATTTCTGCGATACGTCGTGGAAACGAGA--------- --------------------------------------------- >C3 TTGAGCCCACCCACAGGACGTCCACGTCTCAGCCATGACTATAAGGAGAA CTTGGTGCCGGTTATCGAGCAGGTCGGGGCCCGCGAGATCCTCGATTCCC GCGGCAACCCCACGGTCGAAGTCGAGGTGGTGCTGATTGACGGAACCTTC GCCCGCGCAGCGGTGCCTTCGGGCGCATCGACCGGCGAGTATGAGGCCGT CGAGTTACGTGACGGCGACGGTCGTTACGGTGGCAAGGGTGTGAAAAGGG CCGTGGATGCTGTGCTCGACGAGATCGGTCCAGTGGTGATCGGCCTCAAC GCCAATGACCAGCGGCTGATCGATCAGGAGCTGCTGGACCTCGACGGCAC CCCCGACAAGTCCCGATTGGGTGGTAACGCGATCCTGGGTGTCTCGCTGG CCGTCGCCAAGGCAGCCGCCGATTCAGCGGAATTGCCGCTGTTCCGTTAT ATTGGAGGGTCTAACGCACATATCCTTCCGGTGCCTATGATGAACATTCT CAACGGCGGCGCGCACGCCGACACTGCTGTTGATGTGCAGGAGTTCATGG TGGCACCGATCGGGGCACCCAGTTTCGTTGAGGCGCTGCGTTGGGGCGCC GAGGTATATCACGCTCTCAAATCGGTTCTGAAGAAAAAAGGGTTAAGCAC CGGCCTGGGTGATGAGGGTGGCTTTGCCCCTGAAGTGGCCGGAACCACCG CGGCGCTGGACTTGGTCACCTTAGCTATTGAAGCGGCGGGTTTTAAGCCG GGTGCCGATGTGGCATTGGCCCTTGATGCGGCAGCCACCGAGTTCTACAC GGACGGCATCGGCTACCATTTCGAGGGCATGACCCACACTGCCGACCAGA TGACTGAGTTTTATGCCGACTTGCTGGGTTCATACCCACTGGTGTCCATC GAAGATCCGCTGTCCGAAGATGATTGGGACGGTTGGGCTGCTCTGACGGC GTCGATAGGGGAACAGGTGCAGATCGTCGGGGACGACATCTTTGCCACCA ATCCTGAGAGACTGGAGGAGGGCATCGGTCGCGGTGTGGCAAACGCGTTG CTGGTCAAGGTGAACCAGATAGGCACGTTGACCGAGACGCTCGAAGCTGT TGCGTTGGCACATCACAGCGGATATCGCACGATGATCAGCCACCGCAGTG GCGAGACCGAGGACACGATGATCGCTGACCTGGTCGTGGCTCTCGGTAGC GGGCAAATTAAGACGGGAGCGCCCGCCCGCAGTGAGCGCGTCGCTAAATA TAACCAGCTGCTGCGGATTGAAGAGGAGCTCGGCGACGCCGCCCGCTATG CCGGCGATCTGGCATTTCTGCGATACGTCGTGGAAACGAGA--------- --------------------------------------------- >C4 TTGAGCCCACCCACAGGACGTCCACGTCTCAGCCATGACTATAAGGAGAA CTTGGTGCCGGTTATCGAGCAGGTCGGGGCCCGCGAGATCCTCGATTCCC GCGGCAACCCCACGGTCGAAGTCGAGGTGGTGCTGATTGACGGAACCTTC GCCCGCGCAGCGGTGCCTTCGGGCGCATCGACCGGCGAGTATGAGGCCGT CGAGTTACGTGACGGCGACGGTCGTTACGGTGGCAAGGGTGTGAAAAGGG CCGTGGATGCTGTGCTCGACGAGATCGGTCCAGTGGTGATCGGCCTCAAC GCCAATGACCAGCGGCTGATCGATCAGGAGCTGCTGGACCTCGACGGCAC CCCCGACAAGTCCCGATTGGGTGGTAACGCGATCCTGGGTGTCTCGCTGG CCGTCGCCAAGGCAGCCGCCGATTCAGCGGAATTGCCGCTGTTCCGTTAT ATTGGAGGGTCTAACGCACATATCCTTCCGGTGCCTATGATGAACATTCT CAACGGCGGCGCGCACGCCGACACTGCTGTTGATGTGCAGGAGTTCATGG TGGCACCGATCGGGGCACCCAGTTTCGTTGAGGCGCTGCGTTGGGGCGCC GAGGTATATCACGCTCTCAAATCGGTTCTGAAGAAAAAAGGGTTAAGCAC CGGCCTGGGTGATGAGGGTGGCTTTGCCCCTGAAGTGGCCGGAACCACCG CGGCGCTGGACTTGGTCACCTTAGCTATTGAAGCGGCGGGTTTTAAGCCG GGTGCCGATGTGGCATTGGCCCTTGATGCGGCAGCCACCGAGTTCTACAC GGACGGCATCGGCTACCATTTCGAGGGCATGACCCACACTGCCGACCAGA TGACTGAGTTTTATGCCGACTTGCTGGGTTCATACCCACTGGTGTCCATC GAAGATCCGCTGTCCGAAGATGATTGGGACGGTTGGGCTGCTCTGACGGC GTCGATAGGGGAACAGGTGCAGATCGTCGGGGACGACATCTTTGCCACCA ATCCTGAGAGACTGGAGGAGGGCATCGGTCGCGGTGTGGCAAACGCGTTG CTGGTCAAGGTGAACCAGATAGGCACGTTGACCGAGACGCTCGAAGCTGT TGCGTTGGCACATCACAGCGGATATCGCACGATGATCAGCCACCGCAGTG GCGAGACCGAGGACACGATGATCGCTGACCTGGTCGTGGCTCTCGGTAGC GGGCAAATTAAGACGGGAGCGCCCGCCCGCAGTGAGCGCGTCGCTAAATA TAACCAGCTGCTGCGGATTGAAGAGGAGCTCGGCGACGCCGCCCGCTATG CCGGCGATCTGGCATTTCTGCGATACGTCGTGGAAACGAGA--------- --------------------------------------------- >C5 -------------------------------------------------- ----GTGCCGGTTATCGAGCAGGTCGGGGCCCGCGAGATCCTCGATTCCC GCGGCAACCCCACGGTCGAAGTCGAGGTGGTGCTGATTGACGGAACCTTC GCCCGCGCAGCGGTGCCTTCGGGCGCATCGACCGGCGAGTATGAGGCCGT CGAGTTACGTGACGGCGACGGTCGTTACGGTGGCAAGGGTGTGAAAAGGG CCGTGGATGCTGTGCTCGACGAGATCGGTCCAGTGGTGATCGGCCTCAAC GCCAATGACCAGCGGCTGATCGATCAGGAGCTGCTGGACCTCGACGGCAC CCCCGACAAGTCCCGATTGGGTGGTAACGCGATCCTGGGTGTCTCGCTGG CCGTCGCCAAGGCAGCCGCCGATTCAGCGGAATTGCCGCTGTTCCGTTAT ATTGGAGGGTCTAACGCACATATCCTTCCGGTGCCTATGATGAACATTCT CAACGGCGGCGCGCACGCCGACACTGCTGTTGATGTGCAGGAGTTCATGG TGGCACCGATCGGGGCACCCAGTTTCGTTGAGGCGCTGCGTTGGGGCGCC GAGGTATATCACGCTCTCAAATCGGTTCTGAAGAAAAAAGGGTTAAGCAC CGGCCTGGGTGATGAGGGTGGCTTTGCCCCTGAAGTGGCCGGAACCACCG CGGCGCTGGACTTGGTCACCTTAGCTATTGAAGCGGCGGGTTTTAAGCCG GGTGCCGATGTGGCATTGGCCCTTGATGCGGCAGCCACCGAGTTCTACAC GGACGGCATCGGCTACCATTTCGAGGGCATGACCCACACTGCCGACCAGA TGACTGAGTTTTATGCCGACTTGCTGGGTTCATACCCACTGGTGTCCATC GAAGATCCGCTGTCCGAAGATGATTGGGACGGTTGGGCTGCTCTGACGGC GTCGATAGGGGAACAGGTGCAGATCGTCGGGGACGACATCTTTGCCACCA ATCCTGAGAGACTGGAGGAGGGCATCGGTCGCGGTGTGGCAAACGCGTTG CTGGTCAAGGTGAACCAGATAGGCACGTTGACCGAGACGCTCGAAGCTGT TGCGTTGGCACATCACAGCGGATATCGCACGATGATCAGCCACCGCAGTG GCGAGACCGAGGACACGATGATCGCTGACCTGGTCGTGGCTCTCGGTAGC GGGCAAATTAAGACGGGAGCGCCCGCCCGCAGTGAGCGCGTCGCTAAATA TAACCAGCTGCTGCGGATTGAAGAGGAGCTCGGCGACGCCGCCCGCTATG CCGGCGATCTGGCATTTCTGCGATACGTCGTGGAAACGAGA--------- --------------------------------------------- >C6 -------------------------------------------------- ----GTGCCGGTTATCGAGCAGGTCGGGGCCCGCGAGATCCTCGATTCCC GCGGCAACCCCACGGTCGAAGTCGAGGTGGTGCTGATTGACGGAACCTTC GCCCGCGCAGCGGTGCCTTCGGGCGCATCGACCGGCGAGTATGAGGCCGT CGAGTTACGTGACGGCGACGGTCGTTACGGTGGCAAGGGTGTGAAAAGGG CCGTGGATGCTGTGCTCGACGAGATCGGTCCAGTGGTGATCGGCCTCAAC GCCAATGACCAGCGGCTGATCGATCAGGAGCTGCTGGACCTCGACGGCAC CCCCGACAAGTCCCGATTGGGTGGTAACGCGATCCTGGGTGTCTCGCTGG CCGTCGCCAAGGCAGCCGCCGATTCAGCGGAATTGCCGCTGTTCCGTTAT ATTGGAGGGTCTAACGCACATATCCTTCCGGTGCCTATGATGAACATTCT CAACGGCGGCGCGCACGCCGACACTGCTGTTGATGTGCAGGAGTTCATGG TGGCACCGATCGGGGCACCCAGTTTCGTTGAGGCGCTGCGTTGGGGCGCC GAGGTATATCACGCTCTCAAATCGGTTCTGAAGAAAAAAGGGTTAAGCAC CGGCCTGGGTGATGAGGGTGGCTTTGCCCCTGAAGTGGCCGGAACCACCG CGGCGCTGGACTTGGTCACCTTAGCTATTGAAGCGGCGGGTTTTAAGCCG GGTGCCGATGTGGCATTGGCCCTTGATGCGGCAGCCACCGAGTTCTACAC GGACGGCATCGGCTACCATTTCGAGGGCATGACCCACACTGCCGACCAGA TGACTGAGTTTTATGCCGACTTGCTGGGTTCATACCCACTGGTGTCCATC GAAGATCCGCTGTCCGAAGATGATTGGGACGGTTGGGCTGCTCTGACGGC GTCGATAGGGGAACAGGTGCAGATCGTCGGGGACGACATCTTTGCCACCA ATCCTGAGAGACTGGAGGAGGGCATCGGTCGCGGTGTGGCAAACGCGTTG CTGGTCAAGGTGAACCAGATAGGCACGTTGACCGAGACGCTCGAAGCTGT TGCGTTGGCACATCACAGCGGATATCGCACGATGATCAGCCACCGCAGTG GCGAGACCGAGGACACGATGATCGCTGACCTGGTCGTGGCTCTCGGTAGC GGGCAAATTAAGACGGGAGCGCCCGCCCGCAGTGAGCGCGTCGCTAAATA TAACCAGCTGCTGCGGATTGAAGAGGAGCTCGGCGACGCCGCCCGCTATG CCGGCGATCTGGCATTTCTGCGATACGTCGTGGAAACGAGA--------- --------------------------------------------- >C1 LSPPTGRPRLSHDYKENLVPVIEQVGAREILDSRGNPTVEVEVVLIDGTF ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETR >C2 LSPPTGRPRLSHDYKENLVPVIEQVGAREILDSRGNPTVEVEVVLIDGTF ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETR >C3 LSPPTGRPRLSHDYKENLVPVIEQVGAREILDSRGNPTVEVEVVLIDGTF ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETR >C4 LSPPTGRPRLSHDYKENLVPVIEQVGAREILDSRGNPTVEVEVVLIDGTF ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETR >C5 ooooooooooooooooooVPVIEQVGAREILDSRGNPTVEVEVVLIDGTF ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETR >C6 ooooooooooooooooooVPVIEQVGAREILDSRGNPTVEVEVVLIDGTF ARAAVPSGASTGEYEAVELRDGDGRYGGKGVKRAVDAVLDEIGPVVIGLN ANDQRLIDQELLDLDGTPDKSRLGGNAILGVSLAVAKAAADSAELPLFRY IGGSNAHILPVPMMNILNGGAHADTAVDVQEFMVAPIGAPSFVEALRWGA EVYHALKSVLKKKGLSTGLGDEGGFAPEVAGTTAALDLVTLAIEAAGFKP GADVALALDAAATEFYTDGIGYHFEGMTHTADQMTEFYADLLGSYPLVSI EDPLSEDDWDGWAALTASIGEQVQIVGDDIFATNPERLEEGIGRGVANAL LVKVNQIGTLTETLEAVALAHHSGYRTMISHRSGETEDTMIADLVVALGS GQIKTGAPARSERVAKYNQLLRIEEELGDAARYAGDLAFLRYVVETR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/1res/eno/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1395 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579775901 Setting output file names to "/data/1res/eno/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1679175760 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9764589758 Seed = 756619159 Swapseed = 1579775901 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 9 unique site patterns Division 2 has 9 unique site patterns Division 3 has 9 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2990.883926 -- -24.965149 Chain 2 -- -2986.060472 -- -24.965149 Chain 3 -- -2990.890608 -- -24.965149 Chain 4 -- -2990.883926 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2986.060472 -- -24.965149 Chain 2 -- -2990.890609 -- -24.965149 Chain 3 -- -2990.883939 -- -24.965149 Chain 4 -- -2990.699617 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2990.884] (-2986.060) (-2990.891) (-2990.884) * [-2986.060] (-2990.891) (-2990.884) (-2990.700) 500 -- (-1844.704) (-1847.107) (-1843.100) [-1841.620] * [-1850.150] (-1854.659) (-1865.230) (-1862.406) -- 0:00:00 1000 -- (-1837.423) (-1842.850) (-1838.719) [-1837.791] * (-1853.082) [-1838.972] (-1846.249) (-1840.896) -- 0:00:00 1500 -- (-1834.306) [-1835.751] (-1839.363) (-1836.505) * (-1841.804) [-1831.638] (-1842.245) (-1838.065) -- 0:00:00 2000 -- [-1832.685] (-1840.522) (-1838.217) (-1837.742) * (-1841.268) (-1835.282) (-1839.353) [-1837.745] -- 0:00:00 2500 -- (-1836.058) (-1836.522) [-1833.822] (-1841.508) * (-1838.204) [-1836.467] (-1839.822) (-1844.837) -- 0:00:00 3000 -- (-1837.897) (-1830.603) [-1838.414] (-1840.488) * (-1842.276) (-1837.300) (-1830.421) [-1834.507] -- 0:00:00 3500 -- (-1835.032) (-1837.652) [-1836.272] (-1842.242) * (-1836.656) (-1842.561) [-1832.283] (-1837.990) -- 0:00:00 4000 -- [-1836.836] (-1835.508) (-1835.724) (-1845.445) * (-1837.949) [-1837.841] (-1837.383) (-1835.165) -- 0:04:09 4500 -- [-1839.093] (-1838.573) (-1833.826) (-1833.400) * [-1832.331] (-1835.315) (-1838.641) (-1839.219) -- 0:03:41 5000 -- (-1836.895) (-1837.555) (-1834.250) [-1834.993] * [-1833.601] (-1836.836) (-1835.468) (-1839.492) -- 0:03:19 Average standard deviation of split frequencies: 0.099995 5500 -- (-1840.589) (-1843.232) (-1836.519) [-1841.537] * (-1836.277) (-1836.589) (-1843.409) [-1837.104] -- 0:03:00 6000 -- (-1841.165) [-1834.546] (-1836.092) (-1843.704) * (-1837.284) (-1835.390) [-1837.864] (-1840.741) -- 0:02:45 6500 -- (-1838.498) [-1836.766] (-1836.727) (-1834.766) * (-1839.113) (-1834.258) [-1836.802] (-1836.427) -- 0:02:32 7000 -- (-1835.055) (-1832.502) [-1834.174] (-1833.800) * (-1841.177) (-1841.226) [-1840.740] (-1837.092) -- 0:02:21 7500 -- [-1832.073] (-1837.496) (-1831.351) (-1834.744) * [-1844.153] (-1833.810) (-1838.246) (-1840.613) -- 0:02:12 8000 -- (-1832.813) (-1840.521) [-1835.850] (-1834.468) * (-1837.966) [-1831.946] (-1841.506) (-1836.214) -- 0:02:04 8500 -- (-1843.612) [-1837.099] (-1846.824) (-1838.386) * (-1838.610) (-1841.460) (-1835.071) [-1836.116] -- 0:01:56 9000 -- (-1836.970) (-1846.780) [-1837.209] (-1832.335) * (-1834.341) (-1835.860) [-1832.252] (-1838.768) -- 0:01:50 9500 -- (-1832.107) (-1840.120) (-1843.915) [-1839.492] * [-1834.693] (-1848.803) (-1837.885) (-1837.149) -- 0:01:44 10000 -- (-1837.265) (-1846.151) [-1833.344] (-1836.291) * [-1839.874] (-1850.004) (-1834.064) (-1835.097) -- 0:01:39 Average standard deviation of split frequencies: 0.083736 10500 -- (-1836.655) (-1836.578) (-1837.406) [-1835.854] * [-1834.329] (-1838.684) (-1844.411) (-1836.434) -- 0:01:34 11000 -- (-1839.646) [-1843.549] (-1838.308) (-1837.772) * (-1835.253) (-1835.545) [-1834.820] (-1851.719) -- 0:01:29 11500 -- (-1834.784) (-1836.432) (-1837.296) [-1839.736] * [-1831.441] (-1838.134) (-1833.420) (-1841.692) -- 0:01:25 12000 -- (-1840.516) (-1842.425) [-1834.934] (-1838.568) * (-1842.863) [-1837.191] (-1835.280) (-1841.298) -- 0:01:22 12500 -- [-1837.944] (-1842.360) (-1841.783) (-1835.685) * (-1837.634) [-1835.522] (-1834.552) (-1836.307) -- 0:01:19 13000 -- [-1838.309] (-1841.309) (-1836.715) (-1839.936) * (-1838.889) [-1837.967] (-1835.857) (-1849.785) -- 0:02:31 13500 -- (-1834.715) (-1840.169) [-1834.874] (-1844.875) * (-1842.853) (-1836.209) (-1835.343) [-1835.540] -- 0:02:26 14000 -- [-1836.773] (-1841.455) (-1837.209) (-1831.342) * (-1831.583) (-1833.705) (-1839.675) [-1834.948] -- 0:02:20 14500 -- (-1833.887) (-1837.553) (-1838.137) [-1831.521] * (-1846.278) [-1839.228] (-1837.780) (-1836.356) -- 0:02:15 15000 -- (-1846.897) (-1838.056) [-1836.105] (-1829.881) * (-1838.422) [-1836.546] (-1841.271) (-1843.536) -- 0:02:11 Average standard deviation of split frequencies: 0.054015 15500 -- (-1834.482) (-1839.725) (-1834.886) [-1828.810] * (-1837.242) [-1836.612] (-1841.350) (-1839.103) -- 0:02:07 16000 -- (-1845.422) (-1836.413) (-1836.744) [-1827.866] * (-1840.487) (-1839.647) [-1835.740] (-1841.850) -- 0:02:03 16500 -- [-1833.688] (-1837.305) (-1842.900) (-1827.429) * [-1837.337] (-1840.998) (-1838.981) (-1845.958) -- 0:01:59 17000 -- (-1839.279) (-1833.856) [-1836.507] (-1829.749) * (-1838.934) [-1835.734] (-1854.310) (-1840.029) -- 0:01:55 17500 -- [-1842.692] (-1835.328) (-1835.542) (-1828.109) * [-1827.333] (-1833.693) (-1838.790) (-1836.848) -- 0:01:52 18000 -- [-1842.036] (-1837.291) (-1837.163) (-1830.424) * (-1829.749) (-1838.212) (-1833.936) [-1833.062] -- 0:01:49 18500 -- [-1835.395] (-1838.714) (-1836.841) (-1830.828) * (-1828.165) (-1833.432) (-1828.736) [-1836.157] -- 0:01:46 19000 -- [-1840.361] (-1836.980) (-1837.844) (-1829.376) * [-1828.077] (-1841.707) (-1827.950) (-1837.070) -- 0:01:43 19500 -- [-1834.811] (-1838.694) (-1841.003) (-1829.978) * [-1828.744] (-1839.174) (-1827.822) (-1834.691) -- 0:01:40 20000 -- [-1835.130] (-1841.307) (-1836.891) (-1829.097) * [-1828.619] (-1838.707) (-1827.792) (-1840.287) -- 0:01:38 Average standard deviation of split frequencies: 0.043219 20500 -- (-1836.381) [-1842.119] (-1835.185) (-1829.223) * [-1827.071] (-1833.612) (-1827.736) (-1843.646) -- 0:01:35 21000 -- [-1835.010] (-1842.170) (-1836.628) (-1835.457) * (-1827.440) (-1830.195) [-1829.277] (-1839.420) -- 0:01:33 21500 -- (-1837.321) [-1835.725] (-1836.760) (-1831.445) * (-1827.807) (-1831.002) (-1828.592) [-1835.077] -- 0:01:31 22000 -- (-1842.107) [-1840.024] (-1835.854) (-1828.984) * (-1829.570) [-1830.860] (-1829.450) (-1846.739) -- 0:01:28 22500 -- (-1837.314) (-1833.320) [-1835.569] (-1829.649) * (-1830.051) (-1829.370) (-1831.626) [-1827.082] -- 0:01:26 23000 -- (-1837.301) [-1832.664] (-1832.401) (-1829.585) * (-1828.958) (-1830.128) (-1830.436) [-1826.709] -- 0:01:24 23500 -- (-1845.229) [-1844.628] (-1838.442) (-1831.041) * (-1828.941) (-1828.641) (-1830.718) [-1832.931] -- 0:01:23 24000 -- (-1843.101) (-1840.181) (-1835.161) [-1829.998] * (-1828.303) (-1829.151) (-1834.493) [-1832.696] -- 0:01:21 24500 -- (-1839.005) (-1838.441) [-1845.998] (-1826.789) * (-1828.010) (-1829.206) [-1834.967] (-1828.179) -- 0:01:59 25000 -- (-1836.097) (-1841.829) (-1840.114) [-1826.738] * (-1828.559) (-1827.953) (-1833.169) [-1831.062] -- 0:01:57 Average standard deviation of split frequencies: 0.025548 25500 -- [-1834.129] (-1835.928) (-1836.040) (-1826.738) * (-1830.970) (-1828.452) [-1827.639] (-1828.777) -- 0:01:54 26000 -- [-1831.292] (-1840.855) (-1846.714) (-1826.696) * [-1830.247] (-1828.171) (-1827.639) (-1826.958) -- 0:01:52 26500 -- (-1836.044) (-1839.381) [-1840.134] (-1828.083) * (-1829.662) (-1829.084) (-1828.292) [-1827.631] -- 0:01:50 27000 -- (-1833.747) (-1839.320) (-1835.673) [-1828.279] * (-1828.646) (-1828.708) (-1827.153) [-1832.766] -- 0:01:48 27500 -- [-1840.125] (-1848.950) (-1839.563) (-1826.928) * (-1834.083) (-1827.596) (-1827.153) [-1828.775] -- 0:01:46 28000 -- (-1840.120) (-1839.552) [-1836.182] (-1826.633) * [-1831.802] (-1827.357) (-1826.599) (-1830.099) -- 0:01:44 28500 -- [-1837.193] (-1835.602) (-1841.418) (-1826.653) * (-1833.496) [-1828.186] (-1826.428) (-1828.176) -- 0:01:42 29000 -- [-1838.446] (-1837.585) (-1838.785) (-1828.366) * [-1829.382] (-1829.775) (-1826.882) (-1829.806) -- 0:01:40 29500 -- [-1838.819] (-1833.325) (-1833.245) (-1828.788) * [-1829.048] (-1832.028) (-1826.899) (-1828.400) -- 0:01:38 30000 -- (-1839.893) [-1835.232] (-1833.324) (-1827.749) * (-1827.382) (-1831.144) [-1831.696] (-1829.113) -- 0:01:37 Average standard deviation of split frequencies: 0.023424 30500 -- [-1844.259] (-1837.779) (-1839.345) (-1831.474) * (-1830.506) (-1829.943) (-1827.031) [-1828.377] -- 0:01:35 31000 -- (-1841.046) (-1845.240) (-1835.490) [-1829.325] * (-1830.817) [-1830.003] (-1827.345) (-1831.835) -- 0:01:33 31500 -- (-1835.797) (-1838.082) (-1833.761) [-1828.853] * (-1828.666) (-1829.964) [-1826.455] (-1828.738) -- 0:01:32 32000 -- (-1837.894) (-1835.399) [-1838.801] (-1828.147) * (-1828.427) (-1829.240) (-1826.533) [-1826.539] -- 0:01:30 32500 -- (-1843.189) (-1836.629) (-1836.675) [-1827.631] * (-1828.619) (-1833.866) [-1828.753] (-1826.909) -- 0:01:29 33000 -- [-1835.643] (-1843.421) (-1844.842) (-1829.475) * [-1831.027] (-1829.442) (-1830.136) (-1828.192) -- 0:01:27 33500 -- [-1837.137] (-1844.646) (-1847.761) (-1829.442) * [-1829.909] (-1827.772) (-1828.232) (-1828.655) -- 0:01:26 34000 -- (-1842.734) (-1836.889) [-1832.840] (-1829.521) * [-1828.491] (-1828.130) (-1828.232) (-1827.033) -- 0:01:25 34500 -- (-1843.050) (-1833.960) [-1838.261] (-1827.914) * (-1828.263) (-1827.801) [-1827.206] (-1828.240) -- 0:01:23 35000 -- [-1832.584] (-1836.172) (-1835.550) (-1828.520) * (-1828.514) (-1828.556) [-1827.100] (-1828.219) -- 0:01:22 Average standard deviation of split frequencies: 0.023432 35500 -- [-1826.748] (-1837.880) (-1843.471) (-1829.253) * (-1830.726) [-1828.417] (-1831.353) (-1827.977) -- 0:01:21 36000 -- (-1828.804) (-1842.536) [-1837.040] (-1829.100) * (-1831.770) (-1828.262) [-1827.540] (-1831.213) -- 0:01:47 36500 -- (-1828.934) (-1838.519) [-1840.103] (-1828.757) * (-1828.064) (-1828.959) [-1828.096] (-1829.950) -- 0:01:45 37000 -- [-1830.546] (-1831.975) (-1840.250) (-1829.050) * [-1827.018] (-1831.318) (-1827.708) (-1829.819) -- 0:01:44 37500 -- (-1831.391) [-1839.970] (-1836.210) (-1829.553) * (-1828.525) [-1828.376] (-1828.256) (-1829.547) -- 0:01:42 38000 -- [-1830.000] (-1842.765) (-1835.679) (-1830.838) * [-1828.292] (-1831.943) (-1827.401) (-1831.410) -- 0:01:41 38500 -- (-1830.000) (-1836.753) (-1836.046) [-1829.675] * (-1829.288) (-1832.005) [-1827.366] (-1831.459) -- 0:01:39 39000 -- (-1827.940) (-1831.698) [-1834.854] (-1827.418) * (-1829.577) (-1832.857) [-1827.469] (-1829.743) -- 0:01:38 39500 -- [-1828.665] (-1842.012) (-1836.144) (-1827.518) * [-1829.534] (-1832.861) (-1829.204) (-1831.480) -- 0:01:37 40000 -- (-1828.777) (-1846.393) (-1837.156) [-1827.696] * (-1832.586) (-1830.744) [-1827.664] (-1828.514) -- 0:01:36 Average standard deviation of split frequencies: 0.033412 40500 -- (-1828.520) (-1836.420) [-1839.977] (-1829.070) * (-1832.890) (-1827.144) (-1829.422) [-1827.005] -- 0:01:34 41000 -- (-1828.529) [-1833.656] (-1838.537) (-1828.210) * (-1836.137) (-1827.926) [-1828.582] (-1826.964) -- 0:01:33 41500 -- (-1828.465) (-1834.272) (-1844.623) [-1828.111] * (-1830.901) (-1829.527) (-1828.026) [-1826.950] -- 0:01:32 42000 -- (-1828.579) (-1841.925) [-1837.696] (-1828.386) * [-1831.423] (-1828.179) (-1828.721) (-1828.191) -- 0:01:31 42500 -- (-1833.605) (-1837.028) [-1839.744] (-1828.482) * (-1830.227) [-1826.536] (-1828.987) (-1829.334) -- 0:01:30 43000 -- [-1831.677] (-1839.915) (-1832.593) (-1830.604) * (-1829.149) (-1826.831) (-1832.365) [-1826.721] -- 0:01:29 43500 -- (-1828.952) [-1840.961] (-1847.482) (-1828.571) * (-1830.575) (-1835.772) [-1830.642] (-1826.721) -- 0:01:27 44000 -- (-1828.488) (-1840.333) [-1845.848] (-1827.484) * [-1831.049] (-1837.296) (-1828.405) (-1826.713) -- 0:01:26 44500 -- [-1830.560] (-1852.036) (-1830.379) (-1828.408) * (-1830.712) (-1835.962) (-1830.197) [-1833.046] -- 0:01:25 45000 -- [-1829.117] (-1833.338) (-1828.443) (-1829.475) * (-1828.650) (-1831.863) [-1830.590] (-1832.652) -- 0:01:24 Average standard deviation of split frequencies: 0.033073 45500 -- (-1831.944) [-1828.906] (-1828.482) (-1829.993) * (-1829.085) (-1829.433) (-1827.962) [-1830.908] -- 0:01:23 46000 -- (-1832.931) (-1829.310) [-1827.604] (-1830.208) * [-1827.167] (-1834.102) (-1828.125) (-1827.874) -- 0:01:22 46500 -- (-1831.304) (-1831.403) (-1827.607) [-1828.957] * (-1827.132) (-1833.337) (-1830.614) [-1827.001] -- 0:01:22 47000 -- (-1832.352) (-1832.814) [-1827.604] (-1829.385) * [-1827.024] (-1833.324) (-1829.181) (-1828.890) -- 0:01:21 47500 -- (-1830.244) [-1827.180] (-1830.005) (-1828.091) * (-1830.458) (-1833.385) (-1833.376) [-1828.162] -- 0:01:20 48000 -- (-1830.232) (-1827.070) [-1828.321] (-1828.298) * (-1827.913) (-1830.443) (-1830.065) [-1827.202] -- 0:01:39 48500 -- (-1831.010) (-1828.850) (-1827.400) [-1827.114] * (-1827.639) (-1829.043) (-1833.269) [-1829.057] -- 0:01:38 49000 -- (-1835.113) [-1830.391] (-1828.845) (-1828.475) * [-1827.452] (-1828.511) (-1834.369) (-1827.768) -- 0:01:37 49500 -- (-1838.483) (-1828.577) (-1829.172) [-1827.385] * [-1827.799] (-1830.568) (-1838.273) (-1827.640) -- 0:01:36 50000 -- (-1836.480) (-1828.169) (-1828.500) [-1833.902] * (-1826.701) (-1828.571) [-1828.059] (-1827.469) -- 0:01:35 Average standard deviation of split frequencies: 0.026982 50500 -- [-1829.337] (-1829.153) (-1830.830) (-1829.631) * [-1829.724] (-1827.534) (-1828.456) (-1829.543) -- 0:01:34 51000 -- [-1828.224] (-1828.379) (-1832.199) (-1829.631) * (-1827.259) [-1828.786] (-1827.330) (-1834.679) -- 0:01:33 51500 -- (-1833.086) [-1827.467] (-1828.435) (-1832.367) * [-1826.966] (-1828.590) (-1827.597) (-1834.770) -- 0:01:32 52000 -- (-1833.285) (-1827.258) [-1828.820] (-1827.139) * (-1826.933) [-1829.248] (-1826.897) (-1833.545) -- 0:01:31 52500 -- (-1828.082) [-1827.573] (-1829.618) (-1828.346) * (-1828.689) (-1827.902) (-1827.783) [-1835.352] -- 0:01:30 53000 -- (-1828.342) [-1827.785] (-1828.509) (-1828.821) * (-1829.180) [-1827.769] (-1827.053) (-1832.372) -- 0:01:29 53500 -- (-1828.342) (-1830.255) (-1829.558) [-1827.992] * (-1827.797) (-1829.590) [-1826.938] (-1831.172) -- 0:01:28 54000 -- [-1828.396] (-1830.255) (-1828.591) (-1827.845) * [-1828.951] (-1829.785) (-1828.130) (-1830.295) -- 0:01:27 54500 -- (-1829.022) (-1828.577) [-1831.237] (-1829.424) * (-1827.305) (-1827.924) [-1829.794] (-1831.467) -- 0:01:26 55000 -- (-1835.547) [-1826.803] (-1828.720) (-1828.743) * (-1827.424) (-1827.920) (-1828.337) [-1829.999] -- 0:01:25 Average standard deviation of split frequencies: 0.025254 55500 -- (-1830.520) [-1828.191] (-1829.205) (-1827.389) * (-1827.708) [-1829.206] (-1830.519) (-1828.446) -- 0:01:25 56000 -- (-1834.055) (-1829.887) (-1829.463) [-1829.523] * (-1827.874) (-1829.828) [-1828.773] (-1828.390) -- 0:01:24 56500 -- (-1832.401) (-1827.395) [-1829.985] (-1827.286) * (-1831.732) (-1831.304) (-1829.449) [-1830.787] -- 0:01:23 57000 -- (-1826.946) (-1830.217) [-1829.682] (-1827.284) * (-1830.147) (-1829.554) (-1832.381) [-1828.588] -- 0:01:22 57500 -- (-1826.919) (-1827.653) [-1830.643] (-1826.779) * [-1832.468] (-1830.459) (-1828.697) (-1828.179) -- 0:01:21 58000 -- [-1827.240] (-1830.878) (-1829.302) (-1827.303) * [-1828.647] (-1828.230) (-1830.517) (-1828.081) -- 0:01:21 58500 -- (-1827.218) (-1829.398) (-1827.979) [-1831.464] * (-1827.853) [-1830.467] (-1830.843) (-1831.452) -- 0:01:20 59000 -- (-1830.512) (-1829.900) [-1827.721] (-1829.374) * [-1828.554] (-1831.394) (-1831.754) (-1830.224) -- 0:01:19 59500 -- [-1830.558] (-1828.458) (-1828.213) (-1828.450) * [-1827.845] (-1833.716) (-1829.426) (-1828.201) -- 0:01:34 60000 -- (-1834.423) (-1829.433) (-1831.653) [-1828.879] * [-1829.698] (-1830.753) (-1828.208) (-1832.195) -- 0:01:34 Average standard deviation of split frequencies: 0.029037 60500 -- (-1835.088) (-1828.482) (-1828.278) [-1827.480] * [-1830.071] (-1831.379) (-1828.464) (-1829.682) -- 0:01:33 61000 -- [-1832.143] (-1828.537) (-1829.345) (-1834.391) * (-1830.774) (-1829.703) [-1829.057] (-1829.141) -- 0:01:32 61500 -- (-1833.805) (-1829.410) [-1829.255] (-1829.501) * (-1831.443) (-1834.081) [-1827.605] (-1831.382) -- 0:01:31 62000 -- (-1834.813) (-1829.191) (-1829.725) [-1826.486] * [-1827.703] (-1836.705) (-1827.654) (-1828.106) -- 0:01:30 62500 -- (-1832.069) (-1832.473) (-1830.697) [-1828.812] * [-1828.145] (-1833.436) (-1829.663) (-1828.269) -- 0:01:30 63000 -- (-1832.213) (-1829.587) [-1828.867] (-1828.221) * (-1828.228) [-1830.464] (-1829.508) (-1829.607) -- 0:01:29 63500 -- (-1826.888) (-1829.730) [-1830.834] (-1828.349) * (-1829.670) (-1827.909) [-1828.469] (-1829.194) -- 0:01:28 64000 -- (-1826.820) (-1830.125) [-1828.409] (-1829.119) * (-1829.275) (-1827.867) (-1828.698) [-1829.163] -- 0:01:27 64500 -- (-1826.790) [-1828.443] (-1827.383) (-1831.185) * (-1828.142) (-1830.193) [-1827.254] (-1834.770) -- 0:01:27 65000 -- (-1827.468) [-1828.706] (-1829.414) (-1830.753) * (-1830.468) [-1828.189] (-1827.255) (-1836.324) -- 0:01:26 Average standard deviation of split frequencies: 0.031971 65500 -- [-1827.661] (-1828.161) (-1827.564) (-1828.611) * (-1827.871) [-1827.266] (-1828.806) (-1827.537) -- 0:01:25 66000 -- (-1828.840) (-1829.348) (-1827.320) [-1827.645] * (-1827.702) [-1827.901] (-1827.530) (-1827.947) -- 0:01:24 66500 -- (-1828.152) [-1829.776] (-1828.307) (-1827.644) * (-1828.263) (-1828.151) [-1827.321] (-1828.389) -- 0:01:24 67000 -- [-1827.602] (-1829.129) (-1828.539) (-1828.795) * [-1828.114] (-1829.879) (-1827.392) (-1828.569) -- 0:01:23 67500 -- (-1828.793) (-1830.035) [-1834.366] (-1832.450) * [-1829.492] (-1832.157) (-1829.034) (-1829.379) -- 0:01:22 68000 -- (-1830.567) [-1827.569] (-1834.126) (-1831.421) * (-1827.387) (-1827.474) [-1829.249] (-1827.744) -- 0:01:22 68500 -- (-1828.912) (-1827.923) (-1827.735) [-1827.734] * (-1828.548) (-1826.927) (-1829.256) [-1827.502] -- 0:01:21 69000 -- (-1830.878) [-1828.017] (-1828.772) (-1827.777) * [-1828.759] (-1826.690) (-1826.519) (-1828.865) -- 0:01:20 69500 -- (-1831.750) (-1827.841) [-1833.014] (-1826.541) * (-1828.668) [-1826.594] (-1827.216) (-1828.311) -- 0:01:20 70000 -- (-1830.539) (-1829.721) [-1829.169] (-1827.565) * (-1828.955) [-1828.181] (-1828.649) (-1831.716) -- 0:01:19 Average standard deviation of split frequencies: 0.029352 70500 -- (-1828.486) [-1828.080] (-1830.792) (-1828.654) * (-1828.961) (-1829.641) [-1827.482] (-1831.068) -- 0:01:19 71000 -- (-1830.280) (-1828.641) (-1835.874) [-1827.946] * (-1830.367) [-1828.208] (-1831.024) (-1831.069) -- 0:01:31 71500 -- [-1831.233] (-1831.380) (-1830.253) (-1831.887) * (-1831.969) (-1826.414) (-1828.426) [-1830.920] -- 0:01:30 72000 -- (-1831.217) (-1828.164) (-1828.578) [-1828.682] * (-1831.949) [-1827.095] (-1826.780) (-1831.673) -- 0:01:30 72500 -- (-1832.351) (-1828.227) (-1827.792) [-1828.956] * (-1829.927) (-1828.390) [-1829.694] (-1830.372) -- 0:01:29 73000 -- (-1829.114) (-1830.602) [-1827.829] (-1828.821) * (-1829.616) (-1829.650) (-1828.849) [-1829.137] -- 0:01:28 73500 -- (-1829.755) (-1830.433) [-1829.157] (-1828.875) * (-1830.979) [-1828.768] (-1829.682) (-1828.515) -- 0:01:28 74000 -- (-1829.488) [-1827.895] (-1830.072) (-1830.305) * (-1831.365) [-1832.549] (-1829.631) (-1833.599) -- 0:01:27 74500 -- [-1828.542] (-1828.037) (-1829.017) (-1829.641) * (-1827.542) (-1832.602) [-1827.580] (-1831.219) -- 0:01:26 75000 -- (-1829.391) (-1828.049) (-1829.585) [-1828.285] * (-1826.414) [-1831.704] (-1826.678) (-1829.819) -- 0:01:26 Average standard deviation of split frequencies: 0.027602 75500 -- (-1829.618) (-1829.316) [-1826.537] (-1830.582) * [-1827.772] (-1832.845) (-1827.075) (-1829.708) -- 0:01:25 76000 -- (-1827.608) (-1828.128) [-1827.646] (-1827.336) * (-1827.191) (-1832.414) [-1829.740] (-1829.029) -- 0:01:25 76500 -- [-1828.174] (-1831.130) (-1827.065) (-1828.120) * (-1828.543) (-1830.205) (-1827.384) [-1827.398] -- 0:01:24 77000 -- (-1829.558) (-1832.467) [-1827.295] (-1827.833) * (-1826.587) (-1830.181) [-1828.587] (-1828.025) -- 0:01:23 77500 -- [-1829.412] (-1831.172) (-1826.894) (-1828.153) * (-1830.445) (-1829.034) (-1828.824) [-1826.491] -- 0:01:23 78000 -- (-1830.489) [-1828.222] (-1827.725) (-1828.248) * (-1828.825) (-1828.209) [-1829.666] (-1828.084) -- 0:01:22 78500 -- (-1828.888) [-1828.550] (-1826.607) (-1827.189) * [-1830.559] (-1830.371) (-1829.748) (-1828.180) -- 0:01:22 79000 -- (-1828.515) (-1829.187) [-1827.416] (-1827.437) * [-1828.953] (-1829.339) (-1828.232) (-1830.774) -- 0:01:21 79500 -- (-1828.561) [-1827.617] (-1827.046) (-1827.140) * (-1833.520) (-1828.937) [-1828.435] (-1827.352) -- 0:01:21 80000 -- (-1828.987) [-1828.255] (-1831.641) (-1828.368) * (-1836.685) (-1828.955) (-1828.085) [-1829.736] -- 0:01:20 Average standard deviation of split frequencies: 0.026759 80500 -- (-1827.356) (-1828.580) [-1831.858] (-1827.288) * (-1833.435) (-1829.171) (-1829.629) [-1829.871] -- 0:01:19 81000 -- [-1828.601] (-1829.465) (-1830.048) (-1831.224) * (-1829.348) (-1829.130) (-1832.091) [-1829.303] -- 0:01:19 81500 -- [-1827.468] (-1829.014) (-1827.393) (-1828.009) * (-1831.149) (-1828.425) [-1828.742] (-1831.316) -- 0:01:18 82000 -- (-1829.178) (-1828.224) (-1827.122) [-1827.429] * (-1828.077) [-1828.162] (-1830.504) (-1831.449) -- 0:01:18 82500 -- [-1828.548] (-1827.697) (-1828.527) (-1827.880) * (-1828.253) (-1830.059) [-1828.640] (-1829.652) -- 0:01:28 83000 -- (-1831.113) (-1826.570) [-1829.892] (-1827.774) * (-1828.251) (-1828.815) (-1827.567) [-1828.542] -- 0:01:28 83500 -- (-1829.526) [-1826.823] (-1829.405) (-1827.393) * (-1827.634) (-1827.600) [-1827.240] (-1829.160) -- 0:01:27 84000 -- (-1827.458) (-1828.929) [-1830.014] (-1828.050) * [-1829.240] (-1827.951) (-1828.110) (-1829.766) -- 0:01:27 84500 -- [-1828.046] (-1827.454) (-1830.841) (-1828.326) * [-1827.526] (-1827.998) (-1830.838) (-1831.100) -- 0:01:26 85000 -- [-1828.829] (-1829.568) (-1830.171) (-1829.205) * [-1830.516] (-1829.220) (-1830.714) (-1831.774) -- 0:01:26 Average standard deviation of split frequencies: 0.026311 85500 -- [-1828.490] (-1826.862) (-1830.600) (-1829.204) * (-1828.173) (-1827.487) [-1831.216] (-1831.056) -- 0:01:25 86000 -- (-1830.291) (-1828.975) (-1830.401) [-1827.564] * (-1828.120) [-1831.956] (-1829.638) (-1831.100) -- 0:01:25 86500 -- [-1828.200] (-1828.739) (-1830.211) (-1830.785) * [-1828.245] (-1827.814) (-1829.838) (-1832.198) -- 0:01:24 87000 -- (-1827.663) (-1829.094) [-1829.179] (-1827.667) * (-1829.142) (-1831.199) [-1829.100] (-1831.484) -- 0:01:23 87500 -- (-1827.728) (-1830.258) (-1831.154) [-1827.254] * (-1830.238) (-1840.964) [-1828.498] (-1830.507) -- 0:01:23 88000 -- (-1829.961) [-1829.016] (-1831.537) (-1827.416) * (-1826.973) (-1838.661) [-1827.989] (-1827.934) -- 0:01:22 88500 -- (-1827.637) (-1830.167) (-1828.875) [-1831.343] * (-1827.395) (-1829.313) (-1827.251) [-1828.315] -- 0:01:22 89000 -- (-1828.599) [-1831.189] (-1828.233) (-1830.692) * (-1827.355) (-1829.719) (-1827.619) [-1827.156] -- 0:01:21 89500 -- [-1829.134] (-1830.857) (-1827.512) (-1829.673) * (-1829.818) (-1829.213) [-1826.847] (-1828.270) -- 0:01:21 90000 -- (-1827.482) (-1832.167) (-1827.575) [-1827.811] * (-1827.775) (-1829.155) [-1828.540] (-1832.525) -- 0:01:20 Average standard deviation of split frequencies: 0.025079 90500 -- (-1828.009) (-1831.396) (-1829.354) [-1827.925] * (-1828.437) [-1828.249] (-1829.043) (-1830.829) -- 0:01:20 91000 -- [-1828.278] (-1832.631) (-1829.937) (-1827.234) * (-1830.108) (-1826.705) [-1827.870] (-1828.632) -- 0:01:19 91500 -- (-1828.292) [-1829.139] (-1828.323) (-1828.005) * (-1831.724) (-1827.508) [-1827.243] (-1828.148) -- 0:01:19 92000 -- (-1827.752) (-1828.438) [-1827.828] (-1831.264) * (-1833.009) [-1827.246] (-1826.868) (-1833.007) -- 0:01:18 92500 -- (-1827.280) (-1828.211) (-1828.801) [-1827.718] * (-1832.268) (-1826.662) [-1827.384] (-1829.402) -- 0:01:18 93000 -- (-1830.004) (-1828.394) (-1829.380) [-1830.203] * (-1831.499) (-1832.820) [-1827.856] (-1829.366) -- 0:01:18 93500 -- (-1829.256) (-1829.169) (-1826.971) [-1828.646] * (-1831.911) [-1828.813] (-1827.783) (-1827.513) -- 0:01:17 94000 -- (-1826.766) (-1827.646) (-1830.226) [-1827.141] * (-1833.538) (-1827.500) (-1827.035) [-1826.950] -- 0:01:26 94500 -- (-1829.137) (-1828.337) (-1828.346) [-1826.807] * (-1829.279) (-1827.778) [-1827.595] (-1827.799) -- 0:01:26 95000 -- [-1827.601] (-1827.514) (-1827.892) (-1827.109) * [-1831.015] (-1828.954) (-1828.739) (-1827.081) -- 0:01:25 Average standard deviation of split frequencies: 0.023188 95500 -- [-1830.327] (-1827.952) (-1828.797) (-1828.468) * (-1827.607) (-1828.043) [-1826.809] (-1826.406) -- 0:01:25 96000 -- (-1832.363) (-1827.475) [-1829.195] (-1827.491) * [-1828.479] (-1832.600) (-1827.577) (-1826.894) -- 0:01:24 96500 -- (-1829.212) [-1829.466] (-1827.318) (-1828.515) * (-1826.899) (-1832.732) [-1826.834] (-1827.354) -- 0:01:24 97000 -- [-1827.110] (-1830.228) (-1827.160) (-1827.185) * [-1828.618] (-1831.947) (-1828.603) (-1834.425) -- 0:01:23 97500 -- [-1828.164] (-1829.555) (-1828.654) (-1831.334) * (-1831.998) [-1830.429] (-1826.571) (-1830.534) -- 0:01:23 98000 -- (-1828.164) (-1830.953) (-1828.779) [-1828.669] * (-1831.119) (-1829.841) (-1829.847) [-1831.562] -- 0:01:22 98500 -- [-1827.210] (-1830.701) (-1832.420) (-1830.041) * [-1834.808] (-1830.050) (-1829.892) (-1833.178) -- 0:01:22 99000 -- (-1829.213) (-1830.187) [-1832.676] (-1827.879) * [-1828.291] (-1829.489) (-1833.488) (-1830.684) -- 0:01:21 99500 -- (-1828.966) (-1827.038) [-1831.318] (-1827.620) * [-1826.649] (-1828.566) (-1827.226) (-1830.039) -- 0:01:21 100000 -- (-1826.843) (-1833.936) (-1838.277) [-1827.725] * (-1828.602) (-1829.999) [-1827.503] (-1829.752) -- 0:01:21 Average standard deviation of split frequencies: 0.023674 100500 -- (-1827.397) [-1831.135] (-1829.095) (-1826.878) * (-1829.442) [-1827.171] (-1827.740) (-1830.195) -- 0:01:20 101000 -- [-1828.656] (-1831.139) (-1828.288) (-1827.834) * (-1827.908) (-1828.625) [-1828.208] (-1831.457) -- 0:01:20 101500 -- [-1827.831] (-1828.655) (-1828.912) (-1827.211) * (-1829.092) (-1834.350) (-1832.693) [-1828.325] -- 0:01:19 102000 -- (-1827.534) (-1828.476) [-1828.333] (-1829.200) * [-1828.009] (-1828.038) (-1829.097) (-1828.882) -- 0:01:19 102500 -- (-1830.395) [-1826.523] (-1829.488) (-1830.794) * (-1828.009) (-1829.730) (-1827.182) [-1831.294] -- 0:01:18 103000 -- (-1830.723) (-1828.377) [-1830.582] (-1826.851) * [-1827.864] (-1829.008) (-1829.069) (-1827.267) -- 0:01:18 103500 -- [-1829.262] (-1826.938) (-1829.954) (-1830.458) * (-1828.198) (-1828.253) [-1827.989] (-1828.630) -- 0:01:17 104000 -- [-1833.664] (-1826.578) (-1830.426) (-1830.359) * (-1828.619) (-1832.802) (-1831.018) [-1827.850] -- 0:01:17 104500 -- (-1830.947) (-1827.049) (-1830.810) [-1827.945] * (-1829.224) (-1827.727) (-1830.514) [-1828.047] -- 0:01:17 105000 -- (-1830.465) (-1827.049) [-1827.831] (-1828.678) * [-1829.616] (-1828.559) (-1834.295) (-1827.295) -- 0:01:16 Average standard deviation of split frequencies: 0.021347 105500 -- [-1834.500] (-1830.597) (-1828.341) (-1828.798) * (-1829.021) (-1830.478) [-1830.212] (-1827.362) -- 0:01:24 106000 -- (-1826.970) (-1827.515) (-1829.100) [-1827.671] * (-1832.520) [-1829.216] (-1827.924) (-1829.474) -- 0:01:24 106500 -- (-1827.189) (-1832.287) (-1827.745) [-1826.519] * (-1831.751) (-1830.727) [-1830.844] (-1829.849) -- 0:01:23 107000 -- (-1828.443) (-1826.752) (-1827.426) [-1826.923] * (-1829.685) (-1830.691) [-1830.970] (-1829.137) -- 0:01:23 107500 -- (-1830.838) [-1829.825] (-1833.668) (-1827.814) * (-1827.115) (-1832.437) [-1829.606] (-1827.634) -- 0:01:23 108000 -- [-1828.560] (-1829.079) (-1830.358) (-1827.392) * (-1827.459) (-1831.641) [-1828.845] (-1827.554) -- 0:01:22 108500 -- (-1831.731) [-1827.858] (-1828.426) (-1828.370) * (-1828.172) (-1827.413) [-1827.975] (-1828.122) -- 0:01:22 109000 -- (-1838.078) [-1831.279] (-1830.889) (-1829.374) * [-1826.856] (-1827.180) (-1829.328) (-1828.473) -- 0:01:21 109500 -- [-1832.546] (-1829.757) (-1831.890) (-1829.603) * (-1830.307) (-1827.041) (-1828.124) [-1826.796] -- 0:01:21 110000 -- (-1829.020) (-1831.883) (-1832.103) [-1829.780] * (-1830.063) [-1830.908] (-1827.462) (-1828.797) -- 0:01:20 Average standard deviation of split frequencies: 0.021535 110500 -- (-1828.427) (-1831.828) [-1827.810] (-1827.236) * (-1829.472) (-1834.380) (-1833.687) [-1826.868] -- 0:01:20 111000 -- (-1828.253) (-1833.194) [-1827.729] (-1827.707) * (-1828.741) (-1828.783) [-1829.678] (-1827.839) -- 0:01:20 111500 -- (-1829.263) (-1831.289) (-1831.604) [-1830.342] * (-1828.590) (-1828.142) (-1833.019) [-1830.741] -- 0:01:19 112000 -- [-1828.946] (-1835.068) (-1833.682) (-1828.609) * [-1828.708] (-1829.490) (-1830.932) (-1828.551) -- 0:01:19 112500 -- (-1828.457) [-1828.708] (-1831.402) (-1829.209) * (-1831.514) (-1830.312) (-1829.820) [-1827.389] -- 0:01:18 113000 -- (-1829.492) [-1828.830] (-1830.686) (-1829.042) * (-1830.175) (-1828.771) (-1829.251) [-1827.863] -- 0:01:18 113500 -- [-1827.602] (-1830.548) (-1827.289) (-1830.574) * (-1828.953) [-1828.922] (-1828.037) (-1828.782) -- 0:01:18 114000 -- (-1827.352) (-1828.937) [-1826.939] (-1827.811) * (-1832.289) [-1831.740] (-1834.824) (-1827.536) -- 0:01:17 114500 -- (-1828.557) (-1829.484) [-1830.613] (-1828.084) * (-1828.011) (-1829.012) (-1828.585) [-1827.809] -- 0:01:17 115000 -- [-1828.220] (-1827.389) (-1829.852) (-1827.475) * (-1828.756) (-1826.452) (-1827.636) [-1828.293] -- 0:01:16 Average standard deviation of split frequencies: 0.020747 115500 -- (-1831.190) (-1827.205) (-1828.424) [-1828.815] * [-1830.582] (-1826.805) (-1827.138) (-1828.298) -- 0:01:16 116000 -- (-1828.714) (-1827.902) [-1827.615] (-1830.405) * (-1826.772) (-1830.194) (-1826.696) [-1828.044] -- 0:01:16 116500 -- (-1830.745) (-1828.103) (-1829.475) [-1830.468] * [-1826.956] (-1830.418) (-1827.572) (-1828.622) -- 0:01:15 117000 -- [-1829.461] (-1829.117) (-1829.241) (-1827.603) * (-1829.546) [-1830.172] (-1830.168) (-1827.868) -- 0:01:23 117500 -- [-1827.335] (-1827.199) (-1828.923) (-1828.065) * (-1828.785) [-1829.860] (-1828.665) (-1830.928) -- 0:01:22 118000 -- (-1829.932) [-1827.712] (-1830.502) (-1828.015) * (-1830.644) (-1831.497) (-1828.572) [-1828.501] -- 0:01:22 118500 -- (-1835.511) [-1827.407] (-1831.155) (-1827.804) * (-1826.786) (-1832.056) (-1829.479) [-1828.138] -- 0:01:21 119000 -- [-1826.611] (-1827.577) (-1828.985) (-1828.989) * (-1828.597) (-1835.533) (-1828.528) [-1828.105] -- 0:01:21 119500 -- (-1828.831) (-1828.688) [-1828.427] (-1834.955) * [-1829.112] (-1839.221) (-1831.690) (-1827.488) -- 0:01:21 120000 -- (-1827.516) (-1827.224) [-1829.288] (-1828.619) * (-1830.006) (-1834.285) [-1827.867] (-1828.175) -- 0:01:20 Average standard deviation of split frequencies: 0.018665 120500 -- (-1829.995) [-1827.671] (-1835.051) (-1827.659) * (-1826.996) [-1828.445] (-1827.085) (-1827.729) -- 0:01:20 121000 -- (-1830.888) (-1832.277) [-1829.782] (-1828.817) * [-1828.354] (-1827.349) (-1828.141) (-1827.363) -- 0:01:19 121500 -- [-1831.869] (-1835.008) (-1828.265) (-1828.554) * (-1828.524) (-1837.630) [-1827.375] (-1828.470) -- 0:01:19 122000 -- [-1831.798] (-1828.436) (-1829.460) (-1828.429) * (-1827.341) [-1835.088] (-1827.375) (-1826.835) -- 0:01:19 122500 -- (-1827.112) (-1828.824) [-1827.977] (-1827.952) * (-1827.954) (-1828.513) [-1828.594] (-1827.217) -- 0:01:18 123000 -- (-1828.561) (-1828.243) [-1828.819] (-1829.712) * (-1833.273) [-1828.229] (-1826.885) (-1829.804) -- 0:01:18 123500 -- (-1828.077) (-1827.919) [-1826.724] (-1830.755) * [-1829.740] (-1829.108) (-1827.211) (-1830.156) -- 0:01:18 124000 -- [-1829.647] (-1829.551) (-1827.412) (-1829.713) * [-1829.481] (-1828.915) (-1829.949) (-1829.759) -- 0:01:17 124500 -- (-1827.396) (-1830.639) [-1827.276] (-1829.727) * (-1829.562) (-1827.392) (-1827.963) [-1828.076] -- 0:01:17 125000 -- (-1828.140) (-1828.495) [-1827.714] (-1830.960) * (-1828.384) (-1832.489) [-1828.381] (-1827.886) -- 0:01:17 Average standard deviation of split frequencies: 0.018196 125500 -- (-1828.840) (-1828.512) [-1828.647] (-1828.779) * (-1830.624) (-1830.295) [-1829.436] (-1828.591) -- 0:01:16 126000 -- (-1827.631) [-1827.546] (-1827.250) (-1828.779) * (-1833.203) [-1828.286] (-1832.468) (-1829.732) -- 0:01:16 126500 -- (-1828.008) (-1827.292) [-1826.462] (-1828.724) * (-1835.861) (-1831.186) (-1828.154) [-1827.976] -- 0:01:15 127000 -- (-1827.575) (-1826.498) (-1827.410) [-1828.000] * (-1830.030) (-1829.649) [-1830.204] (-1828.722) -- 0:01:15 127500 -- (-1828.567) (-1828.563) (-1828.069) [-1828.208] * (-1832.649) (-1827.781) [-1828.365] (-1829.910) -- 0:01:15 128000 -- (-1827.912) (-1828.651) [-1827.359] (-1827.758) * (-1829.198) [-1827.523] (-1827.798) (-1829.980) -- 0:01:14 128500 -- (-1827.088) (-1828.824) (-1827.715) [-1828.235] * (-1828.130) (-1828.952) [-1827.574] (-1828.586) -- 0:01:14 129000 -- (-1832.917) (-1835.436) [-1827.453] (-1831.215) * (-1831.245) (-1829.260) (-1829.762) [-1828.843] -- 0:01:21 129500 -- (-1832.661) (-1833.674) [-1829.439] (-1829.545) * (-1830.212) [-1830.584] (-1827.764) (-1827.776) -- 0:01:20 130000 -- (-1828.108) (-1834.426) (-1827.025) [-1830.201] * (-1830.287) (-1827.331) (-1828.011) [-1827.557] -- 0:01:20 Average standard deviation of split frequencies: 0.016664 130500 -- (-1828.473) (-1830.519) [-1827.521] (-1830.156) * (-1828.183) [-1830.003] (-1826.808) (-1833.532) -- 0:01:19 131000 -- (-1828.710) (-1830.024) [-1829.338] (-1833.012) * [-1826.894] (-1833.016) (-1827.559) (-1829.510) -- 0:01:19 131500 -- (-1827.572) (-1827.982) [-1832.735] (-1830.879) * (-1827.383) (-1830.922) [-1830.885] (-1828.161) -- 0:01:19 132000 -- (-1829.260) (-1827.571) [-1829.264] (-1829.423) * [-1827.378] (-1830.909) (-1827.717) (-1830.157) -- 0:01:18 132500 -- (-1828.281) (-1829.795) [-1827.427] (-1828.848) * (-1831.969) [-1832.526] (-1827.518) (-1826.861) -- 0:01:18 133000 -- (-1826.971) (-1829.658) [-1828.612] (-1831.637) * (-1829.121) (-1831.730) (-1827.706) [-1826.861] -- 0:01:18 133500 -- [-1827.960] (-1832.752) (-1827.790) (-1830.525) * (-1831.095) (-1833.184) (-1829.011) [-1827.354] -- 0:01:17 134000 -- [-1826.808] (-1829.439) (-1827.291) (-1834.815) * (-1828.934) (-1827.987) (-1829.996) [-1827.802] -- 0:01:17 134500 -- (-1827.373) [-1829.952] (-1828.355) (-1831.591) * (-1829.012) (-1827.947) [-1827.203] (-1829.400) -- 0:01:17 135000 -- (-1827.357) (-1828.783) (-1828.547) [-1827.265] * (-1829.121) (-1829.789) (-1829.842) [-1828.713] -- 0:01:16 Average standard deviation of split frequencies: 0.017661 135500 -- (-1828.473) [-1826.854] (-1830.104) (-1827.469) * [-1828.074] (-1829.777) (-1828.819) (-1828.908) -- 0:01:16 136000 -- (-1828.005) (-1829.542) [-1829.206] (-1827.583) * (-1830.101) (-1835.296) (-1828.264) [-1828.924] -- 0:01:16 136500 -- (-1826.669) [-1827.731] (-1833.434) (-1827.621) * (-1830.305) [-1830.079] (-1829.477) (-1830.966) -- 0:01:15 137000 -- (-1829.042) [-1828.317] (-1833.211) (-1827.168) * (-1830.949) [-1828.829] (-1829.482) (-1826.774) -- 0:01:15 137500 -- (-1830.391) (-1828.816) [-1829.101] (-1829.146) * [-1830.104] (-1829.116) (-1829.376) (-1830.187) -- 0:01:15 138000 -- [-1831.648] (-1827.441) (-1828.983) (-1829.794) * (-1827.879) (-1831.552) [-1827.116] (-1830.017) -- 0:01:14 138500 -- (-1830.713) (-1827.489) (-1826.885) [-1829.540] * [-1826.459] (-1828.226) (-1828.066) (-1828.491) -- 0:01:14 139000 -- (-1830.103) (-1827.799) (-1827.966) [-1831.382] * (-1831.464) (-1827.797) [-1827.565] (-1828.796) -- 0:01:14 139500 -- (-1831.570) [-1827.359] (-1827.212) (-1837.514) * (-1827.259) (-1828.424) (-1828.016) [-1827.814] -- 0:01:14 140000 -- (-1828.656) (-1828.663) (-1827.169) [-1828.769] * (-1828.294) (-1830.691) [-1827.566] (-1829.155) -- 0:01:13 Average standard deviation of split frequencies: 0.015080 140500 -- (-1827.704) [-1827.910] (-1828.632) (-1828.476) * (-1827.512) [-1827.030] (-1829.456) (-1828.138) -- 0:01:19 141000 -- (-1828.171) (-1831.166) (-1829.254) [-1829.466] * (-1829.505) (-1827.273) (-1832.127) [-1828.977] -- 0:01:19 141500 -- (-1830.033) (-1829.995) (-1826.540) [-1827.657] * (-1829.961) [-1827.438] (-1834.870) (-1830.857) -- 0:01:18 142000 -- (-1828.838) (-1831.801) (-1826.823) [-1827.726] * [-1827.720] (-1826.886) (-1835.380) (-1834.097) -- 0:01:18 142500 -- (-1828.611) (-1827.871) [-1827.177] (-1828.168) * [-1829.021] (-1826.712) (-1835.786) (-1829.436) -- 0:01:18 143000 -- (-1827.245) (-1830.278) [-1829.932] (-1828.090) * (-1829.462) (-1830.132) (-1830.878) [-1833.125] -- 0:01:17 143500 -- (-1830.823) [-1828.630] (-1827.414) (-1828.973) * (-1830.989) [-1828.775] (-1831.694) (-1831.874) -- 0:01:17 144000 -- (-1831.924) (-1828.661) (-1827.592) [-1830.873] * (-1830.715) (-1830.003) (-1830.504) [-1829.904] -- 0:01:17 144500 -- (-1829.732) (-1827.697) (-1827.668) [-1829.276] * [-1829.018] (-1828.777) (-1831.819) (-1828.515) -- 0:01:16 145000 -- (-1828.847) (-1826.859) (-1828.060) [-1829.599] * (-1829.946) (-1828.252) (-1834.704) [-1830.036] -- 0:01:16 Average standard deviation of split frequencies: 0.017067 145500 -- (-1829.368) [-1828.122] (-1828.103) (-1828.443) * (-1829.666) (-1830.296) [-1830.870] (-1832.704) -- 0:01:16 146000 -- [-1829.034] (-1832.526) (-1834.743) (-1827.947) * (-1828.315) [-1826.971] (-1832.440) (-1827.147) -- 0:01:16 146500 -- (-1829.844) (-1831.124) [-1829.117] (-1828.890) * (-1827.837) (-1827.901) [-1828.067] (-1827.927) -- 0:01:15 147000 -- [-1829.049] (-1831.868) (-1827.095) (-1829.650) * [-1826.853] (-1830.010) (-1829.073) (-1827.263) -- 0:01:15 147500 -- (-1828.408) (-1827.480) [-1827.648] (-1828.508) * [-1826.854] (-1829.752) (-1828.498) (-1826.602) -- 0:01:15 148000 -- (-1830.134) [-1827.605] (-1829.244) (-1827.806) * [-1828.473] (-1827.140) (-1827.900) (-1826.980) -- 0:01:14 148500 -- (-1828.692) (-1828.467) (-1827.565) [-1828.248] * (-1828.508) (-1828.350) (-1827.760) [-1829.401] -- 0:01:14 149000 -- (-1827.655) (-1827.304) (-1830.629) [-1828.260] * [-1827.513] (-1828.526) (-1827.958) (-1834.432) -- 0:01:14 149500 -- [-1827.458] (-1833.552) (-1829.555) (-1827.759) * [-1827.218] (-1828.885) (-1828.183) (-1828.714) -- 0:01:13 150000 -- [-1827.387] (-1832.695) (-1830.383) (-1828.217) * (-1827.429) (-1827.755) (-1828.198) [-1827.722] -- 0:01:13 Average standard deviation of split frequencies: 0.016687 150500 -- [-1827.138] (-1829.242) (-1829.951) (-1828.364) * (-1827.922) (-1828.580) (-1827.984) [-1831.774] -- 0:01:13 151000 -- (-1831.964) [-1829.834] (-1830.719) (-1829.222) * (-1829.372) (-1829.068) (-1827.149) [-1828.726] -- 0:01:13 151500 -- [-1828.845] (-1829.743) (-1828.962) (-1828.930) * (-1831.702) [-1827.697] (-1829.270) (-1829.463) -- 0:01:12 152000 -- (-1828.892) (-1830.843) (-1827.977) [-1830.759] * (-1835.314) (-1826.677) (-1829.163) [-1828.849] -- 0:01:18 152500 -- [-1828.314] (-1833.634) (-1827.963) (-1831.935) * (-1832.324) (-1828.119) [-1831.105] (-1828.694) -- 0:01:17 153000 -- (-1828.434) (-1830.906) (-1827.431) [-1830.596] * (-1835.084) (-1831.951) [-1826.864] (-1829.025) -- 0:01:17 153500 -- (-1828.448) [-1830.261] (-1827.452) (-1830.592) * (-1830.349) (-1828.543) [-1827.782] (-1829.879) -- 0:01:17 154000 -- (-1828.374) (-1831.836) [-1827.440] (-1828.993) * (-1827.604) (-1829.041) [-1830.210] (-1830.389) -- 0:01:16 154500 -- (-1837.996) (-1829.407) (-1830.817) [-1828.616] * [-1827.149] (-1828.452) (-1829.907) (-1827.537) -- 0:01:16 155000 -- (-1830.092) (-1829.114) [-1831.887] (-1830.765) * (-1826.499) (-1827.166) (-1827.300) [-1828.021] -- 0:01:16 Average standard deviation of split frequencies: 0.018282 155500 -- (-1829.599) (-1829.239) (-1830.632) [-1828.092] * (-1828.754) (-1827.863) [-1828.288] (-1829.148) -- 0:01:16 156000 -- (-1832.138) [-1828.480] (-1829.140) (-1828.839) * [-1829.235] (-1827.654) (-1826.861) (-1830.004) -- 0:01:15 156500 -- (-1831.287) (-1827.079) [-1826.478] (-1828.181) * [-1828.654] (-1827.337) (-1827.894) (-1829.287) -- 0:01:15 157000 -- (-1833.152) [-1827.079] (-1834.706) (-1830.458) * (-1827.691) (-1827.259) (-1828.146) [-1829.324] -- 0:01:15 157500 -- [-1829.539] (-1829.462) (-1831.557) (-1828.032) * [-1828.297] (-1829.055) (-1827.081) (-1835.641) -- 0:01:14 158000 -- (-1830.584) (-1830.035) (-1832.020) [-1832.357] * (-1830.077) (-1830.915) (-1828.656) [-1828.187] -- 0:01:14 158500 -- (-1831.341) (-1831.057) (-1829.412) [-1829.094] * (-1828.264) (-1830.278) [-1828.301] (-1827.456) -- 0:01:14 159000 -- (-1827.400) (-1827.454) (-1832.010) [-1827.865] * (-1828.585) (-1829.042) [-1828.869] (-1827.791) -- 0:01:14 159500 -- [-1827.024] (-1827.595) (-1832.276) (-1828.482) * [-1828.877] (-1828.517) (-1829.130) (-1833.843) -- 0:01:13 160000 -- (-1827.012) (-1828.875) [-1829.083] (-1828.927) * [-1828.731] (-1829.934) (-1831.198) (-1828.813) -- 0:01:13 Average standard deviation of split frequencies: 0.020392 160500 -- (-1828.289) (-1829.039) (-1829.523) [-1828.163] * (-1831.158) (-1829.506) [-1830.059] (-1830.530) -- 0:01:13 161000 -- (-1827.087) (-1829.646) (-1830.170) [-1827.945] * (-1828.698) (-1828.921) (-1829.513) [-1830.458] -- 0:01:12 161500 -- [-1826.336] (-1827.491) (-1828.044) (-1827.553) * [-1828.615] (-1828.442) (-1832.074) (-1834.315) -- 0:01:12 162000 -- (-1826.431) (-1826.731) [-1829.074] (-1827.792) * (-1831.402) (-1828.155) (-1830.162) [-1827.418] -- 0:01:12 162500 -- (-1827.956) (-1827.738) (-1830.041) [-1827.661] * [-1827.525] (-1828.710) (-1829.179) (-1828.459) -- 0:01:12 163000 -- (-1828.467) (-1828.440) [-1828.665] (-1830.194) * (-1828.166) (-1828.780) [-1829.689] (-1826.993) -- 0:01:11 163500 -- (-1829.978) [-1827.376] (-1829.471) (-1829.981) * (-1829.403) (-1830.216) [-1832.235] (-1826.995) -- 0:01:16 164000 -- (-1830.953) [-1827.120] (-1828.397) (-1827.746) * (-1827.055) (-1827.683) (-1827.440) [-1826.910] -- 0:01:16 164500 -- (-1828.578) [-1826.495] (-1830.505) (-1828.519) * (-1828.816) [-1828.317] (-1827.865) (-1826.853) -- 0:01:16 165000 -- (-1829.462) (-1826.598) [-1830.326] (-1831.933) * [-1828.323] (-1829.015) (-1827.741) (-1827.718) -- 0:01:15 Average standard deviation of split frequencies: 0.018601 165500 -- [-1827.264] (-1827.383) (-1829.443) (-1829.720) * (-1829.144) (-1829.721) (-1828.561) [-1827.258] -- 0:01:15 166000 -- (-1831.040) (-1832.718) (-1830.091) [-1831.220] * (-1829.253) (-1827.027) [-1830.642] (-1827.877) -- 0:01:15 166500 -- (-1830.176) [-1828.611] (-1828.619) (-1830.334) * (-1828.846) (-1830.515) (-1828.700) [-1828.185] -- 0:01:15 167000 -- (-1827.127) (-1829.981) (-1831.013) [-1828.912] * (-1827.699) (-1828.904) (-1830.156) [-1827.002] -- 0:01:14 167500 -- (-1827.099) (-1827.936) [-1827.411] (-1831.935) * [-1827.779] (-1831.685) (-1830.590) (-1827.052) -- 0:01:14 168000 -- (-1827.047) [-1827.517] (-1829.224) (-1830.480) * [-1827.779] (-1826.929) (-1828.886) (-1827.821) -- 0:01:14 168500 -- (-1829.162) [-1828.018] (-1831.883) (-1829.690) * (-1829.136) (-1826.929) [-1829.117] (-1827.256) -- 0:01:14 169000 -- [-1830.090] (-1827.895) (-1836.935) (-1829.275) * (-1828.467) (-1826.933) [-1828.847] (-1829.716) -- 0:01:13 169500 -- (-1828.451) [-1827.409] (-1830.574) (-1833.979) * (-1828.405) (-1829.938) [-1829.488] (-1829.387) -- 0:01:13 170000 -- [-1833.813] (-1829.853) (-1827.752) (-1833.309) * (-1829.182) (-1830.426) (-1829.960) [-1830.203] -- 0:01:13 Average standard deviation of split frequencies: 0.018172 170500 -- (-1829.312) (-1831.161) [-1827.533] (-1829.771) * (-1830.226) (-1828.516) [-1829.964] (-1829.210) -- 0:01:12 171000 -- (-1830.687) [-1828.733] (-1828.690) (-1830.229) * (-1827.923) (-1827.968) [-1828.707] (-1828.902) -- 0:01:12 171500 -- (-1828.684) (-1829.553) (-1829.936) [-1830.333] * (-1829.393) (-1827.201) (-1830.451) [-1828.124] -- 0:01:12 172000 -- (-1829.254) (-1835.117) [-1828.836] (-1827.961) * (-1829.461) (-1829.093) [-1830.554] (-1828.464) -- 0:01:12 172500 -- (-1829.267) (-1829.373) [-1828.493] (-1829.189) * (-1827.177) [-1828.392] (-1831.988) (-1831.201) -- 0:01:11 173000 -- (-1828.410) (-1829.663) [-1833.403] (-1827.871) * (-1827.843) (-1828.922) [-1829.698] (-1827.976) -- 0:01:11 173500 -- (-1827.287) (-1827.799) [-1834.596] (-1827.062) * (-1827.767) (-1827.533) [-1829.387] (-1828.370) -- 0:01:11 174000 -- (-1827.349) (-1830.241) [-1827.993] (-1828.260) * (-1827.766) (-1827.222) (-1830.569) [-1828.320] -- 0:01:11 174500 -- (-1828.451) (-1830.293) [-1828.013] (-1829.177) * (-1826.691) (-1827.185) (-1828.758) [-1828.312] -- 0:01:10 175000 -- (-1829.104) (-1828.561) [-1828.562] (-1827.535) * (-1830.603) (-1828.597) [-1827.322] (-1829.822) -- 0:01:15 Average standard deviation of split frequencies: 0.014731 175500 -- (-1828.425) [-1827.269] (-1826.880) (-1828.650) * (-1832.406) (-1828.204) (-1830.546) [-1826.780] -- 0:01:15 176000 -- (-1828.141) (-1827.420) [-1830.367] (-1828.502) * [-1831.531] (-1828.102) (-1829.816) (-1826.843) -- 0:01:14 176500 -- (-1829.518) [-1830.328] (-1830.614) (-1828.631) * (-1834.392) (-1828.899) (-1826.717) [-1829.198] -- 0:01:14 177000 -- (-1829.905) [-1828.063] (-1828.109) (-1827.397) * (-1833.964) [-1828.537] (-1827.729) (-1827.705) -- 0:01:14 177500 -- [-1829.524] (-1831.156) (-1830.105) (-1827.830) * (-1833.400) [-1829.194] (-1829.528) (-1830.083) -- 0:01:14 178000 -- [-1827.323] (-1832.661) (-1834.091) (-1830.896) * (-1830.118) (-1829.037) [-1828.186] (-1830.528) -- 0:01:13 178500 -- (-1831.252) [-1834.488] (-1836.394) (-1827.221) * (-1831.409) (-1829.148) (-1830.790) [-1828.222] -- 0:01:13 179000 -- (-1829.750) (-1832.200) [-1827.417] (-1827.341) * (-1829.948) (-1828.937) (-1829.701) [-1826.537] -- 0:01:13 179500 -- [-1829.605] (-1829.309) (-1828.001) (-1827.341) * (-1828.922) (-1828.950) [-1829.362] (-1827.477) -- 0:01:13 180000 -- [-1828.456] (-1828.369) (-1827.714) (-1829.934) * (-1827.012) (-1830.730) (-1826.936) [-1827.670] -- 0:01:12 Average standard deviation of split frequencies: 0.013699 180500 -- (-1828.444) (-1828.743) [-1830.478] (-1828.326) * (-1828.539) (-1831.264) (-1831.457) [-1827.664] -- 0:01:12 181000 -- (-1828.583) (-1828.685) (-1829.775) [-1827.724] * (-1831.519) (-1829.181) (-1831.415) [-1828.563] -- 0:01:12 181500 -- [-1832.392] (-1828.059) (-1828.691) (-1826.967) * (-1827.232) (-1831.358) [-1830.590] (-1828.972) -- 0:01:12 182000 -- [-1830.318] (-1827.137) (-1830.283) (-1828.233) * (-1827.167) (-1834.201) [-1832.805] (-1828.965) -- 0:01:11 182500 -- (-1830.834) [-1827.033] (-1828.462) (-1827.662) * (-1826.900) (-1831.873) [-1828.089] (-1828.306) -- 0:01:11 183000 -- [-1827.914] (-1827.076) (-1828.883) (-1826.767) * [-1827.723] (-1832.332) (-1829.803) (-1828.479) -- 0:01:11 183500 -- [-1827.513] (-1827.134) (-1829.497) (-1826.770) * (-1828.753) [-1829.496] (-1827.450) (-1830.527) -- 0:01:11 184000 -- (-1827.335) [-1828.184] (-1828.229) (-1826.909) * (-1831.614) (-1826.551) [-1828.143] (-1831.242) -- 0:01:10 184500 -- (-1829.071) (-1827.071) (-1827.731) [-1827.690] * (-1829.487) (-1827.573) [-1829.321] (-1833.243) -- 0:01:10 185000 -- (-1830.201) (-1827.205) [-1829.492] (-1829.294) * (-1828.034) (-1826.758) (-1830.600) [-1830.467] -- 0:01:10 Average standard deviation of split frequencies: 0.012250 185500 -- (-1828.109) (-1827.388) [-1828.743] (-1834.808) * (-1829.288) [-1830.152] (-1830.850) (-1832.605) -- 0:01:10 186000 -- (-1827.833) [-1830.959] (-1828.236) (-1830.897) * (-1831.296) (-1830.140) (-1829.385) [-1829.544] -- 0:01:10 186500 -- [-1828.829] (-1830.641) (-1828.431) (-1831.801) * (-1830.906) [-1828.685] (-1828.592) (-1828.674) -- 0:01:14 187000 -- (-1828.442) (-1828.670) (-1829.072) [-1829.456] * (-1829.190) (-1829.578) (-1827.393) [-1827.793] -- 0:01:13 187500 -- [-1830.175] (-1830.532) (-1827.201) (-1829.986) * (-1830.577) [-1827.233] (-1827.532) (-1827.551) -- 0:01:13 188000 -- (-1833.235) (-1828.282) [-1827.767] (-1828.550) * (-1828.866) [-1827.379] (-1827.354) (-1830.180) -- 0:01:13 188500 -- (-1830.959) (-1828.509) [-1827.261] (-1827.860) * (-1828.974) [-1827.494] (-1827.544) (-1831.946) -- 0:01:13 189000 -- (-1829.557) [-1828.429] (-1826.487) (-1830.844) * (-1827.116) [-1827.556] (-1827.846) (-1830.523) -- 0:01:12 189500 -- (-1830.076) (-1828.085) [-1828.351] (-1828.377) * (-1828.442) [-1827.417] (-1828.491) (-1828.581) -- 0:01:12 190000 -- (-1828.642) (-1827.677) [-1828.390] (-1828.299) * (-1829.565) [-1828.227] (-1827.935) (-1828.339) -- 0:01:12 Average standard deviation of split frequencies: 0.012671 190500 -- (-1828.686) (-1828.825) (-1829.540) [-1828.745] * (-1830.888) (-1826.627) [-1827.656] (-1830.097) -- 0:01:12 191000 -- (-1828.043) [-1828.660] (-1830.652) (-1829.381) * (-1832.576) [-1829.371] (-1828.712) (-1829.284) -- 0:01:12 191500 -- [-1829.537] (-1828.865) (-1831.582) (-1827.984) * (-1827.732) (-1831.196) [-1828.490] (-1829.457) -- 0:01:11 192000 -- (-1828.413) (-1829.767) (-1830.586) [-1827.099] * [-1828.965] (-1830.108) (-1827.354) (-1827.842) -- 0:01:11 192500 -- (-1831.181) [-1828.289] (-1831.500) (-1826.457) * (-1827.482) [-1829.883] (-1827.346) (-1831.911) -- 0:01:11 193000 -- (-1829.029) (-1828.525) [-1830.643] (-1826.967) * (-1827.746) (-1829.417) [-1827.144] (-1830.526) -- 0:01:11 193500 -- (-1830.294) [-1826.444] (-1828.068) (-1826.940) * [-1827.875] (-1827.949) (-1827.490) (-1830.192) -- 0:01:10 194000 -- (-1830.301) [-1827.143] (-1829.371) (-1828.544) * (-1831.033) (-1829.241) [-1827.694] (-1828.612) -- 0:01:10 194500 -- (-1829.910) (-1830.998) [-1827.521] (-1828.045) * (-1828.442) (-1830.469) (-1829.524) [-1828.907] -- 0:01:10 195000 -- (-1829.246) (-1829.337) [-1827.325] (-1829.807) * (-1830.536) [-1829.521] (-1827.578) (-1829.056) -- 0:01:10 Average standard deviation of split frequencies: 0.013379 195500 -- (-1827.863) (-1827.297) (-1827.116) [-1830.971] * (-1830.911) (-1827.723) [-1828.631] (-1829.232) -- 0:01:09 196000 -- (-1829.029) (-1827.678) [-1827.515] (-1831.965) * (-1830.993) (-1827.983) [-1830.743] (-1827.799) -- 0:01:09 196500 -- (-1831.354) (-1828.219) [-1827.045] (-1829.704) * [-1826.952] (-1828.792) (-1832.675) (-1828.774) -- 0:01:09 197000 -- (-1829.544) (-1831.987) (-1831.185) [-1828.950] * (-1828.557) [-1828.509] (-1827.119) (-1828.986) -- 0:01:09 197500 -- (-1827.592) (-1828.542) (-1829.087) [-1828.949] * [-1827.523] (-1828.343) (-1828.545) (-1831.253) -- 0:01:09 198000 -- [-1827.025] (-1827.867) (-1828.330) (-1829.863) * (-1829.363) (-1827.174) (-1826.976) [-1826.927] -- 0:01:12 198500 -- [-1829.604] (-1831.107) (-1829.913) (-1827.529) * (-1828.324) (-1827.781) [-1826.701] (-1828.512) -- 0:01:12 199000 -- (-1829.317) (-1827.492) (-1829.657) [-1829.226] * (-1827.405) [-1831.683] (-1827.265) (-1830.702) -- 0:01:12 199500 -- (-1827.368) (-1827.693) (-1827.523) [-1829.334] * (-1829.954) (-1829.723) [-1827.533] (-1830.615) -- 0:01:12 200000 -- (-1827.192) [-1828.122] (-1827.898) (-1829.951) * (-1829.564) (-1829.215) [-1827.327] (-1830.142) -- 0:01:12 Average standard deviation of split frequencies: 0.013404 200500 -- (-1830.432) (-1827.753) [-1829.853] (-1828.650) * (-1828.281) [-1827.295] (-1827.309) (-1828.232) -- 0:01:11 201000 -- (-1829.207) (-1828.225) [-1830.320] (-1829.503) * (-1829.812) (-1827.406) [-1827.377] (-1830.746) -- 0:01:11 201500 -- (-1827.176) (-1827.708) [-1831.251] (-1828.304) * (-1828.952) (-1829.248) (-1829.303) [-1829.070] -- 0:01:11 202000 -- (-1828.397) (-1828.036) (-1831.913) [-1829.950] * (-1832.443) (-1827.048) (-1829.035) [-1829.886] -- 0:01:11 202500 -- (-1827.768) [-1828.359] (-1829.813) (-1828.384) * [-1829.830] (-1827.972) (-1829.122) (-1828.159) -- 0:01:10 203000 -- (-1828.201) [-1834.215] (-1829.555) (-1829.037) * [-1827.968] (-1827.874) (-1827.962) (-1828.295) -- 0:01:10 203500 -- (-1828.214) [-1833.855] (-1828.804) (-1827.818) * (-1827.651) [-1827.125] (-1829.821) (-1827.312) -- 0:01:10 204000 -- [-1827.650] (-1827.354) (-1827.611) (-1828.022) * (-1827.174) (-1830.403) (-1830.648) [-1827.150] -- 0:01:10 204500 -- (-1828.000) (-1828.179) [-1827.168] (-1828.056) * (-1829.079) (-1829.754) [-1827.051] (-1827.754) -- 0:01:10 205000 -- (-1827.069) (-1826.733) [-1828.588] (-1828.064) * (-1828.055) (-1827.346) (-1828.279) [-1828.499] -- 0:01:09 Average standard deviation of split frequencies: 0.014188 205500 -- (-1829.112) (-1826.954) [-1829.995] (-1827.569) * (-1827.381) [-1826.726] (-1828.522) (-1829.576) -- 0:01:09 206000 -- (-1830.394) (-1826.864) [-1829.511] (-1829.212) * (-1828.941) (-1828.890) [-1827.677] (-1828.893) -- 0:01:09 206500 -- (-1829.590) [-1827.034] (-1830.475) (-1827.444) * (-1827.891) (-1832.363) [-1828.068] (-1828.995) -- 0:01:09 207000 -- (-1828.961) (-1827.576) (-1826.911) [-1827.557] * (-1830.629) (-1832.363) [-1827.186] (-1828.563) -- 0:01:08 207500 -- (-1832.847) (-1827.576) [-1827.048] (-1831.002) * (-1831.155) [-1832.367] (-1827.583) (-1828.219) -- 0:01:08 208000 -- [-1831.737] (-1827.576) (-1829.577) (-1830.532) * (-1828.719) (-1830.361) [-1829.725] (-1835.708) -- 0:01:08 208500 -- (-1829.577) (-1830.058) (-1827.121) [-1827.902] * (-1829.023) [-1828.782] (-1829.497) (-1828.892) -- 0:01:08 209000 -- (-1829.756) (-1829.918) [-1827.222] (-1827.172) * (-1828.747) (-1827.772) [-1832.745] (-1830.138) -- 0:01:11 209500 -- (-1829.756) (-1830.006) [-1828.404] (-1828.959) * (-1827.430) (-1829.941) [-1830.712] (-1827.439) -- 0:01:11 210000 -- [-1830.277] (-1830.184) (-1828.513) (-1829.642) * [-1826.948] (-1836.047) (-1834.274) (-1826.977) -- 0:01:11 Average standard deviation of split frequencies: 0.014486 210500 -- (-1830.071) [-1828.414] (-1826.897) (-1828.579) * (-1826.942) [-1828.837] (-1827.487) (-1826.912) -- 0:01:11 211000 -- (-1831.917) [-1829.903] (-1828.726) (-1827.126) * [-1828.091] (-1828.848) (-1827.721) (-1828.490) -- 0:01:11 211500 -- (-1828.027) (-1831.396) (-1828.559) [-1828.038] * [-1831.662] (-1828.604) (-1827.075) (-1827.702) -- 0:01:10 212000 -- (-1831.817) (-1831.360) [-1829.864] (-1830.239) * (-1832.275) (-1828.235) [-1826.899] (-1828.161) -- 0:01:10 212500 -- (-1827.553) (-1832.584) [-1827.870] (-1827.435) * [-1830.051] (-1827.160) (-1826.824) (-1829.385) -- 0:01:10 213000 -- (-1829.704) (-1828.370) (-1826.858) [-1827.237] * (-1829.440) (-1827.088) (-1827.237) [-1829.622] -- 0:01:10 213500 -- [-1831.225] (-1829.061) (-1833.736) (-1829.435) * (-1830.021) (-1827.727) [-1826.588] (-1829.002) -- 0:01:09 214000 -- (-1832.984) [-1827.039] (-1829.625) (-1827.777) * [-1827.923] (-1828.167) (-1830.597) (-1830.183) -- 0:01:09 214500 -- (-1840.255) (-1827.088) (-1828.855) [-1827.780] * [-1828.059] (-1828.430) (-1830.727) (-1829.572) -- 0:01:09 215000 -- (-1828.102) (-1827.038) (-1829.107) [-1827.222] * (-1837.003) (-1832.940) [-1828.105] (-1829.815) -- 0:01:09 Average standard deviation of split frequencies: 0.014065 215500 -- [-1828.102] (-1827.423) (-1828.905) (-1827.222) * (-1836.338) (-1826.492) (-1827.500) [-1828.427] -- 0:01:09 216000 -- [-1827.647] (-1828.547) (-1833.616) (-1827.679) * (-1832.853) (-1826.495) [-1828.267] (-1828.672) -- 0:01:08 216500 -- (-1826.864) (-1827.020) [-1831.157] (-1826.989) * (-1827.157) (-1827.556) (-1828.035) [-1829.711] -- 0:01:08 217000 -- [-1828.141] (-1826.866) (-1827.029) (-1827.655) * (-1828.009) (-1826.641) (-1828.129) [-1828.146] -- 0:01:08 217500 -- (-1831.058) (-1830.862) (-1828.416) [-1828.044] * (-1829.625) (-1828.989) [-1828.661] (-1833.060) -- 0:01:08 218000 -- (-1830.459) [-1828.789] (-1827.296) (-1830.328) * (-1829.420) [-1827.741] (-1827.525) (-1829.366) -- 0:01:08 218500 -- (-1830.782) [-1830.296] (-1826.970) (-1828.297) * (-1829.155) (-1833.845) (-1836.318) [-1829.131] -- 0:01:07 219000 -- (-1831.824) [-1826.619] (-1827.778) (-1827.473) * (-1826.986) [-1830.623] (-1828.945) (-1828.339) -- 0:01:07 219500 -- (-1829.338) (-1827.348) [-1827.111] (-1828.068) * (-1826.649) (-1827.684) (-1830.420) [-1828.173] -- 0:01:07 220000 -- (-1829.724) (-1826.659) [-1827.313] (-1828.069) * (-1826.324) (-1828.446) [-1827.966] (-1829.943) -- 0:01:07 Average standard deviation of split frequencies: 0.015310 220500 -- (-1828.021) [-1826.750] (-1828.646) (-1826.573) * (-1827.898) (-1828.356) (-1827.608) [-1827.518] -- 0:01:07 221000 -- (-1827.920) (-1827.814) [-1827.935] (-1826.509) * (-1829.534) (-1829.788) [-1828.241] (-1827.588) -- 0:01:10 221500 -- (-1827.467) (-1830.350) (-1829.265) [-1827.565] * (-1828.716) (-1827.932) [-1829.251] (-1830.673) -- 0:01:10 222000 -- (-1829.718) (-1831.340) (-1829.857) [-1828.506] * [-1828.622] (-1829.474) (-1828.734) (-1827.009) -- 0:01:10 222500 -- [-1827.519] (-1828.460) (-1828.481) (-1828.618) * (-1828.216) (-1827.206) [-1829.961] (-1827.482) -- 0:01:09 223000 -- (-1826.794) (-1829.849) [-1828.074] (-1828.355) * (-1826.774) (-1829.198) [-1829.664] (-1827.336) -- 0:01:09 223500 -- (-1826.772) (-1828.827) [-1827.176] (-1826.316) * (-1831.576) (-1829.980) (-1828.131) [-1830.394] -- 0:01:09 224000 -- (-1827.453) [-1828.530] (-1827.157) (-1833.713) * (-1832.249) (-1828.846) (-1828.461) [-1828.643] -- 0:01:09 224500 -- [-1826.490] (-1834.353) (-1827.205) (-1828.492) * (-1827.640) [-1828.102] (-1828.589) (-1830.949) -- 0:01:09 225000 -- (-1826.600) (-1832.054) [-1827.282] (-1827.309) * (-1831.245) [-1827.465] (-1830.367) (-1828.771) -- 0:01:08 Average standard deviation of split frequencies: 0.014914 225500 -- (-1826.816) [-1827.074] (-1828.205) (-1826.491) * (-1827.895) (-1832.144) (-1827.337) [-1826.811] -- 0:01:08 226000 -- [-1827.925] (-1826.695) (-1828.880) (-1826.534) * (-1828.392) (-1829.174) (-1827.648) [-1827.889] -- 0:01:08 226500 -- [-1830.284] (-1826.892) (-1827.820) (-1828.178) * (-1827.877) [-1829.216] (-1827.666) (-1828.332) -- 0:01:08 227000 -- (-1829.647) (-1831.058) [-1830.917] (-1828.087) * (-1827.365) (-1829.825) (-1828.037) [-1827.473] -- 0:01:08 227500 -- (-1829.601) (-1832.384) [-1827.236] (-1828.081) * (-1827.245) (-1828.873) (-1827.774) [-1827.392] -- 0:01:07 228000 -- (-1828.637) (-1829.344) (-1831.201) [-1826.679] * [-1830.975] (-1829.116) (-1826.683) (-1828.045) -- 0:01:07 228500 -- (-1828.420) (-1829.650) (-1831.601) [-1826.888] * (-1831.779) (-1827.245) (-1826.737) [-1828.070] -- 0:01:07 229000 -- [-1827.641] (-1829.233) (-1829.689) (-1827.764) * (-1829.515) (-1827.119) (-1828.280) [-1828.451] -- 0:01:07 229500 -- [-1828.605] (-1829.287) (-1827.303) (-1829.909) * [-1827.409] (-1827.109) (-1830.852) (-1827.657) -- 0:01:07 230000 -- (-1829.287) [-1830.926] (-1834.047) (-1831.305) * (-1829.124) (-1832.510) [-1827.793] (-1829.211) -- 0:01:06 Average standard deviation of split frequencies: 0.015489 230500 -- (-1827.713) [-1830.651] (-1830.997) (-1833.007) * [-1829.059] (-1829.704) (-1829.725) (-1827.408) -- 0:01:06 231000 -- (-1827.705) (-1831.422) [-1830.446] (-1828.834) * (-1831.102) [-1829.392] (-1829.966) (-1829.621) -- 0:01:06 231500 -- (-1827.704) (-1829.875) [-1830.173] (-1829.489) * [-1829.715] (-1827.688) (-1827.436) (-1827.348) -- 0:01:06 232000 -- (-1827.459) [-1828.651] (-1832.126) (-1831.918) * (-1827.970) (-1827.809) [-1826.531] (-1829.503) -- 0:01:06 232500 -- [-1828.296] (-1827.372) (-1832.395) (-1829.611) * (-1828.200) [-1828.583] (-1832.184) (-1831.767) -- 0:01:09 233000 -- [-1828.418] (-1828.798) (-1832.063) (-1828.380) * (-1828.037) (-1827.398) [-1828.876] (-1833.162) -- 0:01:09 233500 -- (-1828.418) [-1828.343] (-1828.418) (-1827.317) * (-1828.872) (-1826.865) [-1830.940] (-1831.073) -- 0:01:08 234000 -- (-1830.604) (-1828.297) [-1826.982] (-1827.433) * (-1828.934) (-1827.720) (-1831.634) [-1836.153] -- 0:01:08 234500 -- [-1832.325] (-1831.826) (-1828.096) (-1827.352) * (-1829.636) [-1829.535] (-1827.271) (-1837.392) -- 0:01:08 235000 -- [-1828.177] (-1835.184) (-1828.728) (-1826.861) * (-1829.276) [-1829.420] (-1831.115) (-1831.759) -- 0:01:08 Average standard deviation of split frequencies: 0.014718 235500 -- (-1828.256) (-1829.267) [-1828.559] (-1831.690) * (-1829.455) (-1829.727) [-1829.276] (-1835.186) -- 0:01:08 236000 -- (-1833.144) (-1829.291) [-1828.456] (-1827.342) * (-1830.919) (-1829.403) [-1827.694] (-1829.532) -- 0:01:07 236500 -- [-1828.193] (-1830.247) (-1828.693) (-1827.169) * [-1826.623] (-1828.830) (-1828.267) (-1828.857) -- 0:01:07 237000 -- (-1829.966) (-1829.325) [-1827.939] (-1827.359) * [-1826.774] (-1826.894) (-1829.288) (-1827.373) -- 0:01:07 237500 -- [-1828.791] (-1827.266) (-1829.856) (-1826.578) * [-1826.721] (-1826.898) (-1826.918) (-1827.502) -- 0:01:07 238000 -- (-1829.277) [-1829.458] (-1830.992) (-1829.195) * [-1826.879] (-1829.747) (-1827.824) (-1827.022) -- 0:01:07 238500 -- (-1831.093) (-1830.110) (-1830.919) [-1829.964] * (-1829.728) (-1829.595) [-1828.101] (-1827.206) -- 0:01:07 239000 -- [-1831.521] (-1832.244) (-1832.641) (-1832.562) * (-1826.462) [-1828.179] (-1831.465) (-1831.874) -- 0:01:06 239500 -- [-1828.632] (-1830.247) (-1833.193) (-1828.405) * [-1827.485] (-1827.887) (-1829.803) (-1830.510) -- 0:01:06 240000 -- (-1827.571) (-1828.710) (-1827.348) [-1828.806] * (-1826.701) (-1830.832) [-1831.279] (-1830.442) -- 0:01:06 Average standard deviation of split frequencies: 0.014536 240500 -- (-1828.522) (-1828.553) (-1830.508) [-1829.348] * [-1829.290] (-1828.186) (-1829.272) (-1829.173) -- 0:01:06 241000 -- (-1828.374) [-1836.881] (-1833.713) (-1829.720) * (-1830.157) [-1828.180] (-1828.228) (-1828.597) -- 0:01:06 241500 -- (-1828.542) (-1830.127) (-1826.806) [-1828.214] * (-1828.610) [-1828.693] (-1827.377) (-1828.359) -- 0:01:05 242000 -- [-1827.275] (-1833.596) (-1828.298) (-1828.576) * [-1828.390] (-1828.048) (-1827.280) (-1828.717) -- 0:01:05 242500 -- [-1828.158] (-1831.655) (-1827.894) (-1827.310) * (-1828.057) (-1828.953) (-1830.166) [-1827.248] -- 0:01:05 243000 -- (-1829.259) (-1827.253) (-1828.205) [-1827.935] * [-1827.494] (-1830.995) (-1829.682) (-1827.493) -- 0:01:05 243500 -- (-1830.169) [-1828.004] (-1827.302) (-1827.707) * (-1829.767) (-1832.776) [-1829.994] (-1827.558) -- 0:01:05 244000 -- (-1827.472) (-1828.785) [-1827.483] (-1827.111) * (-1829.094) (-1827.099) (-1827.965) [-1828.572] -- 0:01:08 244500 -- (-1829.172) [-1827.712] (-1829.504) (-1829.131) * (-1829.133) (-1826.881) [-1831.294] (-1829.529) -- 0:01:07 245000 -- [-1828.049] (-1828.191) (-1830.781) (-1828.031) * (-1830.045) (-1829.749) (-1830.899) [-1831.272] -- 0:01:07 Average standard deviation of split frequencies: 0.013111 245500 -- (-1828.087) (-1830.694) [-1834.992] (-1830.887) * [-1827.895] (-1829.267) (-1828.863) (-1827.503) -- 0:01:07 246000 -- (-1828.008) [-1827.757] (-1830.161) (-1828.537) * (-1828.000) [-1829.257] (-1828.602) (-1831.604) -- 0:01:07 246500 -- (-1828.927) (-1827.152) [-1828.853] (-1828.780) * (-1828.409) [-1828.346] (-1833.473) (-1829.930) -- 0:01:07 247000 -- (-1829.193) (-1827.609) [-1830.655] (-1826.964) * (-1829.622) (-1830.559) [-1830.237] (-1831.771) -- 0:01:07 247500 -- (-1827.389) (-1827.746) (-1828.450) [-1827.254] * (-1828.952) (-1829.630) [-1828.648] (-1831.465) -- 0:01:06 248000 -- [-1827.389] (-1827.302) (-1830.181) (-1830.172) * (-1827.604) (-1828.958) [-1828.957] (-1829.426) -- 0:01:06 248500 -- (-1827.589) [-1827.959] (-1829.851) (-1830.291) * (-1827.733) [-1828.041] (-1831.222) (-1827.412) -- 0:01:06 249000 -- (-1828.215) [-1827.782] (-1832.130) (-1831.629) * (-1826.790) (-1830.020) (-1832.568) [-1829.673] -- 0:01:06 249500 -- (-1827.332) (-1828.332) [-1837.222] (-1831.525) * (-1828.488) (-1830.083) (-1829.731) [-1827.961] -- 0:01:06 250000 -- (-1827.008) [-1828.503] (-1831.396) (-1829.758) * (-1828.841) [-1829.270] (-1830.557) (-1832.532) -- 0:01:06 Average standard deviation of split frequencies: 0.012746 250500 -- [-1827.212] (-1830.611) (-1833.596) (-1831.838) * (-1829.329) (-1828.680) [-1833.138] (-1830.109) -- 0:01:05 251000 -- [-1828.288] (-1826.927) (-1829.371) (-1828.785) * (-1828.501) (-1830.435) (-1829.009) [-1833.003] -- 0:01:05 251500 -- (-1827.259) [-1827.195] (-1826.896) (-1829.203) * [-1829.125] (-1828.723) (-1828.922) (-1831.747) -- 0:01:05 252000 -- (-1827.287) [-1827.715] (-1828.746) (-1832.474) * [-1828.066] (-1828.510) (-1829.072) (-1827.276) -- 0:01:05 252500 -- (-1827.046) [-1832.060] (-1828.902) (-1829.708) * (-1827.118) (-1827.347) (-1828.800) [-1828.589] -- 0:01:05 253000 -- (-1826.982) (-1830.413) [-1828.072] (-1830.583) * (-1827.619) (-1827.755) [-1829.074] (-1827.549) -- 0:01:04 253500 -- (-1828.747) (-1831.840) (-1828.487) [-1829.155] * [-1827.559] (-1827.849) (-1828.335) (-1828.597) -- 0:01:04 254000 -- [-1829.464] (-1829.348) (-1829.984) (-1832.316) * (-1827.372) (-1827.629) [-1830.332] (-1829.399) -- 0:01:04 254500 -- (-1827.798) (-1827.505) [-1827.337] (-1828.313) * (-1827.280) [-1827.713] (-1830.741) (-1829.341) -- 0:01:04 255000 -- [-1827.960] (-1826.937) (-1828.058) (-1829.263) * [-1829.621] (-1826.516) (-1829.495) (-1828.240) -- 0:01:04 Average standard deviation of split frequencies: 0.013095 255500 -- (-1828.220) (-1827.923) (-1826.636) [-1830.592] * (-1828.720) [-1826.407] (-1828.094) (-1827.947) -- 0:01:07 256000 -- (-1828.317) (-1828.368) [-1828.304] (-1830.417) * (-1829.808) (-1826.612) [-1828.023] (-1827.324) -- 0:01:06 256500 -- (-1827.890) (-1828.775) (-1829.030) [-1827.548] * (-1828.905) (-1827.396) [-1828.077] (-1828.628) -- 0:01:06 257000 -- [-1826.280] (-1830.688) (-1828.215) (-1827.732) * [-1827.086] (-1830.158) (-1831.150) (-1829.027) -- 0:01:06 257500 -- (-1828.001) (-1829.996) (-1827.197) [-1827.752] * [-1830.604] (-1826.906) (-1828.046) (-1827.979) -- 0:01:06 258000 -- (-1826.507) [-1828.574] (-1826.532) (-1827.740) * (-1827.439) (-1827.475) [-1827.342] (-1828.088) -- 0:01:06 258500 -- (-1826.637) (-1829.167) (-1827.139) [-1828.194] * [-1829.230] (-1837.260) (-1829.655) (-1828.950) -- 0:01:05 259000 -- [-1826.652] (-1829.759) (-1827.358) (-1827.995) * (-1828.352) (-1831.597) [-1830.326] (-1828.685) -- 0:01:05 259500 -- [-1826.655] (-1827.889) (-1829.679) (-1827.196) * (-1826.595) (-1829.948) (-1829.479) [-1829.568] -- 0:01:05 260000 -- (-1826.624) [-1828.039] (-1832.183) (-1829.504) * [-1826.977] (-1831.260) (-1828.759) (-1829.296) -- 0:01:05 Average standard deviation of split frequencies: 0.014166 260500 -- (-1830.817) (-1829.045) [-1829.769] (-1828.566) * (-1827.682) (-1829.082) [-1829.229] (-1828.289) -- 0:01:05 261000 -- (-1830.367) [-1829.384] (-1828.913) (-1828.331) * (-1828.221) [-1831.231] (-1826.582) (-1832.091) -- 0:01:05 261500 -- (-1828.017) (-1829.562) (-1827.451) [-1827.782] * (-1835.777) [-1828.437] (-1827.875) (-1831.197) -- 0:01:04 262000 -- (-1830.946) [-1832.437] (-1830.415) (-1829.114) * (-1829.714) [-1828.916] (-1829.841) (-1832.521) -- 0:01:04 262500 -- (-1828.583) [-1829.319] (-1828.141) (-1832.446) * (-1829.607) [-1829.126] (-1832.528) (-1831.902) -- 0:01:04 263000 -- (-1829.446) [-1829.513] (-1826.809) (-1830.118) * [-1828.364] (-1830.515) (-1828.501) (-1827.410) -- 0:01:04 263500 -- [-1830.322] (-1827.816) (-1828.058) (-1827.663) * (-1828.496) (-1830.058) (-1831.253) [-1827.573] -- 0:01:04 264000 -- (-1828.404) [-1827.651] (-1826.953) (-1827.740) * (-1829.523) [-1829.070] (-1828.848) (-1827.905) -- 0:01:04 264500 -- [-1828.118] (-1828.589) (-1827.935) (-1827.682) * (-1830.056) (-1831.744) [-1829.244] (-1827.929) -- 0:01:03 265000 -- (-1830.815) (-1828.863) [-1827.494] (-1828.370) * (-1829.360) (-1828.624) (-1829.885) [-1829.097] -- 0:01:03 Average standard deviation of split frequencies: 0.012701 265500 -- (-1830.675) (-1829.946) (-1828.549) [-1830.526] * (-1829.277) (-1827.548) [-1828.802] (-1830.376) -- 0:01:03 266000 -- (-1830.235) [-1827.263] (-1829.477) (-1829.307) * [-1827.219] (-1827.586) (-1827.685) (-1830.667) -- 0:01:03 266500 -- [-1831.061] (-1828.674) (-1828.457) (-1829.765) * [-1828.753] (-1828.546) (-1835.923) (-1827.634) -- 0:01:03 267000 -- [-1831.589] (-1827.932) (-1831.613) (-1829.070) * [-1828.542] (-1828.007) (-1829.476) (-1827.606) -- 0:01:05 267500 -- (-1833.989) [-1827.360] (-1828.995) (-1828.883) * (-1829.233) [-1829.584] (-1829.311) (-1827.293) -- 0:01:05 268000 -- (-1836.834) (-1826.815) [-1831.568] (-1828.288) * (-1829.503) (-1828.221) (-1827.086) [-1826.966] -- 0:01:05 268500 -- (-1835.507) (-1826.827) (-1830.566) [-1828.720] * (-1829.013) [-1826.907] (-1831.093) (-1829.661) -- 0:01:05 269000 -- (-1828.173) (-1826.827) [-1829.912] (-1829.367) * (-1828.785) (-1828.420) (-1829.429) [-1829.756] -- 0:01:05 269500 -- [-1829.962] (-1827.416) (-1829.789) (-1826.607) * (-1832.521) (-1827.426) (-1830.699) [-1829.683] -- 0:01:05 270000 -- (-1827.893) (-1828.885) (-1827.797) [-1827.058] * (-1832.722) [-1828.337] (-1827.515) (-1828.743) -- 0:01:04 Average standard deviation of split frequencies: 0.013546 270500 -- [-1827.117] (-1828.346) (-1827.879) (-1832.276) * [-1830.428] (-1830.414) (-1828.545) (-1830.069) -- 0:01:04 271000 -- (-1831.573) (-1829.058) (-1827.445) [-1832.038] * [-1829.091] (-1829.335) (-1833.534) (-1830.404) -- 0:01:04 271500 -- (-1831.573) (-1828.039) [-1829.831] (-1827.619) * (-1828.570) (-1830.397) (-1830.423) [-1834.567] -- 0:01:04 272000 -- (-1831.737) (-1827.870) [-1829.232] (-1830.540) * (-1828.951) (-1832.467) (-1827.818) [-1832.036] -- 0:01:04 272500 -- (-1831.424) (-1828.036) [-1827.327] (-1829.779) * (-1827.867) (-1831.764) [-1828.800] (-1834.566) -- 0:01:04 273000 -- [-1829.881] (-1831.480) (-1827.406) (-1828.533) * (-1827.566) [-1827.446] (-1827.534) (-1829.836) -- 0:01:03 273500 -- (-1829.413) (-1828.513) [-1827.549] (-1829.005) * (-1828.352) [-1827.644] (-1828.114) (-1831.115) -- 0:01:03 274000 -- (-1828.354) (-1829.481) [-1827.292] (-1829.003) * [-1828.064] (-1829.081) (-1828.476) (-1830.722) -- 0:01:03 274500 -- [-1827.424] (-1827.080) (-1828.192) (-1828.771) * (-1826.796) (-1830.706) (-1828.601) [-1829.206] -- 0:01:03 275000 -- (-1828.602) [-1827.093] (-1828.526) (-1833.078) * (-1826.797) [-1828.167] (-1829.578) (-1830.825) -- 0:01:03 Average standard deviation of split frequencies: 0.014473 275500 -- [-1827.548] (-1828.912) (-1829.927) (-1837.733) * [-1829.212] (-1828.466) (-1830.245) (-1831.060) -- 0:01:03 276000 -- (-1833.052) (-1827.398) (-1826.483) [-1831.541] * [-1829.246] (-1829.977) (-1833.661) (-1829.478) -- 0:01:02 276500 -- (-1828.765) [-1830.144] (-1827.635) (-1831.714) * [-1829.565] (-1831.914) (-1828.645) (-1830.257) -- 0:01:02 277000 -- (-1829.647) (-1829.177) [-1830.102] (-1827.981) * (-1829.303) [-1827.506] (-1829.602) (-1830.592) -- 0:01:02 277500 -- (-1828.821) (-1831.122) [-1834.262] (-1831.192) * (-1829.195) (-1828.820) (-1828.706) [-1830.533] -- 0:01:02 278000 -- (-1827.250) (-1829.309) [-1828.422] (-1830.678) * [-1831.350] (-1830.975) (-1831.583) (-1830.879) -- 0:01:02 278500 -- (-1827.006) [-1830.436] (-1831.263) (-1830.489) * (-1829.282) (-1830.068) (-1833.227) [-1827.128] -- 0:01:02 279000 -- [-1827.010] (-1828.922) (-1831.067) (-1828.976) * (-1826.644) (-1829.386) (-1829.857) [-1827.473] -- 0:01:04 279500 -- (-1829.126) (-1829.702) [-1829.178] (-1830.053) * (-1826.604) (-1831.746) (-1831.188) [-1829.217] -- 0:01:04 280000 -- (-1828.418) (-1828.468) (-1828.669) [-1827.067] * (-1827.964) [-1828.532] (-1831.126) (-1830.025) -- 0:01:04 Average standard deviation of split frequencies: 0.014674 280500 -- (-1829.310) (-1828.824) [-1827.864] (-1826.899) * (-1827.269) (-1827.191) (-1827.905) [-1827.925] -- 0:01:04 281000 -- (-1831.661) (-1829.392) (-1828.689) [-1827.589] * (-1827.176) [-1828.145] (-1827.453) (-1828.059) -- 0:01:03 281500 -- (-1828.686) [-1827.090] (-1831.985) (-1828.101) * (-1828.413) (-1829.699) (-1829.778) [-1827.467] -- 0:01:03 282000 -- (-1830.384) [-1828.273] (-1828.716) (-1828.183) * (-1828.336) [-1829.110] (-1828.711) (-1828.081) -- 0:01:03 282500 -- (-1828.421) [-1827.576] (-1827.658) (-1828.388) * (-1827.168) (-1828.643) [-1831.879] (-1828.339) -- 0:01:03 283000 -- (-1827.727) (-1830.371) [-1827.323] (-1828.006) * (-1827.137) [-1826.538] (-1831.678) (-1833.437) -- 0:01:03 283500 -- (-1830.648) (-1830.292) [-1828.470] (-1826.957) * (-1827.881) [-1826.670] (-1828.737) (-1831.101) -- 0:01:03 284000 -- (-1829.645) (-1829.393) [-1827.458] (-1828.219) * (-1829.888) [-1826.708] (-1828.178) (-1827.023) -- 0:01:03 284500 -- [-1828.023] (-1829.062) (-1828.998) (-1833.515) * (-1829.015) [-1827.311] (-1828.960) (-1828.648) -- 0:01:02 285000 -- [-1829.587] (-1828.265) (-1828.985) (-1827.597) * (-1830.362) [-1827.769] (-1828.801) (-1827.950) -- 0:01:02 Average standard deviation of split frequencies: 0.014401 285500 -- (-1829.612) (-1829.083) [-1826.756] (-1829.314) * (-1828.530) [-1827.328] (-1828.174) (-1826.697) -- 0:01:02 286000 -- (-1829.139) [-1826.471] (-1826.666) (-1828.194) * (-1829.183) (-1827.286) [-1829.010] (-1828.297) -- 0:01:02 286500 -- (-1834.303) (-1827.194) [-1827.788] (-1828.399) * [-1829.048] (-1828.512) (-1831.601) (-1828.297) -- 0:01:02 287000 -- (-1833.511) (-1829.957) [-1828.723] (-1826.647) * [-1828.984] (-1830.788) (-1830.307) (-1827.317) -- 0:01:02 287500 -- (-1827.645) (-1828.141) [-1828.640] (-1826.790) * [-1827.913] (-1827.724) (-1829.998) (-1828.483) -- 0:01:01 288000 -- (-1826.866) (-1827.251) (-1829.392) [-1826.861] * (-1827.386) (-1827.225) (-1831.269) [-1826.839] -- 0:01:01 288500 -- (-1827.326) (-1827.392) [-1830.524] (-1828.335) * (-1829.773) [-1827.233] (-1830.017) (-1831.171) -- 0:01:01 289000 -- (-1826.542) [-1826.696] (-1831.672) (-1826.739) * (-1829.371) (-1826.869) [-1828.599] (-1827.340) -- 0:01:01 289500 -- (-1828.139) [-1826.568] (-1828.238) (-1830.747) * (-1829.661) [-1827.890] (-1826.796) (-1826.701) -- 0:01:01 290000 -- (-1826.733) [-1826.547] (-1827.631) (-1827.192) * (-1833.108) [-1826.835] (-1826.839) (-1826.667) -- 0:01:01 Average standard deviation of split frequencies: 0.014426 290500 -- (-1830.863) (-1827.348) (-1827.138) [-1827.251] * (-1837.856) (-1827.658) (-1831.333) [-1830.005] -- 0:01:03 291000 -- (-1828.046) (-1830.427) [-1827.220] (-1826.877) * (-1830.635) [-1827.968] (-1829.102) (-1828.926) -- 0:01:03 291500 -- (-1829.034) (-1830.768) [-1826.717] (-1826.877) * (-1829.780) [-1827.771] (-1828.305) (-1830.442) -- 0:01:03 292000 -- (-1828.097) (-1829.632) (-1828.814) [-1827.517] * [-1829.204] (-1830.655) (-1827.216) (-1829.440) -- 0:01:03 292500 -- [-1828.327] (-1829.771) (-1829.482) (-1828.119) * (-1831.377) (-1832.084) (-1826.862) [-1828.746] -- 0:01:02 293000 -- (-1829.732) (-1830.164) [-1831.444] (-1827.897) * (-1828.090) (-1832.451) (-1826.882) [-1826.810] -- 0:01:02 293500 -- (-1828.023) (-1827.179) (-1827.754) [-1832.028] * (-1827.761) [-1832.491] (-1830.629) (-1826.989) -- 0:01:02 294000 -- (-1830.127) (-1827.997) [-1827.211] (-1832.791) * (-1827.848) (-1835.053) [-1829.210] (-1827.957) -- 0:01:02 294500 -- (-1828.356) (-1826.566) [-1827.259] (-1829.356) * [-1828.368] (-1828.748) (-1828.847) (-1826.577) -- 0:01:02 295000 -- (-1827.405) (-1826.404) (-1827.276) [-1827.677] * (-1826.986) (-1829.060) (-1828.744) [-1826.911] -- 0:01:02 Average standard deviation of split frequencies: 0.013914 295500 -- [-1829.067] (-1828.519) (-1827.410) (-1831.465) * (-1827.930) [-1829.679] (-1828.924) (-1826.909) -- 0:01:01 296000 -- (-1828.777) [-1827.089] (-1827.459) (-1830.526) * [-1828.646] (-1827.505) (-1829.753) (-1827.109) -- 0:01:01 296500 -- [-1827.985] (-1827.468) (-1826.498) (-1832.352) * [-1827.363] (-1828.052) (-1829.218) (-1826.827) -- 0:01:01 297000 -- [-1828.421] (-1828.764) (-1826.692) (-1830.708) * (-1826.557) (-1827.955) [-1828.030] (-1827.895) -- 0:01:01 297500 -- (-1828.511) (-1827.990) [-1828.128] (-1830.149) * [-1826.699] (-1826.465) (-1828.262) (-1827.895) -- 0:01:01 298000 -- (-1829.771) (-1827.384) (-1829.330) [-1827.134] * (-1827.441) (-1828.605) (-1829.249) [-1827.882] -- 0:01:01 298500 -- (-1830.061) [-1826.804] (-1829.786) (-1827.292) * (-1830.079) (-1829.575) [-1826.973] (-1828.567) -- 0:01:01 299000 -- (-1829.246) [-1827.150] (-1830.337) (-1827.470) * (-1832.462) (-1830.831) [-1828.458] (-1828.966) -- 0:01:00 299500 -- (-1833.027) [-1827.376] (-1830.482) (-1828.507) * (-1831.823) (-1830.149) [-1829.766] (-1834.321) -- 0:01:00 300000 -- (-1830.781) (-1829.770) [-1827.308] (-1827.414) * (-1834.124) (-1830.915) (-1829.764) [-1831.783] -- 0:01:00 Average standard deviation of split frequencies: 0.013675 300500 -- [-1828.712] (-1826.879) (-1827.308) (-1827.414) * (-1828.521) (-1832.016) (-1829.238) [-1832.024] -- 0:01:00 301000 -- (-1832.930) (-1826.879) (-1831.665) [-1831.976] * [-1827.612] (-1832.331) (-1827.174) (-1832.500) -- 0:01:00 301500 -- (-1828.350) (-1830.381) (-1828.336) [-1829.703] * (-1829.661) [-1827.442] (-1828.262) (-1829.631) -- 0:01:02 302000 -- (-1831.345) [-1830.907] (-1829.658) (-1827.750) * [-1831.833] (-1827.873) (-1831.418) (-1829.388) -- 0:01:02 302500 -- [-1829.489] (-1830.205) (-1831.013) (-1828.460) * (-1832.522) (-1827.139) (-1828.511) [-1828.159] -- 0:01:02 303000 -- (-1827.173) [-1827.873] (-1835.182) (-1827.534) * (-1828.407) (-1829.246) [-1829.555] (-1828.495) -- 0:01:02 303500 -- (-1827.564) (-1827.579) (-1832.670) [-1828.994] * [-1832.660] (-1829.317) (-1832.812) (-1828.075) -- 0:01:01 304000 -- (-1830.979) (-1833.018) (-1830.266) [-1829.760] * (-1834.548) (-1828.415) [-1830.278] (-1829.610) -- 0:01:01 304500 -- (-1830.717) [-1829.992] (-1829.455) (-1835.559) * [-1829.170] (-1833.183) (-1827.168) (-1831.096) -- 0:01:01 305000 -- (-1829.131) (-1828.111) [-1828.580] (-1829.595) * (-1828.250) (-1831.346) (-1828.090) [-1826.738] -- 0:01:01 Average standard deviation of split frequencies: 0.014036 305500 -- (-1827.738) [-1827.747] (-1831.269) (-1828.001) * [-1829.387] (-1827.235) (-1828.672) (-1828.533) -- 0:01:01 306000 -- (-1829.037) (-1827.778) (-1829.577) [-1828.506] * (-1827.360) [-1827.877] (-1830.209) (-1827.031) -- 0:01:01 306500 -- (-1828.498) (-1831.308) [-1829.237] (-1828.502) * [-1829.764] (-1827.151) (-1830.486) (-1830.815) -- 0:01:01 307000 -- (-1828.308) (-1828.614) [-1828.724] (-1828.577) * [-1828.115] (-1826.404) (-1828.066) (-1826.956) -- 0:01:00 307500 -- (-1828.113) (-1827.972) [-1828.116] (-1828.393) * (-1826.729) (-1833.491) (-1828.753) [-1829.725] -- 0:01:00 308000 -- (-1827.645) [-1828.856] (-1830.740) (-1831.105) * (-1832.930) (-1829.192) [-1831.658] (-1834.307) -- 0:01:00 308500 -- [-1829.455] (-1827.880) (-1830.536) (-1827.801) * (-1830.334) [-1827.742] (-1832.115) (-1832.362) -- 0:01:00 309000 -- (-1827.081) (-1831.048) [-1827.839] (-1827.801) * (-1831.223) (-1828.345) (-1827.982) [-1829.901] -- 0:01:00 309500 -- [-1827.090] (-1831.296) (-1828.873) (-1827.004) * (-1829.685) (-1829.893) [-1831.891] (-1830.206) -- 0:01:00 310000 -- [-1827.809] (-1830.329) (-1828.988) (-1827.029) * [-1833.830] (-1826.877) (-1829.805) (-1829.142) -- 0:01:00 Average standard deviation of split frequencies: 0.013319 310500 -- [-1827.750] (-1830.052) (-1829.191) (-1829.561) * (-1828.905) (-1827.837) [-1828.208] (-1826.372) -- 0:00:59 311000 -- (-1828.103) (-1827.088) [-1829.701] (-1826.987) * (-1828.419) (-1829.836) [-1828.884] (-1828.255) -- 0:00:59 311500 -- [-1828.276] (-1828.404) (-1830.720) (-1828.221) * [-1829.198] (-1829.529) (-1827.915) (-1827.326) -- 0:00:59 312000 -- (-1828.437) (-1830.126) [-1828.197] (-1829.526) * (-1827.051) (-1826.973) [-1826.955] (-1828.726) -- 0:00:59 312500 -- (-1828.918) (-1829.521) [-1827.585] (-1828.672) * (-1829.900) (-1829.403) [-1828.966] (-1828.398) -- 0:00:59 313000 -- (-1829.747) (-1828.981) [-1829.320] (-1827.816) * (-1828.067) (-1828.689) [-1828.138] (-1828.384) -- 0:00:59 313500 -- [-1833.605] (-1828.893) (-1831.819) (-1827.143) * (-1827.190) (-1832.629) [-1828.641] (-1828.329) -- 0:01:01 314000 -- (-1832.931) (-1829.492) (-1829.964) [-1827.273] * [-1829.133] (-1828.246) (-1831.416) (-1828.777) -- 0:01:01 314500 -- (-1834.706) [-1831.756] (-1829.968) (-1828.604) * [-1827.772] (-1826.875) (-1834.702) (-1828.589) -- 0:01:01 315000 -- (-1829.533) [-1829.326] (-1828.814) (-1828.050) * (-1826.774) (-1829.213) [-1829.913] (-1828.057) -- 0:01:00 Average standard deviation of split frequencies: 0.012763 315500 -- (-1828.765) [-1828.735] (-1827.855) (-1828.721) * [-1826.885] (-1826.976) (-1830.657) (-1827.665) -- 0:01:00 316000 -- (-1827.318) (-1828.657) (-1829.225) [-1832.490] * (-1828.125) (-1831.739) (-1829.897) [-1833.629] -- 0:01:00 316500 -- (-1827.679) [-1831.373] (-1827.415) (-1829.763) * (-1827.750) (-1828.161) [-1828.368] (-1829.668) -- 0:01:00 317000 -- [-1828.333] (-1827.338) (-1828.207) (-1833.649) * (-1827.870) [-1828.035] (-1828.826) (-1826.854) -- 0:01:00 317500 -- (-1828.213) [-1827.335] (-1829.056) (-1828.412) * (-1830.290) (-1828.286) (-1829.680) [-1826.776] -- 0:01:00 318000 -- [-1827.759] (-1828.000) (-1829.544) (-1827.401) * (-1828.872) (-1831.646) [-1829.496] (-1827.331) -- 0:01:00 318500 -- [-1828.047] (-1829.120) (-1829.278) (-1827.640) * (-1830.168) (-1829.372) (-1828.452) [-1827.126] -- 0:00:59 319000 -- (-1830.092) [-1827.318] (-1831.839) (-1826.994) * (-1831.943) (-1829.866) (-1828.444) [-1829.802] -- 0:00:59 319500 -- [-1830.201] (-1827.841) (-1828.871) (-1826.635) * [-1832.840] (-1828.725) (-1832.551) (-1828.251) -- 0:00:59 320000 -- (-1832.030) [-1828.604] (-1827.387) (-1826.730) * [-1828.932] (-1831.162) (-1833.577) (-1829.550) -- 0:00:59 Average standard deviation of split frequencies: 0.013149 320500 -- (-1832.902) [-1828.984] (-1833.007) (-1826.717) * (-1829.228) (-1831.624) (-1829.396) [-1828.256] -- 0:00:59 321000 -- [-1827.164] (-1826.456) (-1828.963) (-1828.230) * (-1829.889) (-1829.573) [-1826.722] (-1827.793) -- 0:00:59 321500 -- [-1827.568] (-1828.229) (-1827.809) (-1827.541) * [-1828.154] (-1829.966) (-1831.117) (-1828.569) -- 0:00:59 322000 -- [-1827.547] (-1827.870) (-1828.240) (-1826.773) * (-1828.194) (-1830.864) (-1827.770) [-1829.909] -- 0:00:58 322500 -- (-1829.247) [-1828.046] (-1829.659) (-1828.661) * (-1829.783) (-1831.368) (-1827.618) [-1831.008] -- 0:00:58 323000 -- (-1829.375) (-1827.831) [-1827.321] (-1826.925) * (-1828.884) (-1830.301) (-1829.458) [-1828.907] -- 0:00:58 323500 -- (-1829.020) [-1827.018] (-1827.412) (-1827.463) * (-1827.179) (-1828.207) (-1829.513) [-1830.470] -- 0:00:58 324000 -- (-1829.099) (-1828.159) [-1828.693] (-1827.762) * [-1828.170] (-1828.359) (-1827.504) (-1829.264) -- 0:00:58 324500 -- (-1827.269) (-1827.484) (-1829.257) [-1826.928] * (-1829.445) (-1826.861) [-1827.469] (-1828.284) -- 0:00:58 325000 -- (-1830.355) (-1827.398) (-1831.338) [-1827.386] * [-1829.493] (-1826.818) (-1827.613) (-1827.852) -- 0:01:00 Average standard deviation of split frequencies: 0.013014 325500 -- [-1829.229] (-1828.117) (-1831.437) (-1828.419) * (-1830.769) (-1828.856) [-1826.831] (-1828.208) -- 0:01:00 326000 -- [-1831.185] (-1827.443) (-1826.898) (-1829.697) * (-1830.062) (-1826.992) [-1829.093] (-1828.816) -- 0:00:59 326500 -- (-1829.339) (-1827.125) [-1827.314] (-1827.694) * [-1831.248] (-1830.829) (-1827.797) (-1827.656) -- 0:00:59 327000 -- (-1828.250) [-1828.418] (-1831.580) (-1827.319) * (-1832.438) (-1826.479) (-1831.077) [-1826.951] -- 0:00:59 327500 -- (-1827.928) (-1828.867) [-1828.982] (-1830.764) * [-1830.631] (-1826.808) (-1829.469) (-1827.589) -- 0:00:59 328000 -- (-1827.927) (-1827.646) [-1827.704] (-1834.682) * (-1831.771) [-1826.737] (-1832.406) (-1826.754) -- 0:00:59 328500 -- (-1830.099) [-1827.341] (-1828.096) (-1827.769) * [-1830.189] (-1831.863) (-1829.717) (-1829.970) -- 0:00:59 329000 -- (-1830.018) (-1826.861) [-1828.336] (-1831.436) * [-1826.844] (-1828.204) (-1830.245) (-1831.152) -- 0:00:59 329500 -- (-1828.224) [-1827.385] (-1828.278) (-1829.203) * (-1826.981) [-1828.988] (-1829.747) (-1828.803) -- 0:00:59 330000 -- [-1828.772] (-1827.186) (-1827.791) (-1826.930) * (-1826.996) (-1826.728) (-1831.593) [-1828.018] -- 0:00:58 Average standard deviation of split frequencies: 0.013147 330500 -- (-1830.139) (-1827.883) [-1826.897] (-1828.244) * [-1826.996] (-1828.573) (-1830.865) (-1828.080) -- 0:00:58 331000 -- (-1827.531) (-1828.108) [-1827.899] (-1827.855) * (-1829.997) (-1830.185) [-1828.696] (-1827.890) -- 0:00:58 331500 -- (-1829.811) [-1828.002] (-1828.811) (-1827.225) * (-1830.905) [-1828.896] (-1830.588) (-1827.968) -- 0:00:58 332000 -- (-1833.331) (-1829.002) (-1828.685) [-1831.527] * (-1830.473) (-1830.928) (-1830.984) [-1827.817] -- 0:00:58 332500 -- (-1828.106) (-1829.053) [-1828.414] (-1832.435) * [-1828.914] (-1827.455) (-1830.281) (-1828.267) -- 0:00:58 333000 -- (-1828.434) (-1829.189) [-1826.837] (-1831.719) * (-1829.540) (-1827.536) (-1830.580) [-1828.155] -- 0:00:58 333500 -- (-1832.186) (-1831.819) (-1826.953) [-1827.652] * (-1830.362) (-1829.128) [-1832.326] (-1828.181) -- 0:00:57 334000 -- (-1829.400) (-1831.547) [-1827.168] (-1829.546) * (-1829.710) [-1828.983] (-1831.980) (-1828.799) -- 0:00:57 334500 -- (-1829.209) (-1831.429) (-1827.268) [-1829.341] * (-1828.699) [-1828.584] (-1830.490) (-1832.117) -- 0:00:57 335000 -- (-1828.800) (-1828.259) [-1826.741] (-1828.396) * [-1826.948] (-1828.429) (-1833.057) (-1831.050) -- 0:00:57 Average standard deviation of split frequencies: 0.013718 335500 -- (-1828.493) [-1830.343] (-1827.555) (-1827.555) * (-1827.066) (-1830.921) (-1839.031) [-1829.923] -- 0:00:57 336000 -- [-1828.796] (-1832.081) (-1826.850) (-1826.975) * [-1827.821] (-1830.850) (-1826.876) (-1830.820) -- 0:00:57 336500 -- (-1828.096) (-1829.879) [-1828.492] (-1828.511) * [-1826.724] (-1829.227) (-1827.130) (-1830.351) -- 0:00:59 337000 -- (-1827.200) (-1829.171) (-1828.367) [-1827.649] * (-1826.723) (-1827.990) (-1828.048) [-1829.594] -- 0:00:59 337500 -- (-1829.388) (-1830.972) [-1827.171] (-1827.581) * [-1831.959] (-1829.519) (-1829.759) (-1836.163) -- 0:00:58 338000 -- (-1829.382) [-1827.055] (-1827.400) (-1827.256) * (-1831.156) (-1829.145) (-1831.380) [-1826.491] -- 0:00:58 338500 -- (-1827.620) (-1827.655) [-1826.589] (-1831.231) * (-1829.267) (-1828.024) [-1828.850] (-1831.409) -- 0:00:58 339000 -- (-1829.017) (-1827.253) [-1826.999] (-1827.217) * (-1827.544) (-1827.991) [-1829.205] (-1828.285) -- 0:00:58 339500 -- (-1827.905) [-1826.956] (-1829.105) (-1828.218) * (-1830.516) [-1829.702] (-1828.867) (-1828.429) -- 0:00:58 340000 -- (-1829.389) (-1826.956) [-1827.155] (-1828.760) * (-1828.551) (-1828.652) [-1828.270] (-1828.345) -- 0:00:58 Average standard deviation of split frequencies: 0.013838 340500 -- [-1828.852] (-1827.234) (-1830.937) (-1827.655) * (-1828.277) (-1830.277) (-1828.656) [-1828.667] -- 0:00:58 341000 -- [-1830.720] (-1827.310) (-1829.004) (-1827.745) * (-1827.905) (-1828.323) (-1831.245) [-1831.828] -- 0:00:57 341500 -- (-1830.722) [-1826.708] (-1828.685) (-1828.811) * (-1826.595) (-1830.040) [-1833.990] (-1828.563) -- 0:00:57 342000 -- (-1828.778) (-1826.854) (-1829.349) [-1828.769] * [-1826.480] (-1829.961) (-1829.822) (-1829.945) -- 0:00:57 342500 -- (-1826.577) [-1828.052] (-1831.589) (-1829.507) * [-1830.411] (-1828.841) (-1829.742) (-1829.928) -- 0:00:57 343000 -- [-1827.219] (-1830.161) (-1828.858) (-1827.060) * (-1828.647) (-1827.889) [-1828.199] (-1827.661) -- 0:00:57 343500 -- (-1827.319) [-1831.387] (-1827.169) (-1832.009) * (-1828.723) [-1827.465] (-1829.538) (-1830.846) -- 0:00:57 344000 -- (-1829.777) (-1830.517) (-1829.021) [-1827.539] * (-1829.730) [-1830.741] (-1829.250) (-1831.883) -- 0:00:57 344500 -- (-1829.888) (-1828.160) (-1829.074) [-1827.375] * (-1827.762) [-1830.726] (-1827.575) (-1834.589) -- 0:00:57 345000 -- (-1832.618) (-1829.839) [-1828.481] (-1826.741) * [-1827.814] (-1829.158) (-1830.364) (-1830.636) -- 0:00:56 Average standard deviation of split frequencies: 0.014506 345500 -- (-1830.789) (-1827.114) (-1827.603) [-1828.256] * (-1827.873) [-1829.195] (-1829.257) (-1832.012) -- 0:00:56 346000 -- (-1828.455) (-1827.060) [-1828.711] (-1829.510) * (-1830.438) (-1830.247) [-1830.574] (-1829.326) -- 0:00:56 346500 -- [-1830.232] (-1827.636) (-1833.744) (-1828.065) * (-1828.848) (-1831.751) [-1831.461] (-1830.944) -- 0:00:56 347000 -- (-1828.163) (-1828.217) (-1830.349) [-1830.861] * (-1826.715) (-1833.870) [-1828.911] (-1827.505) -- 0:00:56 347500 -- [-1827.229] (-1827.529) (-1832.378) (-1831.745) * (-1826.460) (-1829.554) (-1829.070) [-1827.421] -- 0:00:56 348000 -- [-1827.876] (-1827.891) (-1830.628) (-1830.085) * [-1826.941] (-1830.768) (-1835.558) (-1832.233) -- 0:00:58 348500 -- (-1829.417) (-1830.772) (-1829.576) [-1829.017] * (-1826.564) (-1828.060) [-1829.000] (-1828.164) -- 0:00:57 349000 -- (-1829.558) [-1830.579] (-1829.878) (-1828.366) * (-1833.014) (-1829.565) (-1828.962) [-1829.389] -- 0:00:57 349500 -- [-1829.140] (-1833.269) (-1828.357) (-1828.310) * (-1833.006) (-1831.478) (-1828.705) [-1828.992] -- 0:00:57 350000 -- (-1829.025) (-1833.351) (-1828.311) [-1828.101] * (-1829.825) [-1832.200] (-1828.266) (-1828.554) -- 0:00:57 Average standard deviation of split frequencies: 0.014041 350500 -- (-1829.391) (-1827.062) [-1828.511] (-1829.257) * (-1828.582) (-1832.193) [-1827.733] (-1826.657) -- 0:00:57 351000 -- (-1829.527) (-1827.814) [-1830.128] (-1829.820) * (-1828.506) (-1833.025) [-1829.448] (-1826.635) -- 0:00:57 351500 -- (-1828.002) [-1827.527] (-1830.003) (-1832.097) * (-1829.541) [-1829.194] (-1831.019) (-1828.791) -- 0:00:57 352000 -- [-1827.541] (-1831.279) (-1828.634) (-1828.611) * (-1827.515) (-1832.636) [-1828.501] (-1827.577) -- 0:00:57 352500 -- (-1834.568) (-1827.394) (-1828.811) [-1828.380] * [-1828.551] (-1831.766) (-1831.058) (-1830.243) -- 0:00:56 353000 -- (-1827.777) (-1830.078) (-1829.250) [-1826.956] * (-1828.148) [-1828.635] (-1832.897) (-1829.485) -- 0:00:56 353500 -- (-1827.458) [-1827.481] (-1827.790) (-1827.189) * (-1830.357) (-1831.074) (-1826.950) [-1828.945] -- 0:00:56 354000 -- [-1829.117] (-1828.744) (-1826.785) (-1827.485) * (-1834.340) (-1828.437) [-1828.938] (-1829.743) -- 0:00:56 354500 -- [-1829.781] (-1827.212) (-1829.930) (-1828.443) * (-1827.330) (-1828.467) [-1826.817] (-1830.758) -- 0:00:56 355000 -- (-1827.295) (-1827.773) [-1830.781] (-1831.032) * (-1832.580) (-1828.512) (-1827.099) [-1827.891] -- 0:00:56 Average standard deviation of split frequencies: 0.014345 355500 -- (-1827.732) (-1828.483) (-1828.655) [-1827.711] * (-1830.827) [-1832.074] (-1828.833) (-1828.890) -- 0:00:56 356000 -- (-1830.382) [-1829.534] (-1827.128) (-1827.305) * [-1829.683] (-1836.387) (-1828.423) (-1830.904) -- 0:00:56 356500 -- [-1828.821] (-1828.013) (-1827.391) (-1828.331) * [-1827.569] (-1829.817) (-1830.502) (-1835.204) -- 0:00:55 357000 -- (-1827.777) (-1827.682) [-1829.295] (-1827.975) * (-1830.299) (-1826.839) (-1829.104) [-1828.877] -- 0:00:55 357500 -- (-1827.012) [-1826.959] (-1827.899) (-1829.529) * [-1828.599] (-1827.813) (-1828.890) (-1827.876) -- 0:00:55 358000 -- (-1826.851) (-1827.230) [-1828.340] (-1830.485) * [-1830.528] (-1829.271) (-1826.464) (-1828.373) -- 0:00:55 358500 -- (-1827.213) (-1826.694) (-1828.667) [-1829.513] * (-1829.321) (-1829.432) [-1827.129] (-1827.990) -- 0:00:55 359000 -- [-1828.799] (-1827.182) (-1828.668) (-1834.874) * (-1830.432) (-1830.233) (-1826.876) [-1829.280] -- 0:00:55 359500 -- (-1828.731) (-1829.538) [-1829.826] (-1832.704) * (-1832.320) (-1830.839) (-1827.300) [-1826.917] -- 0:00:57 360000 -- (-1827.869) [-1827.373] (-1827.970) (-1832.000) * [-1829.414] (-1832.788) (-1828.088) (-1828.547) -- 0:00:56 Average standard deviation of split frequencies: 0.014301 360500 -- (-1827.825) [-1826.861] (-1829.261) (-1832.869) * (-1828.248) [-1830.898] (-1827.142) (-1832.174) -- 0:00:56 361000 -- (-1828.472) [-1826.816] (-1828.757) (-1829.672) * [-1827.823] (-1828.674) (-1826.621) (-1832.984) -- 0:00:56 361500 -- (-1828.729) [-1830.928] (-1832.240) (-1828.995) * [-1827.038] (-1828.407) (-1827.561) (-1829.701) -- 0:00:56 362000 -- (-1827.703) [-1828.814] (-1830.297) (-1830.141) * (-1828.066) (-1827.713) (-1827.066) [-1829.681] -- 0:00:56 362500 -- [-1829.082] (-1833.197) (-1828.556) (-1827.718) * (-1829.813) (-1826.991) (-1831.577) [-1829.493] -- 0:00:56 363000 -- [-1828.468] (-1831.391) (-1827.312) (-1831.240) * (-1827.999) (-1831.058) (-1828.534) [-1828.524] -- 0:00:56 363500 -- (-1828.267) [-1828.109] (-1826.456) (-1828.960) * [-1827.817] (-1833.395) (-1833.870) (-1829.962) -- 0:00:56 364000 -- [-1826.841] (-1828.651) (-1827.630) (-1834.707) * (-1828.326) [-1827.519] (-1827.754) (-1829.916) -- 0:00:55 364500 -- (-1827.674) (-1828.203) [-1828.265] (-1827.575) * (-1830.029) (-1827.532) [-1827.140] (-1829.431) -- 0:00:55 365000 -- [-1827.674] (-1828.941) (-1828.967) (-1828.459) * [-1826.867] (-1829.529) (-1826.872) (-1830.474) -- 0:00:55 Average standard deviation of split frequencies: 0.014622 365500 -- (-1826.899) [-1827.692] (-1826.852) (-1830.846) * (-1829.570) (-1829.320) [-1829.544] (-1833.087) -- 0:00:55 366000 -- (-1826.508) (-1827.604) [-1827.341] (-1832.130) * (-1828.217) [-1828.544] (-1827.123) (-1828.525) -- 0:00:55 366500 -- [-1832.417] (-1827.145) (-1828.969) (-1842.074) * [-1827.038] (-1830.076) (-1827.280) (-1828.924) -- 0:00:55 367000 -- (-1832.506) [-1827.170] (-1828.070) (-1829.978) * (-1829.516) (-1833.276) [-1827.509] (-1829.053) -- 0:00:55 367500 -- (-1829.342) [-1829.215] (-1827.403) (-1828.701) * (-1828.055) [-1830.948] (-1826.410) (-1828.268) -- 0:00:55 368000 -- (-1829.867) (-1827.378) (-1829.569) [-1829.367] * (-1827.543) (-1826.703) (-1830.474) [-1828.946] -- 0:00:54 368500 -- (-1830.614) (-1827.563) [-1827.372] (-1827.599) * (-1829.748) [-1826.703] (-1828.708) (-1828.031) -- 0:00:54 369000 -- (-1828.981) (-1828.843) [-1827.063] (-1827.801) * (-1828.052) [-1827.296] (-1831.694) (-1834.948) -- 0:00:54 369500 -- (-1827.869) (-1827.136) [-1827.506] (-1830.674) * (-1829.554) (-1828.659) [-1830.524] (-1828.748) -- 0:00:54 370000 -- [-1828.062] (-1827.508) (-1827.618) (-1828.654) * (-1826.530) (-1830.193) [-1828.327] (-1828.976) -- 0:00:54 Average standard deviation of split frequencies: 0.013521 370500 -- (-1827.890) (-1832.784) (-1829.296) [-1828.809] * [-1826.474] (-1827.288) (-1830.081) (-1830.450) -- 0:00:54 371000 -- (-1828.367) (-1831.000) [-1829.599] (-1828.654) * (-1827.202) (-1827.186) (-1830.667) [-1829.531] -- 0:00:55 371500 -- (-1831.327) [-1829.011] (-1832.013) (-1833.177) * [-1826.585] (-1827.172) (-1831.985) (-1827.212) -- 0:00:55 372000 -- (-1827.446) [-1828.453] (-1833.210) (-1830.295) * [-1828.034] (-1828.448) (-1828.285) (-1828.508) -- 0:00:55 372500 -- [-1826.977] (-1827.751) (-1831.403) (-1826.399) * (-1828.277) [-1827.463] (-1828.145) (-1830.863) -- 0:00:55 373000 -- [-1827.418] (-1833.277) (-1827.457) (-1827.768) * (-1827.149) (-1827.842) [-1828.143] (-1831.458) -- 0:00:55 373500 -- (-1827.227) [-1829.855] (-1829.558) (-1826.968) * (-1827.563) [-1827.519] (-1828.384) (-1831.553) -- 0:00:55 374000 -- (-1827.410) [-1827.693] (-1827.218) (-1827.228) * (-1827.832) (-1828.450) [-1829.773] (-1827.553) -- 0:00:55 374500 -- [-1829.806] (-1827.445) (-1826.489) (-1828.968) * (-1829.266) (-1827.890) [-1827.992] (-1828.830) -- 0:00:55 375000 -- (-1828.145) [-1827.923] (-1827.420) (-1829.699) * (-1829.541) [-1827.888] (-1827.880) (-1827.932) -- 0:00:55 Average standard deviation of split frequencies: 0.014012 375500 -- (-1828.318) (-1827.971) [-1827.420] (-1827.348) * (-1830.997) (-1827.679) [-1830.136] (-1833.298) -- 0:00:54 376000 -- [-1828.772] (-1827.862) (-1833.969) (-1827.906) * (-1829.483) (-1828.251) [-1829.023] (-1828.795) -- 0:00:54 376500 -- (-1828.697) (-1831.489) (-1831.610) [-1827.762] * (-1830.809) [-1827.666] (-1829.578) (-1831.401) -- 0:00:54 377000 -- (-1828.368) [-1829.743] (-1828.464) (-1830.907) * (-1827.967) [-1827.432] (-1829.463) (-1829.575) -- 0:00:54 377500 -- (-1830.703) (-1827.778) (-1828.585) [-1828.552] * (-1829.593) [-1826.859] (-1828.904) (-1827.792) -- 0:00:54 378000 -- (-1830.703) (-1827.754) [-1829.729] (-1829.013) * [-1829.473] (-1827.337) (-1827.609) (-1829.295) -- 0:00:54 378500 -- (-1828.436) (-1830.421) [-1826.661] (-1829.319) * (-1831.166) (-1827.881) [-1827.525] (-1832.397) -- 0:00:54 379000 -- [-1831.821] (-1828.956) (-1827.074) (-1830.669) * (-1830.456) (-1827.023) [-1832.284] (-1828.498) -- 0:00:54 379500 -- [-1828.328] (-1828.579) (-1827.070) (-1828.420) * (-1831.440) [-1827.226] (-1828.386) (-1829.860) -- 0:00:53 380000 -- (-1828.216) (-1826.919) (-1826.818) [-1828.052] * (-1827.576) (-1827.525) [-1827.756] (-1827.419) -- 0:00:53 Average standard deviation of split frequencies: 0.013209 380500 -- [-1829.877] (-1827.910) (-1830.602) (-1827.497) * [-1830.225] (-1828.027) (-1826.532) (-1826.973) -- 0:00:53 381000 -- [-1828.271] (-1829.572) (-1830.316) (-1827.881) * (-1831.253) (-1829.763) (-1829.762) [-1826.952] -- 0:00:53 381500 -- (-1827.695) (-1829.632) [-1830.357] (-1830.569) * [-1828.592] (-1828.562) (-1827.725) (-1829.040) -- 0:00:53 382000 -- (-1833.000) [-1827.718] (-1833.990) (-1826.805) * [-1830.182] (-1828.270) (-1829.045) (-1828.064) -- 0:00:53 382500 -- (-1830.238) [-1827.799] (-1831.704) (-1826.937) * (-1827.068) (-1832.666) (-1830.695) [-1826.704] -- 0:00:53 383000 -- (-1827.359) (-1828.148) (-1828.491) [-1827.898] * (-1830.333) [-1831.348] (-1827.477) (-1826.670) -- 0:00:54 383500 -- (-1830.871) (-1830.913) [-1828.093] (-1827.898) * [-1828.614] (-1831.651) (-1829.506) (-1828.482) -- 0:00:54 384000 -- (-1829.657) (-1827.640) (-1828.070) [-1826.943] * [-1831.961] (-1830.446) (-1831.163) (-1826.733) -- 0:00:54 384500 -- (-1827.787) (-1831.348) (-1828.252) [-1828.774] * (-1831.500) (-1829.241) [-1829.659] (-1829.345) -- 0:00:54 385000 -- (-1829.036) (-1833.169) [-1828.345] (-1829.390) * (-1828.288) [-1826.651] (-1829.223) (-1829.410) -- 0:00:54 Average standard deviation of split frequencies: 0.013177 385500 -- (-1834.294) (-1831.958) (-1828.571) [-1828.453] * (-1828.054) (-1826.783) [-1827.721] (-1829.648) -- 0:00:54 386000 -- (-1828.810) (-1832.707) [-1830.341] (-1827.469) * [-1828.552] (-1826.989) (-1830.543) (-1830.211) -- 0:00:54 386500 -- (-1833.635) (-1832.233) [-1827.202] (-1826.649) * (-1828.670) [-1827.388] (-1827.208) (-1828.400) -- 0:00:53 387000 -- (-1827.523) [-1829.755] (-1830.860) (-1827.404) * (-1830.044) [-1827.388] (-1828.996) (-1826.580) -- 0:00:53 387500 -- (-1827.039) (-1828.426) [-1830.881] (-1830.218) * (-1832.312) (-1826.774) [-1829.015] (-1827.812) -- 0:00:53 388000 -- (-1828.824) (-1828.435) (-1829.064) [-1830.370] * (-1832.110) (-1827.792) (-1830.693) [-1827.513] -- 0:00:53 388500 -- (-1828.471) (-1832.141) [-1828.766] (-1832.503) * (-1828.540) (-1831.022) (-1829.214) [-1827.375] -- 0:00:53 389000 -- (-1833.820) (-1828.715) (-1827.988) [-1829.047] * [-1832.524] (-1828.501) (-1828.214) (-1832.564) -- 0:00:53 389500 -- (-1834.970) (-1828.015) (-1830.347) [-1829.174] * (-1834.153) (-1827.950) [-1828.130] (-1836.063) -- 0:00:53 390000 -- [-1830.975] (-1827.229) (-1828.059) (-1829.849) * [-1829.130] (-1826.548) (-1828.463) (-1828.870) -- 0:00:53 Average standard deviation of split frequencies: 0.012804 390500 -- (-1833.951) [-1827.660] (-1827.934) (-1832.511) * [-1828.363] (-1826.795) (-1831.059) (-1827.993) -- 0:00:53 391000 -- [-1831.951] (-1826.894) (-1830.490) (-1832.745) * (-1828.485) (-1826.690) [-1827.813] (-1827.528) -- 0:00:52 391500 -- (-1826.971) (-1827.925) [-1828.512] (-1829.486) * (-1828.101) (-1828.898) (-1828.644) [-1830.044] -- 0:00:52 392000 -- (-1831.420) (-1830.375) [-1829.527] (-1830.966) * (-1830.014) (-1830.817) (-1827.949) [-1832.067] -- 0:00:52 392500 -- [-1829.637] (-1829.899) (-1828.838) (-1829.198) * (-1829.564) (-1828.427) [-1827.666] (-1830.042) -- 0:00:52 393000 -- (-1827.091) [-1828.243] (-1829.926) (-1830.927) * (-1829.435) (-1832.134) [-1826.974] (-1830.402) -- 0:00:52 393500 -- (-1828.957) [-1827.867] (-1832.535) (-1830.440) * [-1829.031] (-1828.164) (-1826.760) (-1830.064) -- 0:00:52 394000 -- (-1828.120) (-1827.626) [-1829.654] (-1829.037) * [-1829.482] (-1827.252) (-1827.261) (-1828.933) -- 0:00:52 394500 -- [-1827.838] (-1826.515) (-1827.957) (-1828.652) * [-1828.687] (-1828.955) (-1827.130) (-1828.943) -- 0:00:53 395000 -- (-1827.458) (-1826.602) [-1827.290] (-1828.095) * (-1830.609) [-1829.755] (-1826.845) (-1826.746) -- 0:00:53 Average standard deviation of split frequencies: 0.012534 395500 -- (-1830.491) [-1829.777] (-1827.321) (-1828.449) * (-1829.293) (-1829.878) [-1827.363] (-1829.479) -- 0:00:53 396000 -- (-1828.298) (-1827.339) (-1827.452) [-1828.246] * (-1826.969) (-1828.000) (-1827.005) [-1829.428] -- 0:00:53 396500 -- (-1827.882) (-1827.784) (-1827.450) [-1828.210] * (-1827.211) [-1829.148] (-1826.857) (-1827.602) -- 0:00:53 397000 -- [-1827.633] (-1826.954) (-1827.971) (-1829.693) * (-1828.217) (-1830.143) [-1826.709] (-1829.033) -- 0:00:53 397500 -- (-1830.032) (-1827.200) (-1830.064) [-1827.989] * [-1828.198] (-1828.290) (-1829.037) (-1827.707) -- 0:00:53 398000 -- [-1834.006] (-1831.486) (-1833.094) (-1832.345) * (-1828.430) (-1827.669) (-1828.227) [-1827.812] -- 0:00:52 398500 -- (-1833.621) [-1827.119] (-1830.011) (-1832.587) * (-1829.043) [-1830.551] (-1827.974) (-1828.102) -- 0:00:52 399000 -- (-1827.863) [-1826.999] (-1831.034) (-1827.389) * (-1829.630) (-1828.271) (-1827.480) [-1829.515] -- 0:00:52 399500 -- (-1828.084) [-1827.116] (-1829.113) (-1827.659) * (-1829.994) (-1828.155) [-1828.208] (-1832.177) -- 0:00:52 400000 -- (-1828.403) [-1827.018] (-1829.114) (-1827.953) * [-1829.595] (-1826.978) (-1827.195) (-1828.089) -- 0:00:52 Average standard deviation of split frequencies: 0.012207 400500 -- (-1828.286) (-1827.163) (-1828.134) [-1827.769] * (-1829.212) [-1827.149] (-1827.781) (-1828.355) -- 0:00:52 401000 -- (-1828.123) [-1827.212] (-1828.084) (-1827.750) * (-1829.775) [-1827.149] (-1827.295) (-1829.912) -- 0:00:52 401500 -- [-1827.379] (-1827.208) (-1830.680) (-1829.011) * [-1827.541] (-1826.736) (-1827.280) (-1829.599) -- 0:00:52 402000 -- (-1827.004) (-1827.774) (-1830.160) [-1828.773] * [-1828.458] (-1826.981) (-1828.569) (-1830.542) -- 0:00:52 402500 -- [-1827.159] (-1827.437) (-1830.834) (-1827.669) * (-1829.876) [-1827.050] (-1826.973) (-1830.425) -- 0:00:51 403000 -- [-1828.559] (-1829.395) (-1829.023) (-1829.800) * [-1829.447] (-1827.550) (-1829.359) (-1831.424) -- 0:00:51 403500 -- [-1829.171] (-1830.638) (-1827.451) (-1826.899) * (-1830.691) [-1827.369] (-1831.173) (-1831.690) -- 0:00:51 404000 -- (-1827.709) (-1830.245) [-1827.343] (-1827.635) * (-1830.465) (-1828.856) [-1833.217] (-1827.478) -- 0:00:51 404500 -- (-1830.351) [-1829.288] (-1828.201) (-1834.174) * (-1829.735) (-1828.783) (-1838.924) [-1830.051] -- 0:00:51 405000 -- (-1832.120) (-1828.808) [-1826.770] (-1827.814) * (-1827.365) [-1831.750] (-1833.464) (-1830.140) -- 0:00:51 Average standard deviation of split frequencies: 0.012704 405500 -- (-1828.641) (-1828.518) [-1828.285] (-1827.779) * (-1829.515) [-1827.699] (-1833.841) (-1828.588) -- 0:00:51 406000 -- [-1828.292] (-1830.278) (-1828.336) (-1832.570) * [-1829.370] (-1828.947) (-1829.811) (-1827.807) -- 0:00:52 406500 -- (-1828.555) (-1829.006) [-1830.095] (-1832.758) * [-1827.840] (-1827.473) (-1827.047) (-1829.198) -- 0:00:52 407000 -- (-1832.393) (-1831.315) [-1829.762] (-1832.004) * [-1829.073] (-1827.493) (-1827.718) (-1831.089) -- 0:00:52 407500 -- [-1832.672] (-1828.445) (-1828.986) (-1827.709) * (-1829.101) [-1828.263] (-1830.171) (-1829.576) -- 0:00:52 408000 -- (-1831.293) [-1831.341] (-1830.636) (-1829.820) * [-1828.684] (-1835.523) (-1830.655) (-1829.845) -- 0:00:52 408500 -- [-1828.859] (-1829.880) (-1832.863) (-1828.521) * (-1829.336) [-1827.232] (-1827.209) (-1828.605) -- 0:00:52 409000 -- (-1833.763) [-1826.707] (-1838.502) (-1828.397) * (-1827.911) (-1827.207) [-1829.381] (-1829.303) -- 0:00:52 409500 -- (-1833.311) [-1830.221] (-1831.902) (-1827.976) * [-1827.557] (-1827.184) (-1831.079) (-1829.142) -- 0:00:51 410000 -- (-1832.844) (-1831.790) [-1831.184] (-1828.015) * (-1827.619) [-1828.565] (-1828.594) (-1831.506) -- 0:00:51 Average standard deviation of split frequencies: 0.012754 410500 -- (-1829.259) (-1832.237) [-1832.392] (-1827.249) * (-1832.718) [-1828.176] (-1829.020) (-1834.444) -- 0:00:51 411000 -- (-1827.226) (-1831.055) [-1828.289] (-1830.983) * (-1826.841) (-1827.359) [-1827.765] (-1832.114) -- 0:00:51 411500 -- (-1828.443) (-1830.742) [-1826.686] (-1830.943) * (-1829.784) (-1832.767) (-1829.723) [-1830.270] -- 0:00:51 412000 -- (-1829.050) (-1832.745) (-1830.875) [-1831.531] * (-1828.400) (-1829.660) (-1830.010) [-1829.285] -- 0:00:51 412500 -- (-1832.038) (-1827.226) [-1827.727] (-1829.244) * (-1832.430) (-1829.560) [-1827.901] (-1830.309) -- 0:00:51 413000 -- (-1828.900) (-1827.307) (-1826.910) [-1830.241] * [-1827.587] (-1833.336) (-1829.428) (-1828.016) -- 0:00:51 413500 -- (-1833.203) [-1827.283] (-1826.490) (-1830.135) * (-1832.728) (-1830.063) (-1829.081) [-1826.918] -- 0:00:51 414000 -- (-1827.969) (-1827.704) [-1830.876] (-1830.725) * [-1830.814] (-1830.330) (-1827.777) (-1828.340) -- 0:00:50 414500 -- [-1828.537] (-1828.292) (-1831.546) (-1829.511) * (-1827.098) [-1827.913] (-1830.280) (-1832.582) -- 0:00:50 415000 -- (-1830.851) (-1827.205) [-1826.844] (-1829.511) * (-1826.933) [-1827.613] (-1830.140) (-1831.902) -- 0:00:50 Average standard deviation of split frequencies: 0.012087 415500 -- [-1828.454] (-1829.331) (-1828.264) (-1829.694) * [-1827.932] (-1828.381) (-1827.457) (-1831.138) -- 0:00:50 416000 -- (-1830.565) (-1828.933) (-1831.588) [-1828.465] * (-1833.410) (-1828.849) [-1829.997] (-1830.587) -- 0:00:50 416500 -- (-1832.984) (-1831.423) (-1831.049) [-1828.512] * (-1829.303) [-1829.156] (-1827.539) (-1833.599) -- 0:00:50 417000 -- (-1827.114) [-1831.567] (-1826.640) (-1829.017) * (-1827.613) (-1828.345) [-1827.283] (-1831.300) -- 0:00:50 417500 -- (-1826.895) (-1828.326) [-1826.605] (-1828.415) * [-1827.153] (-1830.411) (-1830.367) (-1831.822) -- 0:00:51 418000 -- (-1827.315) [-1829.189] (-1828.167) (-1828.901)