--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 09:10:37 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/1res/accD5/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/1res/accD5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/accD5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/accD5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2243.04 -2246.20 2 -2243.03 -2245.98 -------------------------------------- TOTAL -2243.04 -2246.10 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/accD5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/accD5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/accD5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896808 0.088355 0.372130 1.495832 0.867177 1296.77 1348.36 1.000 r(A<->C){all} 0.171178 0.020136 0.000120 0.450395 0.136820 169.39 201.55 1.001 r(A<->G){all} 0.161583 0.018790 0.000028 0.423783 0.126096 272.71 285.56 1.000 r(A<->T){all} 0.163353 0.018675 0.000092 0.443829 0.131766 190.10 232.73 1.001 r(C<->G){all} 0.167827 0.019545 0.000031 0.452287 0.131888 132.97 175.41 1.000 r(C<->T){all} 0.170703 0.020375 0.000013 0.459710 0.130792 207.31 211.82 1.001 r(G<->T){all} 0.165356 0.020243 0.000061 0.464681 0.125110 191.89 248.23 1.003 pi(A){all} 0.217860 0.000104 0.196879 0.236932 0.217855 1019.06 1163.82 1.000 pi(C){all} 0.319296 0.000124 0.297671 0.341339 0.319516 1167.55 1222.87 1.000 pi(G){all} 0.285742 0.000117 0.265509 0.308019 0.285563 1106.35 1179.27 1.000 pi(T){all} 0.177103 0.000083 0.158642 0.194042 0.176929 1263.50 1264.95 1.000 alpha{1,2} 0.422251 0.230745 0.000164 1.371092 0.256692 1262.28 1356.61 1.000 alpha{3} 0.448695 0.233258 0.000101 1.422034 0.296473 1501.00 1501.00 1.000 pinvar{all} 0.999121 0.000001 0.997241 1.000000 0.999431 914.05 1156.31 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2115.272373 Model 2: PositiveSelection -2115.272675 Model 0: one-ratio -2115.272556 Model 7: beta -2115.272373 Model 8: beta&w>1 -2115.272373 Model 0 vs 1 3.660000002128072E-4 Model 2 vs 1 6.040000007487833E-4 Model 8 vs 7 0.0
>C1 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL >C2 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL >C3 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL >C4 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL >C5 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL >C6 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=549 C1 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK C2 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK C3 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK C4 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK C5 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK C6 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK ************************************************** C1 VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT C2 VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT C3 VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT C4 VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT C5 VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT C6 VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT ************************************************** C1 GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN C2 GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN C3 GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN C4 GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN C5 GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN C6 GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN ************************************************** C1 DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA C2 DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA C3 DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA C4 DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA C5 DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA C6 DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA ************************************************** C1 LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY C2 LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY C3 LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY C4 LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY C5 LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY C6 LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY ************************************************** C1 VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL C2 VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL C3 VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL C4 VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL C5 VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL C6 VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL ************************************************** C1 DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV C2 DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV C3 DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV C4 DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV C5 DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV C6 DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV ************************************************** C1 GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE C2 GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE C3 GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE C4 GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE C5 GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE C6 GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE ************************************************** C1 QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN C2 QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN C3 QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN C4 QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN C5 QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN C6 QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN ************************************************** C1 LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL C2 LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL C3 LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL C4 LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL C5 LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL C6 LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL ************************************************** C1 VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL C2 VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL C3 VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL C4 VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL C5 VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL C6 VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL ************************************************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 549 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 549 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16470] Library Relaxation: Multi_proc [96] Relaxation Summary: [16470]--->[16470] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.568 Mb, Max= 31.152 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK C2 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK C3 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK C4 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK C5 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK C6 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK ************************************************** C1 VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT C2 VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT C3 VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT C4 VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT C5 VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT C6 VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT ************************************************** C1 GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN C2 GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN C3 GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN C4 GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN C5 GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN C6 GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN ************************************************** C1 DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA C2 DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA C3 DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA C4 DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA C5 DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA C6 DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA ************************************************** C1 LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY C2 LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY C3 LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY C4 LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY C5 LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY C6 LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY ************************************************** C1 VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL C2 VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL C3 VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL C4 VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL C5 VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL C6 VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL ************************************************** C1 DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV C2 DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV C3 DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV C4 DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV C5 DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV C6 DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV ************************************************** C1 GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE C2 GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE C3 GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE C4 GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE C5 GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE C6 GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE ************************************************** C1 QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN C2 QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN C3 QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN C4 QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN C5 QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN C6 QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN ************************************************** C1 LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL C2 LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL C3 LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL C4 LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL C5 LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL C6 LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL ************************************************** C1 VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL C2 VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL C3 VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL C4 VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL C5 VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL C6 VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL ************************************************* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGACAAGCGTTACCGACCACTCGGCTCATTCAATGGAACGCGCTGCCGA C2 ATGACAAGCGTTACCGACCACTCGGCTCATTCAATGGAACGCGCTGCCGA C3 ATGACAAGCGTTACCGACCACTCGGCTCATTCAATGGAACGCGCTGCCGA C4 ATGACAAGCGTTACCGACCACTCGGCTCATTCAATGGAACGCGCTGCCGA C5 ATGACAAGCGTTACCGACCACTCGGCTCATTCAATGGAACGCGCTGCCGA C6 ATGACAAGCGTTACCGACCACTCGGCTCATTCAATGGAACGCGCTGCCGA ************************************************** C1 GCACACGATCAATATCCACACCACGGCAGGCAAGCTGGCCGAGCTGCATA C2 GCACACGATCAATATCCACACCACGGCAGGCAAGCTGGCCGAGCTGCATA C3 GCACACGATCAATATCCACACCACGGCAGGCAAGCTGGCCGAGCTGCATA C4 GCACACGATCAATATCCACACCACGGCAGGCAAGCTGGCCGAGCTGCATA C5 GCACACGATCAATATCCACACCACGGCAGGCAAGCTGGCCGAGCTGCATA C6 GCACACGATCAATATCCACACCACGGCAGGCAAGCTGGCCGAGCTGCATA ************************************************** C1 AGCGGACCGAAGAAGCGCTGCATCCGGTCGGTGCAGCTGCCTTCGAGAAG C2 AGCGGACCGAAGAAGCGCTGCATCCGGTCGGTGCAGCTGCCTTCGAGAAG C3 AGCGGACCGAAGAAGCGCTGCATCCGGTCGGTGCAGCTGCCTTCGAGAAG C4 AGCGGACCGAAGAAGCGCTGCATCCGGTCGGTGCAGCTGCCTTCGAGAAG C5 AGCGGACCGAAGAAGCGCTGCATCCGGTCGGTGCAGCTGCCTTCGAGAAG C6 AGCGGACCGAAGAAGCGCTGCATCCGGTCGGTGCAGCTGCCTTCGAGAAG ************************************************** C1 GTACACGCTAAGGGTAAGTTTACCGCCCGCGAGCGCATCTACGCCCTATT C2 GTACACGCTAAGGGTAAGTTTACCGCCCGCGAGCGCATCTACGCCCTATT C3 GTACACGCTAAGGGTAAGTTTACCGCCCGCGAGCGCATCTACGCCCTATT C4 GTACACGCTAAGGGTAAGTTTACCGCCCGCGAGCGCATCTACGCCCTATT C5 GTACACGCTAAGGGTAAGTTTACCGCCCGCGAGCGCATCTACGCCCTATT C6 GTACACGCTAAGGGTAAGTTTACCGCCCGCGAGCGCATCTACGCCCTATT ************************************************** C1 GGACGACGACTCATTCGTCGAACTCGACGCACTGGCCAGACACCGCAGCA C2 GGACGACGACTCATTCGTCGAACTCGACGCACTGGCCAGACACCGCAGCA C3 GGACGACGACTCATTCGTCGAACTCGACGCACTGGCCAGACACCGCAGCA C4 GGACGACGACTCATTCGTCGAACTCGACGCACTGGCCAGACACCGCAGCA C5 GGACGACGACTCATTCGTCGAACTCGACGCACTGGCCAGACACCGCAGCA C6 GGACGACGACTCATTCGTCGAACTCGACGCACTGGCCAGACACCGCAGCA ************************************************** C1 CCAACTTCGGCCTCGGTGAAAACCGCCCGGTAGGCGATGGCGTGGTCACC C2 CCAACTTCGGCCTCGGTGAAAACCGCCCGGTAGGCGATGGCGTGGTCACC C3 CCAACTTCGGCCTCGGTGAAAACCGCCCGGTAGGCGATGGCGTGGTCACC C4 CCAACTTCGGCCTCGGTGAAAACCGCCCGGTAGGCGATGGCGTGGTCACC C5 CCAACTTCGGCCTCGGTGAAAACCGCCCGGTAGGCGATGGCGTGGTCACC C6 CCAACTTCGGCCTCGGTGAAAACCGCCCGGTAGGCGATGGCGTGGTCACC ************************************************** C1 GGCTACGGCACCATCGACGGCCGCGACGTATGCATCTTCAGCCAGGACGT C2 GGCTACGGCACCATCGACGGCCGCGACGTATGCATCTTCAGCCAGGACGT C3 GGCTACGGCACCATCGACGGCCGCGACGTATGCATCTTCAGCCAGGACGT C4 GGCTACGGCACCATCGACGGCCGCGACGTATGCATCTTCAGCCAGGACGT C5 GGCTACGGCACCATCGACGGCCGCGACGTATGCATCTTCAGCCAGGACGT C6 GGCTACGGCACCATCGACGGCCGCGACGTATGCATCTTCAGCCAGGACGT ************************************************** C1 CACGGTGTTCGGCGGCAGCCTGGGCGAAGTGTATGGCGAGAAGATCGTCA C2 CACGGTGTTCGGCGGCAGCCTGGGCGAAGTGTATGGCGAGAAGATCGTCA C3 CACGGTGTTCGGCGGCAGCCTGGGCGAAGTGTATGGCGAGAAGATCGTCA C4 CACGGTGTTCGGCGGCAGCCTGGGCGAAGTGTATGGCGAGAAGATCGTCA C5 CACGGTGTTCGGCGGCAGCCTGGGCGAAGTGTATGGCGAGAAGATCGTCA C6 CACGGTGTTCGGCGGCAGCCTGGGCGAAGTGTATGGCGAGAAGATCGTCA ************************************************** C1 AGGTCCAGGAACTGGCGATCAAGACCGGCCGTCCGCTTATCGGCATCAAC C2 AGGTCCAGGAACTGGCGATCAAGACCGGCCGTCCGCTTATCGGCATCAAC C3 AGGTCCAGGAACTGGCGATCAAGACCGGCCGTCCGCTTATCGGCATCAAC C4 AGGTCCAGGAACTGGCGATCAAGACCGGCCGTCCGCTTATCGGCATCAAC C5 AGGTCCAGGAACTGGCGATCAAGACCGGCCGTCCGCTTATCGGCATCAAC C6 AGGTCCAGGAACTGGCGATCAAGACCGGCCGTCCGCTTATCGGCATCAAC ************************************************** C1 GACGGCGCGGGCGCGCGTATCCAAGAAGGCGTCGTCTCGCTCGGCCTGTA C2 GACGGCGCGGGCGCGCGTATCCAAGAAGGCGTCGTCTCGCTCGGCCTGTA C3 GACGGCGCGGGCGCGCGTATCCAAGAAGGCGTCGTCTCGCTCGGCCTGTA C4 GACGGCGCGGGCGCGCGTATCCAAGAAGGCGTCGTCTCGCTCGGCCTGTA C5 GACGGCGCGGGCGCGCGTATCCAAGAAGGCGTCGTCTCGCTCGGCCTGTA C6 GACGGCGCGGGCGCGCGTATCCAAGAAGGCGTCGTCTCGCTCGGCCTGTA ************************************************** C1 CAGCCGGATTTTCCGCAACAATATCTTGGCCTCCGGCGTCATCCCGCAGA C2 CAGCCGGATTTTCCGCAACAATATCTTGGCCTCCGGCGTCATCCCGCAGA C3 CAGCCGGATTTTCCGCAACAATATCTTGGCCTCCGGCGTCATCCCGCAGA C4 CAGCCGGATTTTCCGCAACAATATCTTGGCCTCCGGCGTCATCCCGCAGA C5 CAGCCGGATTTTCCGCAACAATATCTTGGCCTCCGGCGTCATCCCGCAGA C6 CAGCCGGATTTTCCGCAACAATATCTTGGCCTCCGGCGTCATCCCGCAGA ************************************************** C1 TCTCGCTGATCATGGGAGCGGCCGCCGGTGGACACGTGTATTCCCCAGCA C2 TCTCGCTGATCATGGGAGCGGCCGCCGGTGGACACGTGTATTCCCCAGCA C3 TCTCGCTGATCATGGGAGCGGCCGCCGGTGGACACGTGTATTCCCCAGCA C4 TCTCGCTGATCATGGGAGCGGCCGCCGGTGGACACGTGTATTCCCCAGCA C5 TCTCGCTGATCATGGGAGCGGCCGCCGGTGGACACGTGTATTCCCCAGCA C6 TCTCGCTGATCATGGGAGCGGCCGCCGGTGGACACGTGTATTCCCCAGCA ************************************************** C1 CTGACCGACTTCGTGGTTATGGTCGACCAAACCAGCCAGATGTTCATCAC C2 CTGACCGACTTCGTGGTTATGGTCGACCAAACCAGCCAGATGTTCATCAC C3 CTGACCGACTTCGTGGTTATGGTCGACCAAACCAGCCAGATGTTCATCAC C4 CTGACCGACTTCGTGGTTATGGTCGACCAAACCAGCCAGATGTTCATCAC C5 CTGACCGACTTCGTGGTTATGGTCGACCAAACCAGCCAGATGTTCATCAC C6 CTGACCGACTTCGTGGTTATGGTCGACCAAACCAGCCAGATGTTCATCAC ************************************************** C1 CGGACCCGACGTCATCAAGACCGTCACCGGCGAGGACGTCACCATGGAGG C2 CGGACCCGACGTCATCAAGACCGTCACCGGCGAGGACGTCACCATGGAGG C3 CGGACCCGACGTCATCAAGACCGTCACCGGCGAGGACGTCACCATGGAGG C4 CGGACCCGACGTCATCAAGACCGTCACCGGCGAGGACGTCACCATGGAGG C5 CGGACCCGACGTCATCAAGACCGTCACCGGCGAGGACGTCACCATGGAGG C6 CGGACCCGACGTCATCAAGACCGTCACCGGCGAGGACGTCACCATGGAGG ************************************************** C1 AGCTGGGTGGCGCCCATACCCACATGGCCAAGTCGGGTACCGCACACTAT C2 AGCTGGGTGGCGCCCATACCCACATGGCCAAGTCGGGTACCGCACACTAT C3 AGCTGGGTGGCGCCCATACCCACATGGCCAAGTCGGGTACCGCACACTAT C4 AGCTGGGTGGCGCCCATACCCACATGGCCAAGTCGGGTACCGCACACTAT C5 AGCTGGGTGGCGCCCATACCCACATGGCCAAGTCGGGTACCGCACACTAT C6 AGCTGGGTGGCGCCCATACCCACATGGCCAAGTCGGGTACCGCACACTAT ************************************************** C1 GTAGCATCGGGCGAGCAAGACGCCTTCGATTGGGTGCGCGATGTGTTGAG C2 GTAGCATCGGGCGAGCAAGACGCCTTCGATTGGGTGCGCGATGTGTTGAG C3 GTAGCATCGGGCGAGCAAGACGCCTTCGATTGGGTGCGCGATGTGTTGAG C4 GTAGCATCGGGCGAGCAAGACGCCTTCGATTGGGTGCGCGATGTGTTGAG C5 GTAGCATCGGGCGAGCAAGACGCCTTCGATTGGGTGCGCGATGTGTTGAG C6 GTAGCATCGGGCGAGCAAGACGCCTTCGATTGGGTGCGCGATGTGTTGAG ************************************************** C1 CTACCTGCCGTCAAACAACTTCACCGACGCGCCGCGGTATTCTAAGCCCG C2 CTACCTGCCGTCAAACAACTTCACCGACGCGCCGCGGTATTCTAAGCCCG C3 CTACCTGCCGTCAAACAACTTCACCGACGCGCCGCGGTATTCTAAGCCCG C4 CTACCTGCCGTCAAACAACTTCACCGACGCGCCGCGGTATTCTAAGCCCG C5 CTACCTGCCGTCAAACAACTTCACCGACGCGCCGCGGTATTCTAAGCCCG C6 CTACCTGCCGTCAAACAACTTCACCGACGCGCCGCGGTATTCTAAGCCCG ************************************************** C1 TTCCTCACGGCTCCATTGAAGACAACCTGACCGCTAAAGACTTGGAGTTG C2 TTCCTCACGGCTCCATTGAAGACAACCTGACCGCTAAAGACTTGGAGTTG C3 TTCCTCACGGCTCCATTGAAGACAACCTGACCGCTAAAGACTTGGAGTTG C4 TTCCTCACGGCTCCATTGAAGACAACCTGACCGCTAAAGACTTGGAGTTG C5 TTCCTCACGGCTCCATTGAAGACAACCTGACCGCTAAAGACTTGGAGTTG C6 TTCCTCACGGCTCCATTGAAGACAACCTGACCGCTAAAGACTTGGAGTTG ************************************************** C1 GACACGCTTATCCCGGACTCGCCGAACCAACCGTACGACATGCACGAAGT C2 GACACGCTTATCCCGGACTCGCCGAACCAACCGTACGACATGCACGAAGT C3 GACACGCTTATCCCGGACTCGCCGAACCAACCGTACGACATGCACGAAGT C4 GACACGCTTATCCCGGACTCGCCGAACCAACCGTACGACATGCACGAAGT C5 GACACGCTTATCCCGGACTCGCCGAACCAACCGTACGACATGCACGAAGT C6 GACACGCTTATCCCGGACTCGCCGAACCAACCGTACGACATGCACGAAGT ************************************************** C1 GGTGACCCGCCTCCTCGACGAGGAAGAGTTCCTTGAGGTGCAAGCCGGTT C2 GGTGACCCGCCTCCTCGACGAGGAAGAGTTCCTTGAGGTGCAAGCCGGTT C3 GGTGACCCGCCTCCTCGACGAGGAAGAGTTCCTTGAGGTGCAAGCCGGTT C4 GGTGACCCGCCTCCTCGACGAGGAAGAGTTCCTTGAGGTGCAAGCCGGTT C5 GGTGACCCGCCTCCTCGACGAGGAAGAGTTCCTTGAGGTGCAAGCCGGTT C6 GGTGACCCGCCTCCTCGACGAGGAAGAGTTCCTTGAGGTGCAAGCCGGTT ************************************************** C1 ACGCCACCAACATCGTCGTCGGGCTCGGACGCATAGATGACCGACCGGTG C2 ACGCCACCAACATCGTCGTCGGGCTCGGACGCATAGATGACCGACCGGTG C3 ACGCCACCAACATCGTCGTCGGGCTCGGACGCATAGATGACCGACCGGTG C4 ACGCCACCAACATCGTCGTCGGGCTCGGACGCATAGATGACCGACCGGTG C5 ACGCCACCAACATCGTCGTCGGGCTCGGACGCATAGATGACCGACCGGTG C6 ACGCCACCAACATCGTCGTCGGGCTCGGACGCATAGATGACCGACCGGTG ************************************************** C1 GGCATCGTTGCCAACCAACCCATCCAGTTCGCCGGCTGTCTAGACATCAA C2 GGCATCGTTGCCAACCAACCCATCCAGTTCGCCGGCTGTCTAGACATCAA C3 GGCATCGTTGCCAACCAACCCATCCAGTTCGCCGGCTGTCTAGACATCAA C4 GGCATCGTTGCCAACCAACCCATCCAGTTCGCCGGCTGTCTAGACATCAA C5 GGCATCGTTGCCAACCAACCCATCCAGTTCGCCGGCTGTCTAGACATCAA C6 GGCATCGTTGCCAACCAACCCATCCAGTTCGCCGGCTGTCTAGACATCAA ************************************************** C1 CGCCTCGGAAAAGGCAGCCCGATTTGTGCGGGTCTGCGACTGCTTCAACA C2 CGCCTCGGAAAAGGCAGCCCGATTTGTGCGGGTCTGCGACTGCTTCAACA C3 CGCCTCGGAAAAGGCAGCCCGATTTGTGCGGGTCTGCGACTGCTTCAACA C4 CGCCTCGGAAAAGGCAGCCCGATTTGTGCGGGTCTGCGACTGCTTCAACA C5 CGCCTCGGAAAAGGCAGCCCGATTTGTGCGGGTCTGCGACTGCTTCAACA C6 CGCCTCGGAAAAGGCAGCCCGATTTGTGCGGGTCTGCGACTGCTTCAACA ************************************************** C1 TCCCGATCGTGATGTTGGTGGATGTTCCAGGCTTCCTGCCTGGCACCGAG C2 TCCCGATCGTGATGTTGGTGGATGTTCCAGGCTTCCTGCCTGGCACCGAG C3 TCCCGATCGTGATGTTGGTGGATGTTCCAGGCTTCCTGCCTGGCACCGAG C4 TCCCGATCGTGATGTTGGTGGATGTTCCAGGCTTCCTGCCTGGCACCGAG C5 TCCCGATCGTGATGTTGGTGGATGTTCCAGGCTTCCTGCCTGGCACCGAG C6 TCCCGATCGTGATGTTGGTGGATGTTCCAGGCTTCCTGCCTGGCACCGAG ************************************************** C1 CAAGAATATGATGGCATCATCCGACGCGGCGCAAAGCTGCTCTTCGCCTA C2 CAAGAATATGATGGCATCATCCGACGCGGCGCAAAGCTGCTCTTCGCCTA C3 CAAGAATATGATGGCATCATCCGACGCGGCGCAAAGCTGCTCTTCGCCTA C4 CAAGAATATGATGGCATCATCCGACGCGGCGCAAAGCTGCTCTTCGCCTA C5 CAAGAATATGATGGCATCATCCGACGCGGCGCAAAGCTGCTCTTCGCCTA C6 CAAGAATATGATGGCATCATCCGACGCGGCGCAAAGCTGCTCTTCGCCTA ************************************************** C1 CGGCGAAGCCACCGTACCCAAGATCACCGTCATCACCCGCAAGGCCTACG C2 CGGCGAAGCCACCGTACCCAAGATCACCGTCATCACCCGCAAGGCCTACG C3 CGGCGAAGCCACCGTACCCAAGATCACCGTCATCACCCGCAAGGCCTACG C4 CGGCGAAGCCACCGTACCCAAGATCACCGTCATCACCCGCAAGGCCTACG C5 CGGCGAAGCCACCGTACCCAAGATCACCGTCATCACCCGCAAGGCCTACG C6 CGGCGAAGCCACCGTACCCAAGATCACCGTCATCACCCGCAAGGCCTACG ************************************************** C1 GTGGCGCTTACTGCGTGATGGGCTCCAAAAATATGGGCTGCGACGTCAAC C2 GTGGCGCTTACTGCGTGATGGGCTCCAAAAATATGGGCTGCGACGTCAAC C3 GTGGCGCTTACTGCGTGATGGGCTCCAAAAATATGGGCTGCGACGTCAAC C4 GTGGCGCTTACTGCGTGATGGGCTCCAAAAATATGGGCTGCGACGTCAAC C5 GTGGCGCTTACTGCGTGATGGGCTCCAAAAATATGGGCTGCGACGTCAAC C6 GTGGCGCTTACTGCGTGATGGGCTCCAAAAATATGGGCTGCGACGTCAAC ************************************************** C1 CTGGCTTGGCCGACCGCACAGATTGCGGTGATGGGTGCCTCCGGCGCAGT C2 CTGGCTTGGCCGACCGCACAGATTGCGGTGATGGGTGCCTCCGGCGCAGT C3 CTGGCTTGGCCGACCGCACAGATTGCGGTGATGGGTGCCTCCGGCGCAGT C4 CTGGCTTGGCCGACCGCACAGATTGCGGTGATGGGTGCCTCCGGCGCAGT C5 CTGGCTTGGCCGACCGCACAGATTGCGGTGATGGGTGCCTCCGGCGCAGT C6 CTGGCTTGGCCGACCGCACAGATTGCGGTGATGGGTGCCTCCGGCGCAGT ************************************************** C1 AGGCTTCGTGTACCGCAAGGAACTGGCCCAAGCGGCCAAGAACGGCGCCA C2 AGGCTTCGTGTACCGCAAGGAACTGGCCCAAGCGGCCAAGAACGGCGCCA C3 AGGCTTCGTGTACCGCAAGGAACTGGCCCAAGCGGCCAAGAACGGCGCCA C4 AGGCTTCGTGTACCGCAAGGAACTGGCCCAAGCGGCCAAGAACGGCGCCA C5 AGGCTTCGTGTACCGCAAGGAACTGGCCCAAGCGGCCAAGAACGGCGCCA C6 AGGCTTCGTGTACCGCAAGGAACTGGCCCAAGCGGCCAAGAACGGCGCCA ************************************************** C1 ATGTTGATGAGCTACGCCTGCAGCTGCAGCAAGAGTACGAGGACACCCTG C2 ATGTTGATGAGCTACGCCTGCAGCTGCAGCAAGAGTACGAGGACACCCTG C3 ATGTTGATGAGCTACGCCTGCAGCTGCAGCAAGAGTACGAGGACACCCTG C4 ATGTTGATGAGCTACGCCTGCAGCTGCAGCAAGAGTACGAGGACACCCTG C5 ATGTTGATGAGCTACGCCTGCAGCTGCAGCAAGAGTACGAGGACACCCTG C6 ATGTTGATGAGCTACGCCTGCAGCTGCAGCAAGAGTACGAGGACACCCTG ************************************************** C1 GTGAACCCGTACATCGCCGCCGAACGAGGTTACGTCGATGCGGTGATCCC C2 GTGAACCCGTACATCGCCGCCGAACGAGGTTACGTCGATGCGGTGATCCC C3 GTGAACCCGTACATCGCCGCCGAACGAGGTTACGTCGATGCGGTGATCCC C4 GTGAACCCGTACATCGCCGCCGAACGAGGTTACGTCGATGCGGTGATCCC C5 GTGAACCCGTACATCGCCGCCGAACGAGGTTACGTCGATGCGGTGATCCC C6 GTGAACCCGTACATCGCCGCCGAACGAGGTTACGTCGATGCGGTGATCCC ************************************************** C1 GCCGTCACACACTCGCGGCTACATTGCCACGGCGCTTCACCTGTTGGAGC C2 GCCGTCACACACTCGCGGCTACATTGCCACGGCGCTTCACCTGTTGGAGC C3 GCCGTCACACACTCGCGGCTACATTGCCACGGCGCTTCACCTGTTGGAGC C4 GCCGTCACACACTCGCGGCTACATTGCCACGGCGCTTCACCTGTTGGAGC C5 GCCGTCACACACTCGCGGCTACATTGCCACGGCGCTTCACCTGTTGGAGC C6 GCCGTCACACACTCGCGGCTACATTGCCACGGCGCTTCACCTGTTGGAGC ************************************************** C1 GCAAGATCGCACACCTTCCCCCCAAGAAGCACGGGAACATTCCGCTG C2 GCAAGATCGCACACCTTCCCCCCAAGAAGCACGGGAACATTCCGCTG C3 GCAAGATCGCACACCTTCCCCCCAAGAAGCACGGGAACATTCCGCTG C4 GCAAGATCGCACACCTTCCCCCCAAGAAGCACGGGAACATTCCGCTG C5 GCAAGATCGCACACCTTCCCCCCAAGAAGCACGGGAACATTCCGCTG C6 GCAAGATCGCACACCTTCCCCCCAAGAAGCACGGGAACATTCCGCTG *********************************************** >C1 ATGACAAGCGTTACCGACCACTCGGCTCATTCAATGGAACGCGCTGCCGA GCACACGATCAATATCCACACCACGGCAGGCAAGCTGGCCGAGCTGCATA AGCGGACCGAAGAAGCGCTGCATCCGGTCGGTGCAGCTGCCTTCGAGAAG GTACACGCTAAGGGTAAGTTTACCGCCCGCGAGCGCATCTACGCCCTATT GGACGACGACTCATTCGTCGAACTCGACGCACTGGCCAGACACCGCAGCA CCAACTTCGGCCTCGGTGAAAACCGCCCGGTAGGCGATGGCGTGGTCACC GGCTACGGCACCATCGACGGCCGCGACGTATGCATCTTCAGCCAGGACGT CACGGTGTTCGGCGGCAGCCTGGGCGAAGTGTATGGCGAGAAGATCGTCA AGGTCCAGGAACTGGCGATCAAGACCGGCCGTCCGCTTATCGGCATCAAC GACGGCGCGGGCGCGCGTATCCAAGAAGGCGTCGTCTCGCTCGGCCTGTA CAGCCGGATTTTCCGCAACAATATCTTGGCCTCCGGCGTCATCCCGCAGA TCTCGCTGATCATGGGAGCGGCCGCCGGTGGACACGTGTATTCCCCAGCA CTGACCGACTTCGTGGTTATGGTCGACCAAACCAGCCAGATGTTCATCAC CGGACCCGACGTCATCAAGACCGTCACCGGCGAGGACGTCACCATGGAGG AGCTGGGTGGCGCCCATACCCACATGGCCAAGTCGGGTACCGCACACTAT GTAGCATCGGGCGAGCAAGACGCCTTCGATTGGGTGCGCGATGTGTTGAG CTACCTGCCGTCAAACAACTTCACCGACGCGCCGCGGTATTCTAAGCCCG TTCCTCACGGCTCCATTGAAGACAACCTGACCGCTAAAGACTTGGAGTTG GACACGCTTATCCCGGACTCGCCGAACCAACCGTACGACATGCACGAAGT GGTGACCCGCCTCCTCGACGAGGAAGAGTTCCTTGAGGTGCAAGCCGGTT ACGCCACCAACATCGTCGTCGGGCTCGGACGCATAGATGACCGACCGGTG GGCATCGTTGCCAACCAACCCATCCAGTTCGCCGGCTGTCTAGACATCAA CGCCTCGGAAAAGGCAGCCCGATTTGTGCGGGTCTGCGACTGCTTCAACA TCCCGATCGTGATGTTGGTGGATGTTCCAGGCTTCCTGCCTGGCACCGAG CAAGAATATGATGGCATCATCCGACGCGGCGCAAAGCTGCTCTTCGCCTA CGGCGAAGCCACCGTACCCAAGATCACCGTCATCACCCGCAAGGCCTACG GTGGCGCTTACTGCGTGATGGGCTCCAAAAATATGGGCTGCGACGTCAAC CTGGCTTGGCCGACCGCACAGATTGCGGTGATGGGTGCCTCCGGCGCAGT AGGCTTCGTGTACCGCAAGGAACTGGCCCAAGCGGCCAAGAACGGCGCCA ATGTTGATGAGCTACGCCTGCAGCTGCAGCAAGAGTACGAGGACACCCTG GTGAACCCGTACATCGCCGCCGAACGAGGTTACGTCGATGCGGTGATCCC GCCGTCACACACTCGCGGCTACATTGCCACGGCGCTTCACCTGTTGGAGC GCAAGATCGCACACCTTCCCCCCAAGAAGCACGGGAACATTCCGCTG >C2 ATGACAAGCGTTACCGACCACTCGGCTCATTCAATGGAACGCGCTGCCGA GCACACGATCAATATCCACACCACGGCAGGCAAGCTGGCCGAGCTGCATA AGCGGACCGAAGAAGCGCTGCATCCGGTCGGTGCAGCTGCCTTCGAGAAG GTACACGCTAAGGGTAAGTTTACCGCCCGCGAGCGCATCTACGCCCTATT GGACGACGACTCATTCGTCGAACTCGACGCACTGGCCAGACACCGCAGCA CCAACTTCGGCCTCGGTGAAAACCGCCCGGTAGGCGATGGCGTGGTCACC GGCTACGGCACCATCGACGGCCGCGACGTATGCATCTTCAGCCAGGACGT CACGGTGTTCGGCGGCAGCCTGGGCGAAGTGTATGGCGAGAAGATCGTCA AGGTCCAGGAACTGGCGATCAAGACCGGCCGTCCGCTTATCGGCATCAAC GACGGCGCGGGCGCGCGTATCCAAGAAGGCGTCGTCTCGCTCGGCCTGTA CAGCCGGATTTTCCGCAACAATATCTTGGCCTCCGGCGTCATCCCGCAGA TCTCGCTGATCATGGGAGCGGCCGCCGGTGGACACGTGTATTCCCCAGCA CTGACCGACTTCGTGGTTATGGTCGACCAAACCAGCCAGATGTTCATCAC CGGACCCGACGTCATCAAGACCGTCACCGGCGAGGACGTCACCATGGAGG AGCTGGGTGGCGCCCATACCCACATGGCCAAGTCGGGTACCGCACACTAT GTAGCATCGGGCGAGCAAGACGCCTTCGATTGGGTGCGCGATGTGTTGAG CTACCTGCCGTCAAACAACTTCACCGACGCGCCGCGGTATTCTAAGCCCG TTCCTCACGGCTCCATTGAAGACAACCTGACCGCTAAAGACTTGGAGTTG GACACGCTTATCCCGGACTCGCCGAACCAACCGTACGACATGCACGAAGT GGTGACCCGCCTCCTCGACGAGGAAGAGTTCCTTGAGGTGCAAGCCGGTT ACGCCACCAACATCGTCGTCGGGCTCGGACGCATAGATGACCGACCGGTG GGCATCGTTGCCAACCAACCCATCCAGTTCGCCGGCTGTCTAGACATCAA CGCCTCGGAAAAGGCAGCCCGATTTGTGCGGGTCTGCGACTGCTTCAACA TCCCGATCGTGATGTTGGTGGATGTTCCAGGCTTCCTGCCTGGCACCGAG CAAGAATATGATGGCATCATCCGACGCGGCGCAAAGCTGCTCTTCGCCTA CGGCGAAGCCACCGTACCCAAGATCACCGTCATCACCCGCAAGGCCTACG GTGGCGCTTACTGCGTGATGGGCTCCAAAAATATGGGCTGCGACGTCAAC CTGGCTTGGCCGACCGCACAGATTGCGGTGATGGGTGCCTCCGGCGCAGT AGGCTTCGTGTACCGCAAGGAACTGGCCCAAGCGGCCAAGAACGGCGCCA ATGTTGATGAGCTACGCCTGCAGCTGCAGCAAGAGTACGAGGACACCCTG GTGAACCCGTACATCGCCGCCGAACGAGGTTACGTCGATGCGGTGATCCC GCCGTCACACACTCGCGGCTACATTGCCACGGCGCTTCACCTGTTGGAGC GCAAGATCGCACACCTTCCCCCCAAGAAGCACGGGAACATTCCGCTG >C3 ATGACAAGCGTTACCGACCACTCGGCTCATTCAATGGAACGCGCTGCCGA GCACACGATCAATATCCACACCACGGCAGGCAAGCTGGCCGAGCTGCATA AGCGGACCGAAGAAGCGCTGCATCCGGTCGGTGCAGCTGCCTTCGAGAAG GTACACGCTAAGGGTAAGTTTACCGCCCGCGAGCGCATCTACGCCCTATT GGACGACGACTCATTCGTCGAACTCGACGCACTGGCCAGACACCGCAGCA CCAACTTCGGCCTCGGTGAAAACCGCCCGGTAGGCGATGGCGTGGTCACC GGCTACGGCACCATCGACGGCCGCGACGTATGCATCTTCAGCCAGGACGT CACGGTGTTCGGCGGCAGCCTGGGCGAAGTGTATGGCGAGAAGATCGTCA AGGTCCAGGAACTGGCGATCAAGACCGGCCGTCCGCTTATCGGCATCAAC GACGGCGCGGGCGCGCGTATCCAAGAAGGCGTCGTCTCGCTCGGCCTGTA CAGCCGGATTTTCCGCAACAATATCTTGGCCTCCGGCGTCATCCCGCAGA TCTCGCTGATCATGGGAGCGGCCGCCGGTGGACACGTGTATTCCCCAGCA CTGACCGACTTCGTGGTTATGGTCGACCAAACCAGCCAGATGTTCATCAC CGGACCCGACGTCATCAAGACCGTCACCGGCGAGGACGTCACCATGGAGG AGCTGGGTGGCGCCCATACCCACATGGCCAAGTCGGGTACCGCACACTAT GTAGCATCGGGCGAGCAAGACGCCTTCGATTGGGTGCGCGATGTGTTGAG CTACCTGCCGTCAAACAACTTCACCGACGCGCCGCGGTATTCTAAGCCCG TTCCTCACGGCTCCATTGAAGACAACCTGACCGCTAAAGACTTGGAGTTG GACACGCTTATCCCGGACTCGCCGAACCAACCGTACGACATGCACGAAGT GGTGACCCGCCTCCTCGACGAGGAAGAGTTCCTTGAGGTGCAAGCCGGTT ACGCCACCAACATCGTCGTCGGGCTCGGACGCATAGATGACCGACCGGTG GGCATCGTTGCCAACCAACCCATCCAGTTCGCCGGCTGTCTAGACATCAA CGCCTCGGAAAAGGCAGCCCGATTTGTGCGGGTCTGCGACTGCTTCAACA TCCCGATCGTGATGTTGGTGGATGTTCCAGGCTTCCTGCCTGGCACCGAG CAAGAATATGATGGCATCATCCGACGCGGCGCAAAGCTGCTCTTCGCCTA CGGCGAAGCCACCGTACCCAAGATCACCGTCATCACCCGCAAGGCCTACG GTGGCGCTTACTGCGTGATGGGCTCCAAAAATATGGGCTGCGACGTCAAC CTGGCTTGGCCGACCGCACAGATTGCGGTGATGGGTGCCTCCGGCGCAGT AGGCTTCGTGTACCGCAAGGAACTGGCCCAAGCGGCCAAGAACGGCGCCA ATGTTGATGAGCTACGCCTGCAGCTGCAGCAAGAGTACGAGGACACCCTG GTGAACCCGTACATCGCCGCCGAACGAGGTTACGTCGATGCGGTGATCCC GCCGTCACACACTCGCGGCTACATTGCCACGGCGCTTCACCTGTTGGAGC GCAAGATCGCACACCTTCCCCCCAAGAAGCACGGGAACATTCCGCTG >C4 ATGACAAGCGTTACCGACCACTCGGCTCATTCAATGGAACGCGCTGCCGA GCACACGATCAATATCCACACCACGGCAGGCAAGCTGGCCGAGCTGCATA AGCGGACCGAAGAAGCGCTGCATCCGGTCGGTGCAGCTGCCTTCGAGAAG GTACACGCTAAGGGTAAGTTTACCGCCCGCGAGCGCATCTACGCCCTATT GGACGACGACTCATTCGTCGAACTCGACGCACTGGCCAGACACCGCAGCA CCAACTTCGGCCTCGGTGAAAACCGCCCGGTAGGCGATGGCGTGGTCACC GGCTACGGCACCATCGACGGCCGCGACGTATGCATCTTCAGCCAGGACGT CACGGTGTTCGGCGGCAGCCTGGGCGAAGTGTATGGCGAGAAGATCGTCA AGGTCCAGGAACTGGCGATCAAGACCGGCCGTCCGCTTATCGGCATCAAC GACGGCGCGGGCGCGCGTATCCAAGAAGGCGTCGTCTCGCTCGGCCTGTA CAGCCGGATTTTCCGCAACAATATCTTGGCCTCCGGCGTCATCCCGCAGA TCTCGCTGATCATGGGAGCGGCCGCCGGTGGACACGTGTATTCCCCAGCA CTGACCGACTTCGTGGTTATGGTCGACCAAACCAGCCAGATGTTCATCAC CGGACCCGACGTCATCAAGACCGTCACCGGCGAGGACGTCACCATGGAGG AGCTGGGTGGCGCCCATACCCACATGGCCAAGTCGGGTACCGCACACTAT GTAGCATCGGGCGAGCAAGACGCCTTCGATTGGGTGCGCGATGTGTTGAG CTACCTGCCGTCAAACAACTTCACCGACGCGCCGCGGTATTCTAAGCCCG TTCCTCACGGCTCCATTGAAGACAACCTGACCGCTAAAGACTTGGAGTTG GACACGCTTATCCCGGACTCGCCGAACCAACCGTACGACATGCACGAAGT GGTGACCCGCCTCCTCGACGAGGAAGAGTTCCTTGAGGTGCAAGCCGGTT ACGCCACCAACATCGTCGTCGGGCTCGGACGCATAGATGACCGACCGGTG GGCATCGTTGCCAACCAACCCATCCAGTTCGCCGGCTGTCTAGACATCAA CGCCTCGGAAAAGGCAGCCCGATTTGTGCGGGTCTGCGACTGCTTCAACA TCCCGATCGTGATGTTGGTGGATGTTCCAGGCTTCCTGCCTGGCACCGAG CAAGAATATGATGGCATCATCCGACGCGGCGCAAAGCTGCTCTTCGCCTA CGGCGAAGCCACCGTACCCAAGATCACCGTCATCACCCGCAAGGCCTACG GTGGCGCTTACTGCGTGATGGGCTCCAAAAATATGGGCTGCGACGTCAAC CTGGCTTGGCCGACCGCACAGATTGCGGTGATGGGTGCCTCCGGCGCAGT AGGCTTCGTGTACCGCAAGGAACTGGCCCAAGCGGCCAAGAACGGCGCCA ATGTTGATGAGCTACGCCTGCAGCTGCAGCAAGAGTACGAGGACACCCTG GTGAACCCGTACATCGCCGCCGAACGAGGTTACGTCGATGCGGTGATCCC GCCGTCACACACTCGCGGCTACATTGCCACGGCGCTTCACCTGTTGGAGC GCAAGATCGCACACCTTCCCCCCAAGAAGCACGGGAACATTCCGCTG >C5 ATGACAAGCGTTACCGACCACTCGGCTCATTCAATGGAACGCGCTGCCGA GCACACGATCAATATCCACACCACGGCAGGCAAGCTGGCCGAGCTGCATA AGCGGACCGAAGAAGCGCTGCATCCGGTCGGTGCAGCTGCCTTCGAGAAG GTACACGCTAAGGGTAAGTTTACCGCCCGCGAGCGCATCTACGCCCTATT GGACGACGACTCATTCGTCGAACTCGACGCACTGGCCAGACACCGCAGCA CCAACTTCGGCCTCGGTGAAAACCGCCCGGTAGGCGATGGCGTGGTCACC GGCTACGGCACCATCGACGGCCGCGACGTATGCATCTTCAGCCAGGACGT CACGGTGTTCGGCGGCAGCCTGGGCGAAGTGTATGGCGAGAAGATCGTCA AGGTCCAGGAACTGGCGATCAAGACCGGCCGTCCGCTTATCGGCATCAAC GACGGCGCGGGCGCGCGTATCCAAGAAGGCGTCGTCTCGCTCGGCCTGTA CAGCCGGATTTTCCGCAACAATATCTTGGCCTCCGGCGTCATCCCGCAGA TCTCGCTGATCATGGGAGCGGCCGCCGGTGGACACGTGTATTCCCCAGCA CTGACCGACTTCGTGGTTATGGTCGACCAAACCAGCCAGATGTTCATCAC CGGACCCGACGTCATCAAGACCGTCACCGGCGAGGACGTCACCATGGAGG AGCTGGGTGGCGCCCATACCCACATGGCCAAGTCGGGTACCGCACACTAT GTAGCATCGGGCGAGCAAGACGCCTTCGATTGGGTGCGCGATGTGTTGAG CTACCTGCCGTCAAACAACTTCACCGACGCGCCGCGGTATTCTAAGCCCG TTCCTCACGGCTCCATTGAAGACAACCTGACCGCTAAAGACTTGGAGTTG GACACGCTTATCCCGGACTCGCCGAACCAACCGTACGACATGCACGAAGT GGTGACCCGCCTCCTCGACGAGGAAGAGTTCCTTGAGGTGCAAGCCGGTT ACGCCACCAACATCGTCGTCGGGCTCGGACGCATAGATGACCGACCGGTG GGCATCGTTGCCAACCAACCCATCCAGTTCGCCGGCTGTCTAGACATCAA CGCCTCGGAAAAGGCAGCCCGATTTGTGCGGGTCTGCGACTGCTTCAACA TCCCGATCGTGATGTTGGTGGATGTTCCAGGCTTCCTGCCTGGCACCGAG CAAGAATATGATGGCATCATCCGACGCGGCGCAAAGCTGCTCTTCGCCTA CGGCGAAGCCACCGTACCCAAGATCACCGTCATCACCCGCAAGGCCTACG GTGGCGCTTACTGCGTGATGGGCTCCAAAAATATGGGCTGCGACGTCAAC CTGGCTTGGCCGACCGCACAGATTGCGGTGATGGGTGCCTCCGGCGCAGT AGGCTTCGTGTACCGCAAGGAACTGGCCCAAGCGGCCAAGAACGGCGCCA ATGTTGATGAGCTACGCCTGCAGCTGCAGCAAGAGTACGAGGACACCCTG GTGAACCCGTACATCGCCGCCGAACGAGGTTACGTCGATGCGGTGATCCC GCCGTCACACACTCGCGGCTACATTGCCACGGCGCTTCACCTGTTGGAGC GCAAGATCGCACACCTTCCCCCCAAGAAGCACGGGAACATTCCGCTG >C6 ATGACAAGCGTTACCGACCACTCGGCTCATTCAATGGAACGCGCTGCCGA GCACACGATCAATATCCACACCACGGCAGGCAAGCTGGCCGAGCTGCATA AGCGGACCGAAGAAGCGCTGCATCCGGTCGGTGCAGCTGCCTTCGAGAAG GTACACGCTAAGGGTAAGTTTACCGCCCGCGAGCGCATCTACGCCCTATT GGACGACGACTCATTCGTCGAACTCGACGCACTGGCCAGACACCGCAGCA CCAACTTCGGCCTCGGTGAAAACCGCCCGGTAGGCGATGGCGTGGTCACC GGCTACGGCACCATCGACGGCCGCGACGTATGCATCTTCAGCCAGGACGT CACGGTGTTCGGCGGCAGCCTGGGCGAAGTGTATGGCGAGAAGATCGTCA AGGTCCAGGAACTGGCGATCAAGACCGGCCGTCCGCTTATCGGCATCAAC GACGGCGCGGGCGCGCGTATCCAAGAAGGCGTCGTCTCGCTCGGCCTGTA CAGCCGGATTTTCCGCAACAATATCTTGGCCTCCGGCGTCATCCCGCAGA TCTCGCTGATCATGGGAGCGGCCGCCGGTGGACACGTGTATTCCCCAGCA CTGACCGACTTCGTGGTTATGGTCGACCAAACCAGCCAGATGTTCATCAC CGGACCCGACGTCATCAAGACCGTCACCGGCGAGGACGTCACCATGGAGG AGCTGGGTGGCGCCCATACCCACATGGCCAAGTCGGGTACCGCACACTAT GTAGCATCGGGCGAGCAAGACGCCTTCGATTGGGTGCGCGATGTGTTGAG CTACCTGCCGTCAAACAACTTCACCGACGCGCCGCGGTATTCTAAGCCCG TTCCTCACGGCTCCATTGAAGACAACCTGACCGCTAAAGACTTGGAGTTG GACACGCTTATCCCGGACTCGCCGAACCAACCGTACGACATGCACGAAGT GGTGACCCGCCTCCTCGACGAGGAAGAGTTCCTTGAGGTGCAAGCCGGTT ACGCCACCAACATCGTCGTCGGGCTCGGACGCATAGATGACCGACCGGTG GGCATCGTTGCCAACCAACCCATCCAGTTCGCCGGCTGTCTAGACATCAA CGCCTCGGAAAAGGCAGCCCGATTTGTGCGGGTCTGCGACTGCTTCAACA TCCCGATCGTGATGTTGGTGGATGTTCCAGGCTTCCTGCCTGGCACCGAG CAAGAATATGATGGCATCATCCGACGCGGCGCAAAGCTGCTCTTCGCCTA CGGCGAAGCCACCGTACCCAAGATCACCGTCATCACCCGCAAGGCCTACG GTGGCGCTTACTGCGTGATGGGCTCCAAAAATATGGGCTGCGACGTCAAC CTGGCTTGGCCGACCGCACAGATTGCGGTGATGGGTGCCTCCGGCGCAGT AGGCTTCGTGTACCGCAAGGAACTGGCCCAAGCGGCCAAGAACGGCGCCA ATGTTGATGAGCTACGCCTGCAGCTGCAGCAAGAGTACGAGGACACCCTG GTGAACCCGTACATCGCCGCCGAACGAGGTTACGTCGATGCGGTGATCCC GCCGTCACACACTCGCGGCTACATTGCCACGGCGCTTCACCTGTTGGAGC GCAAGATCGCACACCTTCCCCCCAAGAAGCACGGGAACATTCCGCTG >C1 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL >C2 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL >C3 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL >C4 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL >C5 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL >C6 MTSVTDHSAHSMERAAEHTINIHTTAGKLAELHKRTEEALHPVGAAAFEK VHAKGKFTARERIYALLDDDSFVELDALARHRSTNFGLGENRPVGDGVVT GYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA LTDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHY VASGEQDAFDWVRDVLSYLPSNNFTDAPRYSKPVPHGSIEDNLTAKDLEL DTLIPDSPNQPYDMHEVVTRLLDEEEFLEVQAGYATNIVVGLGRIDDRPV GIVANQPIQFAGCLDINASEKAARFVRVCDCFNIPIVMLVDVPGFLPGTE QEYDGIIRRGAKLLFAYGEATVPKITVITRKAYGGAYCVMGSKNMGCDVN LAWPTAQIAVMGASGAVGFVYRKELAQAAKNGANVDELRLQLQQEYEDTL VNPYIAAERGYVDAVIPPSHTRGYIATALHLLERKIAHLPPKKHGNIPL MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/1res/accD5/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1647 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579770553 Setting output file names to "/data/1res/accD5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1734207596 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 8365283161 Seed = 92223219 Swapseed = 1579770553 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3686.064969 -- -24.965149 Chain 2 -- -3686.064969 -- -24.965149 Chain 3 -- -3686.064406 -- -24.965149 Chain 4 -- -3686.064969 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3686.064758 -- -24.965149 Chain 2 -- -3686.064758 -- -24.965149 Chain 3 -- -3686.064969 -- -24.965149 Chain 4 -- -3686.064758 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3686.065] (-3686.065) (-3686.064) (-3686.065) * [-3686.065] (-3686.065) (-3686.065) (-3686.065) 500 -- (-2276.879) [-2271.172] (-2294.949) (-2285.408) * (-2266.674) [-2258.076] (-2263.953) (-2261.493) -- 0:00:00 1000 -- (-2252.261) [-2252.011] (-2269.865) (-2251.450) * (-2255.095) (-2252.954) (-2260.508) [-2251.265] -- 0:00:00 1500 -- (-2258.429) (-2249.143) (-2264.897) [-2248.854] * (-2251.077) (-2262.725) (-2252.825) [-2250.236] -- 0:00:00 2000 -- (-2254.137) (-2252.926) [-2250.726] (-2253.094) * (-2254.206) (-2250.587) [-2249.702] (-2254.078) -- 0:00:00 2500 -- [-2254.385] (-2254.533) (-2247.866) (-2251.997) * (-2252.176) [-2250.940] (-2255.407) (-2247.446) -- 0:00:00 3000 -- (-2247.998) [-2253.172] (-2252.445) (-2251.923) * (-2256.278) (-2253.955) (-2254.405) [-2251.098] -- 0:00:00 3500 -- (-2252.292) (-2255.442) [-2248.873] (-2252.895) * (-2249.848) (-2250.767) (-2251.075) [-2250.399] -- 0:00:00 4000 -- (-2264.807) (-2251.068) [-2250.148] (-2253.783) * [-2248.022] (-2252.476) (-2258.215) (-2252.739) -- 0:00:00 4500 -- [-2253.730] (-2255.484) (-2260.424) (-2249.790) * (-2249.095) [-2251.500] (-2255.156) (-2250.923) -- 0:00:00 5000 -- (-2250.911) [-2249.796] (-2247.678) (-2253.693) * (-2250.932) [-2251.602] (-2252.875) (-2251.182) -- 0:00:00 Average standard deviation of split frequencies: 0.075151 5500 -- (-2251.233) (-2264.830) [-2251.243] (-2250.418) * (-2252.804) [-2248.143] (-2253.635) (-2256.852) -- 0:00:00 6000 -- (-2251.215) [-2256.545] (-2256.301) (-2255.623) * (-2254.131) (-2256.051) (-2249.023) [-2250.900] -- 0:00:00 6500 -- [-2256.771] (-2260.169) (-2250.253) (-2251.352) * (-2262.920) (-2255.073) [-2249.594] (-2252.453) -- 0:00:00 7000 -- [-2259.370] (-2267.860) (-2254.605) (-2252.043) * (-2251.602) (-2256.598) [-2249.089] (-2250.816) -- 0:00:00 7500 -- (-2255.564) (-2252.481) (-2255.906) [-2252.016] * (-2260.322) [-2254.366] (-2261.903) (-2254.897) -- 0:00:00 8000 -- (-2249.711) [-2251.396] (-2250.911) (-2253.998) * (-2257.981) (-2249.906) [-2251.376] (-2251.227) -- 0:00:00 8500 -- [-2251.282] (-2255.559) (-2249.424) (-2256.543) * (-2252.605) (-2254.373) [-2250.070] (-2257.077) -- 0:00:00 9000 -- [-2250.320] (-2257.327) (-2259.342) (-2251.629) * (-2258.290) [-2250.906] (-2251.065) (-2255.592) -- 0:00:00 9500 -- (-2253.153) [-2254.808] (-2253.592) (-2249.593) * [-2252.745] (-2251.857) (-2254.419) (-2252.608) -- 0:00:00 10000 -- (-2250.026) [-2251.541] (-2256.083) (-2257.451) * (-2252.417) (-2247.830) (-2262.847) [-2255.519] -- 0:01:39 Average standard deviation of split frequencies: 0.083969 10500 -- [-2248.477] (-2252.127) (-2253.294) (-2253.972) * (-2253.433) (-2257.204) [-2251.051] (-2254.026) -- 0:01:34 11000 -- [-2250.765] (-2251.915) (-2251.842) (-2255.260) * (-2252.096) [-2255.634] (-2253.143) (-2260.823) -- 0:01:29 11500 -- (-2260.391) (-2258.311) (-2250.691) [-2254.319] * (-2250.619) (-2252.387) (-2260.083) [-2254.824] -- 0:01:25 12000 -- (-2256.263) (-2253.538) (-2257.693) [-2242.931] * (-2259.249) [-2255.378] (-2254.349) (-2256.893) -- 0:01:22 12500 -- (-2251.046) [-2249.857] (-2266.328) (-2243.058) * (-2254.019) (-2249.888) [-2248.660] (-2249.372) -- 0:01:19 13000 -- (-2257.647) (-2257.043) [-2253.901] (-2245.086) * (-2259.778) [-2253.740] (-2261.254) (-2251.600) -- 0:01:15 13500 -- (-2259.364) (-2252.161) (-2257.507) [-2242.076] * (-2253.172) (-2258.948) [-2254.187] (-2247.794) -- 0:01:13 14000 -- [-2251.599] (-2250.565) (-2261.312) (-2241.911) * [-2257.963] (-2249.248) (-2247.584) (-2255.045) -- 0:01:10 14500 -- [-2251.116] (-2253.003) (-2252.871) (-2242.227) * (-2252.983) [-2249.606] (-2257.894) (-2253.068) -- 0:01:07 15000 -- (-2248.312) [-2247.300] (-2258.456) (-2242.770) * [-2249.917] (-2251.648) (-2253.959) (-2256.275) -- 0:01:05 Average standard deviation of split frequencies: 0.076335 15500 -- (-2259.779) (-2260.877) (-2256.032) [-2244.129] * [-2251.731] (-2254.479) (-2258.418) (-2253.691) -- 0:01:03 16000 -- (-2258.923) [-2252.428] (-2248.377) (-2243.828) * [-2250.347] (-2255.406) (-2259.561) (-2251.863) -- 0:01:01 16500 -- (-2253.376) [-2248.113] (-2249.242) (-2243.849) * [-2250.025] (-2256.031) (-2254.087) (-2251.136) -- 0:00:59 17000 -- (-2253.415) [-2249.627] (-2252.694) (-2244.237) * [-2252.220] (-2248.266) (-2251.924) (-2250.622) -- 0:00:57 17500 -- (-2266.927) (-2254.739) (-2254.548) [-2243.387] * (-2248.641) (-2253.302) (-2250.698) [-2255.769] -- 0:00:56 18000 -- (-2252.988) [-2252.461] (-2261.274) (-2243.679) * [-2251.266] (-2251.421) (-2262.769) (-2260.819) -- 0:00:54 18500 -- (-2254.151) (-2254.756) (-2255.946) [-2243.613] * (-2249.753) (-2258.991) [-2246.207] (-2255.017) -- 0:00:53 19000 -- [-2252.683] (-2260.876) (-2262.346) (-2243.282) * [-2254.678] (-2253.238) (-2246.888) (-2250.475) -- 0:00:51 19500 -- (-2251.199) [-2250.330] (-2249.774) (-2243.361) * (-2253.657) [-2247.410] (-2246.548) (-2251.263) -- 0:00:50 20000 -- (-2257.131) [-2254.028] (-2253.122) (-2247.521) * (-2252.940) [-2253.756] (-2244.849) (-2254.015) -- 0:00:49 Average standard deviation of split frequencies: 0.054744 20500 -- [-2255.874] (-2252.509) (-2252.752) (-2242.914) * [-2253.640] (-2248.563) (-2244.870) (-2252.732) -- 0:00:47 21000 -- [-2253.205] (-2258.443) (-2253.454) (-2242.892) * [-2254.875] (-2253.083) (-2245.258) (-2262.674) -- 0:00:46 21500 -- (-2254.340) [-2256.959] (-2262.335) (-2242.597) * (-2257.627) (-2253.911) [-2245.402] (-2259.976) -- 0:00:45 22000 -- (-2246.555) [-2253.978] (-2253.650) (-2241.928) * (-2255.880) [-2252.610] (-2245.628) (-2263.396) -- 0:00:44 22500 -- (-2254.113) (-2254.185) (-2250.923) [-2242.523] * (-2257.068) (-2255.727) [-2244.977] (-2255.000) -- 0:00:43 23000 -- (-2261.752) (-2254.783) (-2250.135) [-2243.995] * (-2257.566) [-2252.768] (-2245.022) (-2250.138) -- 0:00:42 23500 -- (-2251.870) (-2255.479) [-2248.768] (-2244.411) * (-2254.362) (-2253.738) (-2245.499) [-2253.703] -- 0:00:41 24000 -- (-2248.319) [-2256.261] (-2251.943) (-2243.784) * (-2255.410) (-2252.532) (-2243.281) [-2253.129] -- 0:00:40 24500 -- [-2254.095] (-2261.516) (-2246.012) (-2249.754) * (-2253.930) [-2245.630] (-2245.889) (-2256.518) -- 0:01:19 25000 -- [-2254.202] (-2249.521) (-2243.959) (-2244.806) * (-2251.412) [-2252.806] (-2242.395) (-2243.111) -- 0:01:18 Average standard deviation of split frequencies: 0.037910 25500 -- (-2251.446) [-2251.876] (-2244.153) (-2243.241) * (-2254.148) (-2253.299) (-2245.065) [-2242.035] -- 0:01:16 26000 -- (-2249.832) (-2258.479) [-2244.472] (-2243.241) * (-2244.547) (-2252.922) [-2241.876] (-2242.964) -- 0:01:14 26500 -- (-2256.325) [-2248.498] (-2242.710) (-2244.304) * (-2242.759) (-2261.910) [-2242.105] (-2242.636) -- 0:01:13 27000 -- (-2252.802) [-2251.456] (-2243.793) (-2241.795) * (-2243.128) (-2253.699) [-2241.998] (-2241.681) -- 0:01:12 27500 -- (-2256.324) (-2251.612) [-2243.061] (-2242.453) * [-2242.856] (-2251.508) (-2244.452) (-2241.723) -- 0:01:10 28000 -- (-2252.649) (-2265.038) (-2242.962) [-2242.948] * (-2242.857) (-2255.342) [-2242.088] (-2244.601) -- 0:01:09 28500 -- (-2258.338) [-2253.365] (-2244.093) (-2243.895) * (-2242.011) [-2252.163] (-2242.368) (-2252.348) -- 0:01:08 29000 -- (-2251.037) (-2254.937) (-2243.105) [-2243.981] * (-2242.059) [-2252.761] (-2242.133) (-2254.385) -- 0:01:06 29500 -- (-2248.652) (-2252.854) (-2243.233) [-2244.039] * [-2242.579] (-2250.357) (-2243.635) (-2248.377) -- 0:01:05 30000 -- (-2256.174) (-2250.899) [-2244.376] (-2243.567) * (-2243.076) (-2252.614) (-2244.189) [-2244.849] -- 0:01:04 Average standard deviation of split frequencies: 0.040526 30500 -- (-2250.977) (-2256.160) [-2244.427] (-2244.976) * (-2243.420) (-2244.759) [-2242.104] (-2248.262) -- 0:01:03 31000 -- (-2250.687) (-2249.144) (-2246.398) [-2242.985] * (-2242.329) (-2254.672) [-2242.109] (-2246.848) -- 0:01:02 31500 -- (-2251.955) (-2253.934) [-2243.587] (-2244.565) * (-2242.333) (-2249.157) [-2241.696] (-2247.167) -- 0:01:01 32000 -- (-2259.151) (-2248.620) (-2245.109) [-2243.540] * (-2244.135) (-2248.022) (-2243.236) [-2245.108] -- 0:01:00 32500 -- (-2255.681) (-2255.376) [-2243.069] (-2242.694) * (-2244.123) [-2255.079] (-2243.319) (-2244.668) -- 0:00:59 33000 -- (-2257.069) (-2253.822) [-2242.252] (-2242.788) * (-2242.472) (-2254.623) (-2241.890) [-2243.984] -- 0:00:58 33500 -- (-2248.320) [-2253.016] (-2244.147) (-2245.197) * (-2242.478) (-2252.571) [-2241.944] (-2246.285) -- 0:00:57 34000 -- [-2241.980] (-2250.362) (-2246.675) (-2243.305) * (-2242.391) [-2252.960] (-2241.827) (-2247.927) -- 0:00:56 34500 -- (-2245.755) [-2253.998] (-2244.609) (-2243.254) * (-2242.099) (-2253.056) [-2242.935] (-2243.791) -- 0:00:55 35000 -- (-2242.977) [-2252.759] (-2243.493) (-2242.447) * [-2242.208] (-2264.019) (-2243.301) (-2248.090) -- 0:00:55 Average standard deviation of split frequencies: 0.034919 35500 -- [-2243.626] (-2250.442) (-2243.882) (-2243.060) * (-2243.684) (-2249.785) [-2242.052] (-2243.431) -- 0:00:54 36000 -- (-2244.383) [-2248.659] (-2243.279) (-2244.419) * [-2243.303] (-2248.262) (-2242.285) (-2243.381) -- 0:00:53 36500 -- (-2244.859) (-2247.475) (-2242.818) [-2243.082] * (-2243.279) [-2254.224] (-2241.571) (-2242.753) -- 0:00:52 37000 -- (-2245.025) [-2249.015] (-2242.935) (-2243.569) * (-2245.905) (-2255.449) (-2242.307) [-2242.116] -- 0:00:52 37500 -- (-2248.000) (-2252.299) [-2242.890] (-2245.167) * [-2246.637] (-2256.753) (-2243.827) (-2242.395) -- 0:00:51 38000 -- (-2246.842) [-2247.663] (-2242.771) (-2244.836) * (-2246.934) (-2252.549) (-2245.195) [-2243.696] -- 0:00:50 38500 -- (-2245.855) (-2253.656) (-2242.540) [-2243.526] * (-2243.393) (-2252.726) [-2244.056] (-2243.806) -- 0:00:49 39000 -- (-2244.919) [-2248.953] (-2242.106) (-2244.706) * (-2245.761) [-2248.681] (-2246.530) (-2244.660) -- 0:01:13 39500 -- (-2243.574) [-2253.287] (-2244.940) (-2243.363) * [-2242.688] (-2258.248) (-2245.694) (-2243.229) -- 0:01:12 40000 -- (-2245.186) [-2259.671] (-2245.059) (-2243.289) * (-2244.779) (-2255.618) (-2244.127) [-2243.944] -- 0:01:12 Average standard deviation of split frequencies: 0.030719 40500 -- (-2247.515) (-2260.839) (-2243.984) [-2242.794] * (-2245.387) (-2253.524) (-2242.429) [-2244.002] -- 0:01:11 41000 -- (-2244.786) (-2252.844) [-2243.901] (-2245.310) * (-2242.980) [-2249.440] (-2242.292) (-2245.964) -- 0:01:10 41500 -- (-2243.395) (-2252.044) (-2244.983) [-2245.178] * (-2243.025) (-2248.419) (-2245.536) [-2244.481] -- 0:01:09 42000 -- (-2243.324) (-2254.600) [-2245.005] (-2244.653) * (-2244.154) (-2252.373) [-2245.572] (-2245.637) -- 0:01:08 42500 -- (-2245.141) (-2254.552) [-2243.637] (-2244.120) * (-2242.955) [-2254.801] (-2245.500) (-2242.596) -- 0:01:07 43000 -- (-2242.545) (-2256.676) [-2244.227] (-2246.228) * (-2244.628) (-2254.876) (-2251.219) [-2241.613] -- 0:01:06 43500 -- (-2242.364) [-2248.947] (-2246.778) (-2244.405) * (-2242.965) [-2249.019] (-2244.755) (-2242.908) -- 0:01:05 44000 -- [-2243.080] (-2249.340) (-2250.201) (-2246.810) * (-2244.140) (-2255.948) [-2243.124] (-2241.895) -- 0:01:05 44500 -- (-2243.927) [-2248.100] (-2245.187) (-2243.182) * (-2245.418) [-2251.477] (-2242.947) (-2243.845) -- 0:01:04 45000 -- [-2242.755] (-2254.650) (-2242.899) (-2244.285) * [-2242.170] (-2253.251) (-2242.838) (-2243.845) -- 0:01:03 Average standard deviation of split frequencies: 0.021893 45500 -- (-2244.468) (-2253.013) [-2244.648] (-2242.662) * [-2242.670] (-2253.187) (-2243.600) (-2244.089) -- 0:01:02 46000 -- (-2244.181) (-2257.001) [-2245.124] (-2244.097) * [-2243.515] (-2255.697) (-2242.930) (-2244.889) -- 0:01:02 46500 -- (-2244.097) (-2252.985) [-2245.173] (-2247.300) * (-2246.107) (-2250.958) (-2244.366) [-2246.980] -- 0:01:01 47000 -- [-2243.188] (-2252.685) (-2242.034) (-2247.671) * (-2244.288) [-2248.301] (-2242.719) (-2243.905) -- 0:01:00 47500 -- (-2241.579) [-2251.661] (-2242.327) (-2244.870) * (-2242.680) (-2262.772) [-2242.081] (-2242.851) -- 0:01:00 48000 -- (-2244.093) (-2256.744) [-2244.589] (-2251.011) * (-2242.788) (-2250.165) (-2244.170) [-2243.570] -- 0:00:59 48500 -- (-2244.673) (-2251.064) (-2241.761) [-2250.761] * (-2242.474) (-2252.102) (-2243.015) [-2243.653] -- 0:00:58 49000 -- [-2246.063] (-2252.153) (-2241.793) (-2244.442) * (-2245.622) (-2250.904) [-2242.366] (-2242.945) -- 0:00:58 49500 -- (-2250.767) (-2272.443) (-2242.225) [-2243.642] * (-2242.360) [-2248.671] (-2242.356) (-2243.231) -- 0:00:57 50000 -- (-2245.273) (-2252.630) (-2244.524) [-2243.910] * (-2246.749) (-2251.424) (-2242.300) [-2243.365] -- 0:00:57 Average standard deviation of split frequencies: 0.026051 50500 -- (-2242.936) (-2245.428) (-2242.542) [-2249.779] * (-2245.406) (-2257.991) [-2243.826] (-2242.320) -- 0:00:56 51000 -- (-2244.604) (-2245.530) (-2241.975) [-2245.949] * [-2242.207] (-2251.775) (-2244.191) (-2242.211) -- 0:00:55 51500 -- (-2243.233) (-2245.744) (-2245.280) [-2247.053] * (-2242.172) (-2251.540) (-2244.875) [-2242.124] -- 0:00:55 52000 -- (-2242.043) (-2246.354) [-2244.135] (-2244.511) * (-2242.214) (-2250.529) (-2243.972) [-2242.796] -- 0:00:54 52500 -- [-2242.406] (-2244.485) (-2245.975) (-2241.699) * (-2243.454) [-2245.207] (-2246.189) (-2243.077) -- 0:00:54 53000 -- (-2243.141) (-2244.700) (-2247.926) [-2241.848] * (-2241.962) (-2250.244) (-2247.123) [-2243.747] -- 0:00:53 53500 -- (-2243.522) (-2249.544) [-2242.686] (-2244.476) * (-2243.473) (-2244.925) (-2246.989) [-2243.484] -- 0:01:10 54000 -- (-2243.541) (-2243.788) [-2243.638] (-2241.759) * (-2244.683) (-2245.043) (-2245.351) [-2243.341] -- 0:01:10 54500 -- (-2242.272) [-2243.781] (-2243.233) (-2243.588) * (-2243.569) (-2245.186) [-2245.786] (-2243.977) -- 0:01:09 55000 -- [-2243.496] (-2244.171) (-2243.414) (-2243.621) * [-2243.575] (-2244.836) (-2248.045) (-2243.998) -- 0:01:08 Average standard deviation of split frequencies: 0.023039 55500 -- (-2243.709) (-2245.170) [-2243.067] (-2243.903) * (-2244.278) [-2243.359] (-2245.283) (-2243.715) -- 0:01:08 56000 -- (-2243.377) [-2246.715] (-2243.281) (-2245.255) * (-2245.796) (-2251.092) (-2245.658) [-2242.544] -- 0:01:07 56500 -- [-2243.320] (-2245.616) (-2243.797) (-2244.305) * (-2247.804) [-2243.985] (-2245.162) (-2241.478) -- 0:01:06 57000 -- (-2242.911) (-2245.243) [-2242.773] (-2241.909) * (-2242.673) (-2244.593) (-2247.317) [-2242.004] -- 0:01:06 57500 -- [-2243.164] (-2246.838) (-2243.661) (-2242.489) * [-2242.708] (-2243.909) (-2246.442) (-2243.616) -- 0:01:05 58000 -- (-2243.277) [-2243.456] (-2243.639) (-2242.492) * (-2242.958) [-2243.498] (-2244.885) (-2248.311) -- 0:01:04 58500 -- (-2244.322) [-2244.782] (-2243.027) (-2242.152) * [-2242.958] (-2244.007) (-2245.622) (-2244.896) -- 0:01:04 59000 -- (-2243.243) (-2242.512) [-2244.051] (-2242.186) * (-2243.028) (-2243.491) [-2244.864] (-2244.838) -- 0:01:03 59500 -- (-2242.801) (-2245.851) (-2244.786) [-2244.169] * (-2244.107) (-2243.620) (-2245.118) [-2242.046] -- 0:01:03 60000 -- (-2243.720) (-2242.426) (-2245.644) [-2244.910] * (-2243.266) (-2243.692) [-2245.157] (-2245.681) -- 0:01:02 Average standard deviation of split frequencies: 0.017699 60500 -- (-2242.932) (-2242.465) (-2247.269) [-2242.974] * (-2242.595) [-2242.180] (-2245.180) (-2243.715) -- 0:01:02 61000 -- (-2244.270) (-2242.279) [-2243.508] (-2243.337) * [-2242.476] (-2242.152) (-2243.882) (-2243.955) -- 0:01:01 61500 -- (-2245.516) [-2242.298] (-2243.586) (-2244.099) * (-2243.445) [-2242.152] (-2243.903) (-2243.761) -- 0:01:01 62000 -- (-2247.205) [-2242.044] (-2243.043) (-2244.099) * (-2243.445) (-2242.170) (-2247.038) [-2244.772] -- 0:01:00 62500 -- (-2245.722) (-2243.059) (-2243.048) [-2242.813] * (-2244.543) [-2243.108] (-2242.525) (-2243.693) -- 0:01:00 63000 -- (-2245.636) (-2243.133) (-2243.680) [-2243.017] * (-2245.095) (-2244.111) [-2242.447] (-2241.965) -- 0:00:59 63500 -- (-2247.493) (-2243.326) (-2244.066) [-2243.450] * (-2242.821) (-2243.259) [-2242.480] (-2243.952) -- 0:00:58 64000 -- (-2249.278) (-2243.813) [-2244.927] (-2242.485) * (-2243.396) [-2243.063] (-2244.190) (-2244.265) -- 0:00:58 64500 -- (-2246.858) (-2244.091) (-2244.947) [-2243.335] * (-2243.396) (-2243.055) [-2244.285] (-2245.452) -- 0:00:58 65000 -- [-2244.223] (-2243.946) (-2244.605) (-2243.335) * (-2244.323) [-2243.792] (-2244.941) (-2246.178) -- 0:00:57 Average standard deviation of split frequencies: 0.021070 65500 -- (-2246.244) [-2242.609] (-2244.790) (-2244.139) * (-2243.731) (-2244.316) [-2242.425] (-2245.097) -- 0:00:57 66000 -- (-2248.888) (-2242.098) (-2242.581) [-2244.722] * (-2243.137) (-2244.490) (-2242.609) [-2243.320] -- 0:00:56 66500 -- (-2249.015) [-2243.691] (-2242.883) (-2243.483) * (-2242.966) [-2243.477] (-2242.060) (-2243.912) -- 0:00:56 67000 -- (-2246.649) (-2243.073) (-2243.142) [-2245.171] * (-2245.253) (-2245.141) (-2243.003) [-2242.866] -- 0:00:55 67500 -- [-2244.494] (-2244.340) (-2241.787) (-2242.494) * (-2244.245) (-2244.160) (-2242.788) [-2242.115] -- 0:00:55 68000 -- (-2246.083) (-2243.910) (-2243.615) [-2245.426] * (-2246.289) (-2241.995) [-2244.881] (-2243.505) -- 0:01:08 68500 -- (-2245.031) [-2243.634] (-2243.235) (-2245.677) * [-2243.322] (-2241.996) (-2244.820) (-2246.961) -- 0:01:07 69000 -- (-2244.118) (-2244.312) [-2243.509] (-2244.305) * (-2242.904) [-2241.941] (-2244.766) (-2244.918) -- 0:01:07 69500 -- (-2246.500) (-2247.146) [-2243.957] (-2242.474) * (-2244.586) (-2244.702) (-2244.542) [-2242.993] -- 0:01:06 70000 -- (-2246.644) (-2246.307) [-2243.799] (-2244.507) * (-2246.292) [-2242.706] (-2242.959) (-2244.717) -- 0:01:06 Average standard deviation of split frequencies: 0.022871 70500 -- (-2243.929) (-2245.847) [-2243.445] (-2242.327) * (-2248.423) (-2244.389) [-2242.874] (-2242.834) -- 0:01:05 71000 -- (-2244.379) (-2246.235) [-2246.669] (-2244.587) * (-2247.769) (-2245.192) (-2242.843) [-2244.727] -- 0:01:05 71500 -- (-2243.437) (-2244.960) [-2244.319] (-2243.991) * (-2247.744) (-2244.800) (-2241.688) [-2242.607] -- 0:01:04 72000 -- (-2243.679) (-2245.566) (-2244.399) [-2248.444] * (-2243.337) (-2247.656) [-2243.356] (-2247.040) -- 0:01:04 72500 -- [-2243.714] (-2245.970) (-2243.182) (-2243.231) * (-2243.893) (-2248.030) [-2242.937] (-2247.101) -- 0:01:03 73000 -- [-2242.816] (-2244.289) (-2246.624) (-2245.590) * (-2243.219) (-2244.005) (-2244.953) [-2244.304] -- 0:01:03 73500 -- (-2244.571) [-2243.428] (-2242.566) (-2245.680) * (-2242.520) (-2244.394) [-2242.178] (-2243.560) -- 0:01:03 74000 -- (-2244.335) (-2242.421) (-2242.115) [-2243.430] * (-2249.248) (-2243.961) [-2243.135] (-2242.835) -- 0:01:02 74500 -- (-2244.147) (-2244.268) (-2241.984) [-2243.465] * (-2244.686) (-2245.535) (-2243.653) [-2242.840] -- 0:01:02 75000 -- (-2243.931) (-2242.996) [-2243.411] (-2242.100) * (-2242.441) (-2245.049) (-2244.395) [-2242.347] -- 0:01:01 Average standard deviation of split frequencies: 0.022054 75500 -- (-2243.643) [-2243.328] (-2241.794) (-2244.632) * (-2243.845) (-2242.472) (-2244.435) [-2242.347] -- 0:01:01 76000 -- (-2243.672) [-2242.196] (-2241.609) (-2244.969) * (-2243.827) (-2242.066) [-2243.822] (-2242.286) -- 0:01:00 76500 -- (-2243.714) [-2243.765] (-2243.865) (-2243.514) * [-2243.075] (-2247.494) (-2243.031) (-2242.441) -- 0:01:00 77000 -- (-2243.714) [-2242.050] (-2241.739) (-2243.517) * (-2245.584) [-2241.890] (-2243.789) (-2242.441) -- 0:00:59 77500 -- (-2244.926) (-2242.060) [-2245.242] (-2245.012) * (-2243.967) (-2243.446) (-2243.415) [-2242.493] -- 0:00:59 78000 -- [-2246.426] (-2247.726) (-2246.526) (-2243.927) * (-2242.467) [-2244.529] (-2246.343) (-2242.493) -- 0:00:59 78500 -- (-2244.511) (-2245.476) (-2247.594) [-2243.709] * (-2241.807) (-2241.725) (-2247.455) [-2242.576] -- 0:00:58 79000 -- [-2244.431] (-2246.980) (-2244.891) (-2242.939) * (-2241.807) [-2241.640] (-2247.931) (-2242.699) -- 0:00:58 79500 -- (-2243.507) (-2246.561) (-2244.461) [-2245.763] * (-2241.791) [-2243.389] (-2243.249) (-2244.021) -- 0:00:57 80000 -- [-2243.469] (-2245.956) (-2244.548) (-2247.434) * (-2241.801) [-2241.682] (-2243.811) (-2243.369) -- 0:00:57 Average standard deviation of split frequencies: 0.024750 80500 -- (-2244.763) (-2246.033) (-2246.172) [-2247.403] * (-2241.790) [-2243.557] (-2246.367) (-2242.952) -- 0:00:57 81000 -- (-2245.185) [-2245.519] (-2248.086) (-2247.418) * (-2241.789) (-2244.213) [-2247.602] (-2243.547) -- 0:00:56 81500 -- [-2244.131] (-2243.328) (-2243.061) (-2243.279) * (-2243.174) (-2242.576) [-2244.413] (-2245.140) -- 0:00:56 82000 -- (-2243.991) (-2249.866) (-2244.473) [-2242.998] * [-2241.541] (-2244.459) (-2244.963) (-2244.650) -- 0:00:55 82500 -- (-2244.480) (-2247.239) (-2243.914) [-2244.325] * (-2241.870) (-2241.685) [-2247.238] (-2243.912) -- 0:01:06 83000 -- (-2246.115) [-2247.137] (-2248.287) (-2244.302) * (-2241.956) [-2241.669] (-2248.989) (-2247.251) -- 0:01:06 83500 -- [-2244.182] (-2246.474) (-2249.402) (-2243.930) * (-2241.929) [-2241.464] (-2247.874) (-2243.388) -- 0:01:05 84000 -- (-2245.915) (-2243.792) (-2247.445) [-2244.360] * (-2245.764) (-2241.419) [-2242.106] (-2242.906) -- 0:01:05 84500 -- (-2246.119) [-2242.386] (-2244.522) (-2244.056) * (-2244.157) (-2242.249) [-2242.780] (-2243.130) -- 0:01:05 85000 -- (-2246.074) (-2242.121) [-2244.255] (-2245.470) * (-2245.973) [-2242.048] (-2244.192) (-2252.328) -- 0:01:04 Average standard deviation of split frequencies: 0.027407 85500 -- (-2245.911) [-2243.447] (-2243.545) (-2246.666) * (-2246.022) [-2242.515] (-2246.069) (-2251.844) -- 0:01:04 86000 -- [-2244.903] (-2242.990) (-2242.296) (-2244.326) * (-2244.458) [-2241.955] (-2245.621) (-2246.876) -- 0:01:03 86500 -- (-2244.440) (-2245.351) (-2242.700) [-2242.971] * [-2246.407] (-2245.289) (-2247.218) (-2248.551) -- 0:01:03 87000 -- (-2242.004) [-2242.150] (-2246.713) (-2243.119) * (-2244.118) (-2242.894) (-2248.015) [-2245.992] -- 0:01:02 87500 -- [-2245.667] (-2241.813) (-2248.836) (-2242.347) * [-2243.486] (-2241.470) (-2253.627) (-2243.557) -- 0:01:02 88000 -- [-2243.305] (-2242.281) (-2244.044) (-2243.469) * (-2243.611) [-2242.364] (-2242.873) (-2243.650) -- 0:01:02 88500 -- (-2243.521) (-2242.227) (-2243.646) [-2246.942] * (-2243.657) (-2241.784) (-2243.027) [-2243.673] -- 0:01:01 89000 -- (-2242.408) (-2242.857) [-2243.381] (-2244.074) * (-2242.529) [-2241.869] (-2244.082) (-2242.807) -- 0:01:01 89500 -- [-2242.738] (-2241.705) (-2242.124) (-2244.020) * [-2244.264] (-2242.338) (-2246.049) (-2245.348) -- 0:01:01 90000 -- (-2242.189) [-2241.689] (-2241.968) (-2247.791) * [-2245.918] (-2244.908) (-2251.787) (-2243.684) -- 0:01:00 Average standard deviation of split frequencies: 0.020508 90500 -- [-2241.999] (-2242.097) (-2243.232) (-2250.731) * [-2244.224] (-2245.281) (-2248.902) (-2243.677) -- 0:01:00 91000 -- (-2246.072) (-2242.229) [-2242.590] (-2248.770) * (-2244.183) [-2242.066] (-2250.475) (-2244.604) -- 0:00:59 91500 -- (-2245.381) [-2242.167] (-2242.590) (-2248.698) * (-2244.207) (-2243.286) (-2248.361) [-2244.264] -- 0:00:59 92000 -- (-2245.654) [-2243.722] (-2244.522) (-2244.587) * (-2244.209) [-2243.073] (-2247.482) (-2245.630) -- 0:00:59 92500 -- (-2243.344) [-2243.171] (-2243.726) (-2243.830) * [-2243.761] (-2246.332) (-2245.145) (-2243.151) -- 0:00:58 93000 -- (-2242.169) [-2244.872] (-2244.607) (-2243.790) * [-2244.224] (-2247.591) (-2243.721) (-2245.065) -- 0:00:58 93500 -- [-2243.497] (-2244.680) (-2243.176) (-2244.759) * (-2244.292) (-2247.180) [-2242.140] (-2243.506) -- 0:00:58 94000 -- (-2243.883) (-2250.016) [-2243.334] (-2243.259) * [-2244.324] (-2246.907) (-2243.172) (-2244.422) -- 0:00:57 94500 -- [-2244.227] (-2244.460) (-2244.375) (-2242.969) * (-2244.139) [-2246.196] (-2242.521) (-2243.082) -- 0:00:57 95000 -- [-2245.580] (-2246.619) (-2243.154) (-2243.016) * [-2243.853] (-2246.059) (-2243.321) (-2243.528) -- 0:00:57 Average standard deviation of split frequencies: 0.022819 95500 -- (-2247.390) (-2244.029) [-2243.844] (-2242.718) * (-2244.589) (-2243.903) (-2244.591) [-2245.647] -- 0:00:56 96000 -- (-2245.605) (-2247.050) (-2244.954) [-2242.778] * (-2243.947) (-2242.682) [-2246.659] (-2247.562) -- 0:00:56 96500 -- [-2245.560] (-2246.220) (-2244.396) (-2243.013) * (-2243.852) (-2243.684) (-2243.360) [-2243.941] -- 0:00:56 97000 -- (-2243.895) (-2246.474) (-2247.176) [-2244.795] * (-2245.340) (-2244.530) (-2242.593) [-2245.899] -- 0:00:55 97500 -- [-2246.697] (-2244.589) (-2246.315) (-2245.985) * [-2242.401] (-2248.323) (-2243.639) (-2248.818) -- 0:01:04 98000 -- (-2246.139) (-2243.589) (-2247.515) [-2245.269] * (-2242.065) (-2248.431) (-2243.233) [-2243.563] -- 0:01:04 98500 -- [-2244.222] (-2242.979) (-2246.250) (-2244.605) * [-2243.666] (-2243.522) (-2244.406) (-2243.655) -- 0:01:04 99000 -- (-2243.199) [-2243.581] (-2244.601) (-2245.640) * (-2244.893) (-2243.522) [-2244.021] (-2243.661) -- 0:01:03 99500 -- (-2243.773) (-2243.625) [-2241.922] (-2247.397) * (-2245.111) (-2244.005) (-2242.635) [-2247.340] -- 0:01:03 100000 -- (-2244.534) (-2244.565) [-2242.254] (-2244.196) * (-2243.993) [-2243.877] (-2243.356) (-2244.659) -- 0:01:02 Average standard deviation of split frequencies: 0.022374 100500 -- [-2244.122] (-2244.487) (-2243.697) (-2243.988) * (-2244.482) (-2252.567) (-2243.595) [-2250.299] -- 0:01:02 101000 -- [-2247.110] (-2245.590) (-2246.366) (-2242.103) * (-2244.701) (-2244.611) [-2243.622] (-2245.949) -- 0:01:02 101500 -- [-2246.572] (-2243.892) (-2243.286) (-2242.103) * (-2244.278) (-2243.073) [-2242.562] (-2245.867) -- 0:01:01 102000 -- (-2248.167) (-2244.231) (-2245.947) [-2245.531] * [-2243.701] (-2242.520) (-2244.820) (-2243.922) -- 0:01:01 102500 -- (-2247.171) (-2245.905) (-2245.115) [-2244.041] * (-2245.427) (-2244.010) [-2242.497] (-2243.922) -- 0:01:01 103000 -- (-2248.257) (-2246.401) [-2242.148] (-2242.520) * (-2242.016) (-2243.704) [-2242.482] (-2244.222) -- 0:01:00 103500 -- (-2246.995) (-2247.639) (-2243.324) [-2242.152] * [-2243.159] (-2243.809) (-2243.427) (-2243.811) -- 0:01:00 104000 -- (-2246.674) (-2248.216) (-2247.228) [-2242.561] * [-2244.263] (-2245.334) (-2244.512) (-2244.939) -- 0:01:00 104500 -- [-2245.512] (-2245.307) (-2242.422) (-2244.093) * (-2244.523) [-2243.034] (-2243.290) (-2244.456) -- 0:00:59 105000 -- (-2245.462) (-2244.820) [-2242.800] (-2243.086) * (-2247.483) (-2244.300) [-2245.478] (-2244.022) -- 0:00:59 Average standard deviation of split frequencies: 0.022660 105500 -- [-2245.309] (-2243.396) (-2243.369) (-2245.229) * (-2245.419) [-2244.201] (-2243.765) (-2242.586) -- 0:00:59 106000 -- (-2245.977) (-2243.664) [-2242.312] (-2243.421) * (-2246.891) (-2243.074) (-2243.446) [-2244.124] -- 0:00:59 106500 -- [-2245.933] (-2244.357) (-2243.150) (-2242.561) * (-2245.525) (-2244.205) [-2242.241] (-2244.738) -- 0:00:58 107000 -- (-2246.147) [-2245.600] (-2242.275) (-2243.458) * (-2244.523) (-2242.423) (-2242.283) [-2242.610] -- 0:00:58 107500 -- (-2245.762) (-2243.276) [-2245.086] (-2243.966) * (-2243.866) (-2243.668) [-2243.330] (-2242.591) -- 0:00:58 108000 -- (-2247.822) (-2242.656) (-2244.671) [-2244.606] * (-2243.390) (-2244.804) (-2242.775) [-2242.705] -- 0:00:57 108500 -- (-2246.759) [-2242.390] (-2244.020) (-2243.319) * (-2243.165) (-2245.035) [-2242.927] (-2242.786) -- 0:00:57 109000 -- (-2247.297) (-2243.484) (-2244.140) [-2245.724] * [-2243.303] (-2244.705) (-2243.407) (-2244.762) -- 0:00:57 109500 -- (-2243.471) (-2246.648) (-2243.191) [-2244.138] * (-2246.429) (-2247.019) [-2242.657] (-2244.245) -- 0:00:56 110000 -- [-2244.832] (-2248.283) (-2243.119) (-2242.952) * (-2246.878) (-2247.195) (-2242.655) [-2244.297] -- 0:00:56 Average standard deviation of split frequencies: 0.021724 110500 -- (-2244.911) [-2244.108] (-2243.412) (-2245.928) * (-2245.618) [-2246.712] (-2242.873) (-2243.396) -- 0:00:56 111000 -- (-2247.000) (-2241.971) [-2244.799] (-2244.619) * (-2244.546) (-2244.124) (-2242.828) [-2246.000] -- 0:00:56 111500 -- (-2241.693) (-2243.766) (-2245.302) [-2243.981] * (-2243.011) [-2243.975] (-2248.581) (-2247.467) -- 0:00:55 112000 -- [-2245.555] (-2241.603) (-2248.441) (-2242.187) * (-2245.474) (-2244.586) (-2246.924) [-2242.030] -- 0:01:03 112500 -- (-2243.394) (-2243.227) (-2244.048) [-2243.583] * (-2243.317) (-2249.513) [-2243.714] (-2245.272) -- 0:01:03 113000 -- (-2241.927) [-2243.765] (-2243.745) (-2242.876) * (-2242.908) (-2245.302) [-2244.357] (-2244.746) -- 0:01:02 113500 -- (-2242.899) [-2241.918] (-2242.770) (-2242.720) * (-2242.784) [-2243.589] (-2244.579) (-2243.451) -- 0:01:02 114000 -- (-2242.213) (-2244.084) [-2243.626] (-2245.864) * (-2243.211) (-2243.610) (-2243.720) [-2242.312] -- 0:01:02 114500 -- (-2245.529) [-2246.224] (-2243.226) (-2244.463) * (-2243.616) (-2243.606) [-2242.472] (-2241.764) -- 0:01:01 115000 -- [-2243.535] (-2248.736) (-2243.257) (-2242.642) * (-2244.775) [-2242.330] (-2242.646) (-2241.764) -- 0:01:01 Average standard deviation of split frequencies: 0.015400 115500 -- [-2242.870] (-2245.897) (-2244.493) (-2246.332) * (-2242.310) [-2243.382] (-2245.252) (-2244.204) -- 0:01:01 116000 -- (-2242.903) [-2246.938] (-2246.355) (-2242.661) * (-2244.400) (-2243.727) [-2244.258] (-2249.897) -- 0:01:00 116500 -- (-2245.344) (-2243.169) (-2245.395) [-2242.666] * (-2243.138) (-2243.294) [-2242.576] (-2242.990) -- 0:01:00 117000 -- (-2246.705) [-2242.297] (-2249.543) (-2242.602) * (-2244.112) [-2242.619] (-2243.587) (-2246.014) -- 0:01:00 117500 -- (-2245.432) (-2243.260) (-2245.404) [-2246.103] * [-2243.095] (-2242.494) (-2242.578) (-2246.739) -- 0:01:00 118000 -- (-2244.684) [-2246.616] (-2243.542) (-2248.770) * [-2243.161] (-2242.834) (-2243.101) (-2244.792) -- 0:00:59 118500 -- [-2243.374] (-2245.664) (-2243.880) (-2245.667) * (-2244.256) (-2242.903) [-2242.622] (-2242.272) -- 0:00:59 119000 -- (-2244.726) (-2243.642) [-2243.946] (-2246.304) * [-2242.464] (-2243.429) (-2242.755) (-2244.720) -- 0:00:59 119500 -- (-2242.215) (-2244.065) [-2247.875] (-2244.032) * [-2244.533] (-2242.104) (-2243.807) (-2245.105) -- 0:00:58 120000 -- (-2244.324) [-2242.922] (-2250.196) (-2242.907) * [-2244.491] (-2242.104) (-2244.831) (-2242.927) -- 0:00:58 Average standard deviation of split frequencies: 0.017695 120500 -- (-2250.565) (-2242.875) (-2246.758) [-2242.790] * (-2244.552) [-2244.102] (-2242.390) (-2243.011) -- 0:00:58 121000 -- (-2245.370) (-2242.795) (-2246.662) [-2243.688] * [-2243.039] (-2244.691) (-2242.308) (-2244.615) -- 0:00:58 121500 -- (-2243.310) (-2244.736) [-2243.606] (-2246.020) * (-2244.244) [-2244.216] (-2242.189) (-2245.412) -- 0:00:57 122000 -- (-2243.154) (-2245.224) (-2244.590) [-2244.681] * (-2244.560) (-2246.718) [-2242.159] (-2244.966) -- 0:00:57 122500 -- (-2243.063) [-2244.001] (-2250.426) (-2243.337) * (-2242.552) (-2243.778) (-2243.391) [-2245.908] -- 0:00:57 123000 -- [-2244.377] (-2243.659) (-2244.421) (-2245.188) * (-2242.942) [-2243.843] (-2243.785) (-2245.940) -- 0:00:57 123500 -- (-2243.584) (-2246.694) [-2245.802] (-2251.867) * (-2242.013) [-2243.226] (-2243.134) (-2249.050) -- 0:00:56 124000 -- (-2242.781) (-2246.621) [-2242.739] (-2244.215) * (-2242.000) [-2246.338] (-2242.044) (-2247.173) -- 0:00:56 124500 -- [-2241.592] (-2245.756) (-2243.641) (-2243.963) * (-2241.986) (-2250.115) [-2243.938] (-2245.011) -- 0:00:56 125000 -- (-2242.658) (-2245.698) (-2245.771) [-2245.932] * [-2242.428] (-2246.388) (-2242.839) (-2245.390) -- 0:00:56 Average standard deviation of split frequencies: 0.020390 125500 -- (-2242.778) (-2243.987) (-2246.420) [-2243.522] * (-2243.557) (-2242.691) [-2245.676] (-2248.849) -- 0:00:55 126000 -- [-2246.476] (-2243.099) (-2246.301) (-2243.522) * (-2243.180) (-2242.749) [-2246.252] (-2243.633) -- 0:00:55 126500 -- (-2244.679) (-2244.393) (-2244.230) [-2243.984] * (-2243.059) (-2244.211) [-2245.382] (-2243.659) -- 0:00:55 127000 -- (-2243.626) (-2243.888) (-2243.269) [-2244.337] * (-2243.429) (-2244.159) [-2242.617] (-2241.933) -- 0:01:01 127500 -- (-2243.658) (-2242.866) [-2243.202] (-2243.593) * (-2245.292) (-2246.361) (-2243.746) [-2243.093] -- 0:01:01 128000 -- (-2244.677) (-2242.716) [-2245.584] (-2245.166) * [-2244.422] (-2245.023) (-2243.597) (-2246.973) -- 0:01:01 128500 -- (-2242.652) [-2244.197] (-2247.267) (-2244.801) * (-2245.397) (-2245.023) [-2243.055] (-2244.755) -- 0:01:01 129000 -- (-2242.746) (-2244.451) [-2250.270] (-2244.026) * (-2243.008) (-2245.338) [-2250.243] (-2242.351) -- 0:01:00 129500 -- (-2244.090) [-2244.004] (-2252.446) (-2243.469) * (-2243.385) [-2242.641] (-2254.543) (-2243.456) -- 0:01:00 130000 -- [-2245.361] (-2243.829) (-2248.912) (-2243.830) * [-2243.476] (-2242.133) (-2246.477) (-2246.420) -- 0:01:00 Average standard deviation of split frequencies: 0.023991 130500 -- (-2245.093) (-2245.399) (-2245.071) [-2245.643] * (-2243.803) (-2242.528) [-2243.507] (-2244.930) -- 0:00:59 131000 -- (-2246.234) (-2244.145) [-2243.159] (-2245.609) * (-2247.120) (-2245.270) (-2242.853) [-2248.283] -- 0:00:59 131500 -- (-2247.726) (-2245.854) (-2243.117) [-2244.470] * (-2244.748) (-2245.392) [-2243.721] (-2247.641) -- 0:00:59 132000 -- (-2245.067) (-2245.873) (-2242.272) [-2245.150] * (-2244.348) (-2244.077) (-2246.989) [-2245.567] -- 0:00:59 132500 -- (-2242.940) [-2244.394] (-2242.290) (-2244.880) * (-2247.348) (-2242.844) (-2244.711) [-2243.641] -- 0:00:58 133000 -- (-2244.823) [-2243.667] (-2242.827) (-2247.337) * [-2242.049] (-2242.815) (-2244.743) (-2243.453) -- 0:00:58 133500 -- [-2243.127] (-2242.403) (-2241.968) (-2246.078) * (-2241.936) (-2243.106) (-2244.340) [-2242.761] -- 0:00:58 134000 -- (-2241.888) (-2242.594) [-2244.655] (-2244.890) * (-2242.853) (-2243.684) [-2243.685] (-2242.352) -- 0:00:58 134500 -- [-2241.750] (-2242.275) (-2244.641) (-2244.212) * (-2245.694) (-2243.648) [-2242.420] (-2244.513) -- 0:00:57 135000 -- [-2242.160] (-2242.100) (-2246.827) (-2242.907) * (-2245.694) (-2242.771) (-2244.628) [-2242.379] -- 0:00:57 Average standard deviation of split frequencies: 0.021491 135500 -- (-2242.914) [-2243.543] (-2250.266) (-2242.902) * (-2244.222) [-2242.024] (-2245.346) (-2242.718) -- 0:00:57 136000 -- [-2243.138] (-2243.428) (-2244.877) (-2242.648) * (-2243.267) (-2242.155) [-2242.668] (-2241.923) -- 0:00:57 136500 -- (-2243.472) (-2242.069) (-2246.565) [-2242.638] * (-2243.379) (-2245.558) (-2244.443) [-2241.954] -- 0:00:56 137000 -- (-2242.675) (-2242.068) (-2245.767) [-2242.638] * (-2242.921) (-2250.536) (-2243.073) [-2241.934] -- 0:00:56 137500 -- (-2243.367) [-2242.789] (-2244.724) (-2242.754) * [-2243.107] (-2242.372) (-2244.291) (-2242.238) -- 0:00:56 138000 -- (-2242.086) (-2244.860) (-2246.434) [-2243.411] * (-2243.049) [-2243.936] (-2245.127) (-2241.875) -- 0:00:56 138500 -- [-2243.861] (-2242.880) (-2247.146) (-2242.335) * (-2243.187) [-2243.862] (-2244.427) (-2242.384) -- 0:00:55 139000 -- (-2246.306) (-2244.539) (-2246.374) [-2242.078] * (-2243.120) [-2242.412] (-2245.911) (-2244.637) -- 0:00:55 139500 -- (-2244.558) [-2243.249] (-2244.322) (-2242.224) * (-2241.999) [-2242.551] (-2244.664) (-2251.527) -- 0:00:55 140000 -- (-2247.918) (-2245.020) (-2244.433) [-2241.924] * [-2242.581] (-2243.398) (-2243.245) (-2249.276) -- 0:00:55 Average standard deviation of split frequencies: 0.024050 140500 -- (-2244.217) (-2243.345) (-2244.767) [-2242.747] * (-2242.858) [-2244.193] (-2244.007) (-2245.926) -- 0:00:55 141000 -- (-2243.310) (-2244.670) [-2244.781] (-2242.912) * (-2242.533) [-2247.221] (-2244.808) (-2247.032) -- 0:00:54 141500 -- (-2245.703) (-2245.108) (-2244.207) [-2241.460] * (-2243.266) (-2243.296) [-2244.694] (-2244.570) -- 0:01:00 142000 -- (-2245.399) (-2242.822) (-2244.225) [-2245.359] * (-2243.604) (-2242.035) (-2246.702) [-2245.337] -- 0:01:00 142500 -- [-2245.325] (-2242.250) (-2244.784) (-2245.584) * (-2251.210) (-2242.744) [-2246.000] (-2244.530) -- 0:01:00 143000 -- (-2245.060) (-2242.361) [-2244.008] (-2241.789) * (-2242.302) [-2242.339] (-2246.797) (-2246.418) -- 0:00:59 143500 -- [-2242.149] (-2244.359) (-2246.486) (-2241.814) * [-2242.173] (-2241.806) (-2245.937) (-2247.730) -- 0:00:59 144000 -- (-2242.025) (-2244.101) (-2244.558) [-2243.157] * (-2242.218) (-2241.818) [-2248.696] (-2245.980) -- 0:00:59 144500 -- (-2241.996) (-2242.559) [-2246.033] (-2244.589) * (-2245.710) (-2246.832) (-2249.303) [-2246.164] -- 0:00:59 145000 -- (-2242.022) [-2242.560] (-2245.346) (-2246.339) * (-2244.312) (-2242.860) [-2246.447] (-2243.655) -- 0:00:58 Average standard deviation of split frequencies: 0.021884 145500 -- (-2242.033) (-2243.859) [-2242.080] (-2246.340) * [-2244.009] (-2242.857) (-2244.647) (-2244.003) -- 0:00:58 146000 -- [-2244.521] (-2244.657) (-2245.785) (-2244.807) * [-2242.191] (-2242.985) (-2244.720) (-2243.381) -- 0:00:58 146500 -- (-2243.050) [-2242.307] (-2246.147) (-2244.710) * (-2242.897) (-2242.674) [-2243.278] (-2242.951) -- 0:00:58 147000 -- (-2242.504) (-2241.914) (-2249.448) [-2244.544] * [-2246.107] (-2242.692) (-2244.961) (-2246.588) -- 0:00:58 147500 -- [-2244.017] (-2243.687) (-2248.250) (-2245.899) * (-2245.367) [-2242.666] (-2245.085) (-2246.265) -- 0:00:57 148000 -- (-2245.245) [-2242.382] (-2247.206) (-2244.353) * (-2247.394) (-2242.088) (-2243.883) [-2242.737] -- 0:00:57 148500 -- (-2245.346) [-2242.779] (-2244.277) (-2244.331) * (-2251.407) [-2242.304] (-2244.847) (-2242.907) -- 0:00:57 149000 -- (-2244.044) [-2242.669] (-2243.224) (-2243.827) * (-2248.913) (-2242.329) (-2243.029) [-2243.267] -- 0:00:57 149500 -- (-2244.323) [-2243.433] (-2243.728) (-2244.091) * [-2246.978] (-2244.000) (-2241.683) (-2243.513) -- 0:00:56 150000 -- (-2243.576) (-2244.252) (-2243.119) [-2243.671] * (-2246.845) (-2242.076) (-2241.681) [-2243.528] -- 0:00:56 Average standard deviation of split frequencies: 0.022249 150500 -- [-2244.959] (-2242.727) (-2246.279) (-2243.849) * (-2251.302) [-2243.013] (-2241.680) (-2243.843) -- 0:00:56 151000 -- (-2244.611) [-2242.581] (-2246.753) (-2243.639) * (-2245.658) (-2245.922) [-2242.123] (-2243.549) -- 0:00:56 151500 -- (-2243.184) [-2241.992] (-2246.144) (-2242.913) * [-2243.560] (-2245.385) (-2242.950) (-2242.780) -- 0:00:56 152000 -- (-2244.124) (-2246.108) (-2242.781) [-2243.006] * (-2243.651) (-2246.400) (-2245.052) [-2241.976] -- 0:00:55 152500 -- (-2244.929) (-2244.670) (-2246.249) [-2243.640] * [-2241.979] (-2245.970) (-2245.052) (-2241.625) -- 0:00:55 153000 -- [-2243.423] (-2246.181) (-2244.527) (-2249.894) * (-2242.099) (-2244.096) (-2244.550) [-2241.652] -- 0:00:55 153500 -- [-2244.965] (-2243.679) (-2243.581) (-2244.546) * (-2242.404) [-2243.111] (-2244.449) (-2241.912) -- 0:00:55 154000 -- (-2244.737) [-2242.002] (-2244.466) (-2244.264) * [-2241.382] (-2243.404) (-2244.669) (-2244.343) -- 0:00:54 154500 -- (-2244.688) [-2241.901] (-2243.573) (-2245.117) * (-2242.242) [-2246.371] (-2246.567) (-2243.470) -- 0:00:54 155000 -- (-2249.021) [-2246.567] (-2244.453) (-2243.474) * [-2242.890] (-2245.992) (-2244.443) (-2243.232) -- 0:00:54 Average standard deviation of split frequencies: 0.022328 155500 -- (-2245.736) (-2251.446) (-2243.776) [-2244.336] * (-2242.535) (-2245.085) [-2243.631] (-2241.784) -- 0:00:54 156000 -- [-2245.089] (-2245.486) (-2246.540) (-2244.352) * (-2244.741) [-2243.599] (-2242.386) (-2243.313) -- 0:00:59 156500 -- (-2247.688) (-2247.321) (-2248.254) [-2242.696] * (-2243.472) (-2243.421) (-2242.464) [-2243.313] -- 0:00:59 157000 -- (-2247.913) (-2246.439) (-2242.447) [-2243.016] * [-2244.185] (-2247.743) (-2248.725) (-2243.414) -- 0:00:59 157500 -- (-2247.323) [-2243.596] (-2250.839) (-2242.773) * (-2244.260) (-2242.781) (-2245.340) [-2243.124] -- 0:00:58 158000 -- [-2243.792] (-2243.814) (-2251.303) (-2243.523) * (-2244.288) [-2242.771] (-2244.306) (-2243.058) -- 0:00:58 158500 -- (-2243.199) (-2242.917) (-2246.015) [-2242.663] * [-2243.630] (-2243.379) (-2246.617) (-2243.058) -- 0:00:58 159000 -- (-2244.334) (-2242.376) (-2246.010) [-2242.598] * (-2242.605) [-2247.087] (-2251.542) (-2243.058) -- 0:00:58 159500 -- (-2242.916) [-2243.879] (-2244.466) (-2242.632) * (-2244.139) [-2241.578] (-2242.293) (-2250.758) -- 0:00:57 160000 -- (-2242.866) [-2245.568] (-2248.557) (-2242.868) * [-2244.052] (-2242.374) (-2242.395) (-2244.508) -- 0:00:57 Average standard deviation of split frequencies: 0.022983 160500 -- (-2243.640) [-2241.540] (-2246.852) (-2244.589) * [-2243.768] (-2241.560) (-2246.953) (-2246.693) -- 0:00:57 161000 -- (-2246.474) [-2249.492] (-2248.011) (-2242.266) * [-2244.592] (-2242.319) (-2245.801) (-2245.906) -- 0:00:57 161500 -- (-2243.216) (-2245.851) (-2244.564) [-2242.266] * (-2244.190) [-2242.394] (-2246.930) (-2245.287) -- 0:00:57 162000 -- [-2246.895] (-2244.040) (-2247.898) (-2243.668) * (-2247.892) (-2243.221) [-2242.137] (-2246.382) -- 0:00:56 162500 -- (-2244.390) [-2243.284] (-2246.010) (-2242.753) * (-2244.982) (-2245.044) (-2243.467) [-2244.376] -- 0:00:56 163000 -- [-2247.164] (-2243.269) (-2244.817) (-2245.290) * (-2244.663) (-2246.202) [-2243.103] (-2244.125) -- 0:00:56 163500 -- [-2245.432] (-2244.500) (-2245.134) (-2242.971) * (-2247.813) [-2243.004] (-2242.025) (-2244.080) -- 0:00:56 164000 -- [-2243.934] (-2245.641) (-2245.624) (-2244.141) * (-2243.462) [-2243.067] (-2243.694) (-2243.041) -- 0:00:56 164500 -- [-2243.749] (-2242.528) (-2244.959) (-2244.498) * [-2242.625] (-2243.341) (-2246.187) (-2245.553) -- 0:00:55 165000 -- (-2245.772) (-2242.753) (-2244.810) [-2244.102] * (-2242.820) (-2244.427) (-2243.630) [-2245.334] -- 0:00:55 Average standard deviation of split frequencies: 0.022868 165500 -- [-2241.957] (-2244.281) (-2244.037) (-2243.665) * [-2242.914] (-2244.211) (-2242.180) (-2244.027) -- 0:00:55 166000 -- [-2241.717] (-2242.852) (-2248.530) (-2244.121) * [-2243.016] (-2246.155) (-2243.414) (-2243.599) -- 0:00:55 166500 -- (-2242.318) (-2243.907) [-2244.795] (-2244.447) * (-2245.184) [-2244.810] (-2246.620) (-2245.409) -- 0:00:55 167000 -- (-2246.336) [-2243.590] (-2244.853) (-2246.769) * (-2243.846) (-2245.163) [-2243.056] (-2244.582) -- 0:00:54 167500 -- (-2244.556) (-2243.513) (-2243.243) [-2247.018] * (-2242.718) [-2243.919] (-2244.899) (-2243.503) -- 0:00:54 168000 -- (-2246.655) (-2243.918) [-2245.480] (-2244.538) * (-2242.782) (-2245.384) [-2243.456] (-2243.546) -- 0:00:54 168500 -- [-2242.310] (-2245.092) (-2245.062) (-2242.248) * (-2242.750) (-2248.576) [-2243.335] (-2243.215) -- 0:00:54 169000 -- [-2243.882] (-2243.820) (-2245.354) (-2242.491) * (-2245.696) (-2247.190) (-2245.687) [-2241.996] -- 0:00:54 169500 -- (-2243.882) [-2243.080] (-2248.687) (-2241.679) * [-2243.581] (-2243.874) (-2244.598) (-2241.996) -- 0:00:53 170000 -- [-2242.371] (-2243.225) (-2243.464) (-2241.836) * (-2243.072) [-2243.397] (-2243.118) (-2241.938) -- 0:00:53 Average standard deviation of split frequencies: 0.018875 170500 -- (-2244.467) (-2245.200) (-2242.962) [-2242.644] * (-2243.990) (-2243.404) [-2243.027] (-2242.769) -- 0:00:53 171000 -- (-2246.572) [-2244.304] (-2242.071) (-2243.302) * (-2243.871) [-2247.051] (-2244.183) (-2245.128) -- 0:00:58 171500 -- (-2246.427) (-2244.392) (-2241.672) [-2242.972] * (-2244.184) (-2244.444) [-2241.971] (-2246.254) -- 0:00:57 172000 -- (-2244.183) (-2242.925) [-2242.117] (-2243.935) * (-2248.349) (-2246.951) [-2242.647] (-2247.253) -- 0:00:57 172500 -- (-2248.499) [-2244.513] (-2242.142) (-2243.800) * (-2248.225) (-2244.051) [-2242.532] (-2245.807) -- 0:00:57 173000 -- [-2243.194] (-2244.742) (-2243.361) (-2243.522) * (-2242.955) [-2244.208] (-2242.839) (-2244.857) -- 0:00:57 173500 -- (-2243.385) [-2243.644] (-2241.658) (-2242.945) * [-2242.313] (-2243.811) (-2243.017) (-2242.065) -- 0:00:57 174000 -- (-2244.266) [-2242.277] (-2241.675) (-2249.642) * (-2242.437) [-2245.162] (-2242.937) (-2242.951) -- 0:00:56 174500 -- (-2246.194) (-2246.248) (-2243.831) [-2247.713] * [-2244.443] (-2244.274) (-2243.753) (-2242.593) -- 0:00:56 175000 -- (-2247.037) [-2243.994] (-2242.207) (-2245.579) * (-2243.879) (-2244.628) (-2245.346) [-2242.593] -- 0:00:56 Average standard deviation of split frequencies: 0.016543 175500 -- [-2244.389] (-2241.616) (-2242.018) (-2245.873) * (-2243.709) [-2244.451] (-2245.031) (-2241.598) -- 0:00:56 176000 -- [-2243.461] (-2241.610) (-2242.134) (-2243.257) * (-2243.639) (-2245.712) [-2243.836] (-2241.554) -- 0:00:56 176500 -- (-2242.134) (-2241.485) (-2243.933) [-2243.568] * (-2245.017) [-2243.334] (-2247.780) (-2242.366) -- 0:00:55 177000 -- (-2244.060) (-2241.456) (-2246.695) [-2243.829] * [-2243.814] (-2243.528) (-2243.898) (-2248.525) -- 0:00:55 177500 -- (-2246.674) (-2242.905) (-2243.485) [-2242.549] * [-2244.123] (-2243.907) (-2244.573) (-2248.775) -- 0:00:55 178000 -- (-2246.281) (-2244.008) (-2242.897) [-2242.869] * (-2243.263) (-2243.074) (-2247.672) [-2249.065] -- 0:00:55 178500 -- (-2243.033) [-2244.228] (-2243.650) (-2242.621) * (-2242.424) (-2245.696) [-2244.226] (-2244.931) -- 0:00:55 179000 -- [-2244.581] (-2244.914) (-2243.507) (-2245.252) * (-2246.560) [-2245.092] (-2244.188) (-2244.990) -- 0:00:55 179500 -- [-2243.718] (-2242.522) (-2243.727) (-2243.449) * (-2245.185) (-2243.757) [-2244.451] (-2245.773) -- 0:00:54 180000 -- (-2242.847) [-2241.966] (-2244.454) (-2243.334) * (-2245.035) [-2242.633] (-2247.009) (-2243.621) -- 0:00:54 Average standard deviation of split frequencies: 0.018572 180500 -- (-2242.574) [-2243.620] (-2245.007) (-2242.839) * (-2244.113) [-2243.516] (-2246.232) (-2244.359) -- 0:00:54 181000 -- (-2241.960) [-2243.621] (-2244.466) (-2242.293) * (-2242.961) (-2243.640) (-2245.665) [-2242.890] -- 0:00:54 181500 -- (-2243.359) (-2243.704) (-2242.265) [-2243.118] * (-2246.034) (-2250.058) [-2246.754] (-2244.923) -- 0:00:54 182000 -- [-2245.154] (-2245.649) (-2243.447) (-2244.412) * (-2243.277) (-2244.619) (-2243.794) [-2244.328] -- 0:00:53 182500 -- [-2242.922] (-2243.110) (-2243.447) (-2244.091) * [-2242.065] (-2245.156) (-2242.730) (-2243.832) -- 0:00:53 183000 -- (-2242.254) (-2242.466) [-2245.695] (-2248.195) * (-2244.305) [-2246.261] (-2242.542) (-2243.499) -- 0:00:53 183500 -- [-2243.863] (-2248.444) (-2243.376) (-2244.226) * (-2245.060) [-2246.275] (-2243.737) (-2243.939) -- 0:00:53 184000 -- [-2245.016] (-2244.488) (-2243.376) (-2246.152) * (-2244.643) [-2242.354] (-2243.047) (-2244.561) -- 0:00:53 184500 -- (-2243.923) [-2243.102] (-2246.026) (-2245.901) * (-2242.715) (-2246.495) (-2247.506) [-2244.288] -- 0:00:53 185000 -- (-2244.333) [-2241.945] (-2243.458) (-2246.870) * [-2243.780] (-2244.567) (-2245.076) (-2248.648) -- 0:00:52 Average standard deviation of split frequencies: 0.017145 185500 -- (-2242.780) [-2243.591] (-2246.811) (-2243.366) * [-2245.682] (-2244.674) (-2243.502) (-2245.932) -- 0:00:57 186000 -- (-2243.115) (-2243.473) [-2249.546] (-2244.189) * (-2245.953) (-2244.925) [-2243.686] (-2244.517) -- 0:00:56 186500 -- [-2242.079] (-2245.489) (-2249.080) (-2245.278) * [-2242.571] (-2245.115) (-2243.778) (-2243.158) -- 0:00:56 187000 -- (-2241.827) (-2242.281) (-2251.210) [-2245.194] * [-2242.147] (-2247.312) (-2244.586) (-2242.661) -- 0:00:56 187500 -- (-2244.093) (-2243.199) (-2248.442) [-2246.015] * [-2244.882] (-2243.278) (-2246.594) (-2241.870) -- 0:00:56 188000 -- (-2242.564) (-2242.597) (-2245.573) [-2242.796] * (-2243.225) (-2243.172) (-2246.233) [-2241.740] -- 0:00:56 188500 -- (-2242.830) [-2243.077] (-2247.215) (-2245.357) * (-2241.958) (-2243.277) (-2243.926) [-2242.320] -- 0:00:55 189000 -- [-2245.060] (-2243.214) (-2243.324) (-2245.145) * (-2242.030) (-2244.592) [-2241.882] (-2242.458) -- 0:00:55 189500 -- [-2245.424] (-2243.061) (-2243.335) (-2245.041) * (-2242.082) (-2244.327) (-2242.089) [-2243.188] -- 0:00:55 190000 -- (-2244.378) (-2242.643) [-2246.746] (-2242.001) * (-2243.052) (-2242.545) [-2242.060] (-2244.018) -- 0:00:55 Average standard deviation of split frequencies: 0.016757 190500 -- (-2244.441) [-2243.235] (-2246.234) (-2242.521) * (-2242.696) (-2242.868) (-2244.560) [-2246.699] -- 0:00:55 191000 -- (-2246.346) (-2243.355) [-2246.449] (-2245.222) * [-2242.380] (-2243.871) (-2244.642) (-2242.634) -- 0:00:55 191500 -- (-2243.968) [-2245.390] (-2246.197) (-2243.700) * (-2242.751) (-2247.612) (-2246.233) [-2242.335] -- 0:00:54 192000 -- (-2241.957) (-2243.402) [-2242.436] (-2242.275) * [-2242.358] (-2246.658) (-2244.223) (-2242.839) -- 0:00:54 192500 -- (-2242.050) [-2244.942] (-2244.818) (-2244.326) * (-2243.058) (-2246.991) (-2243.442) [-2246.230] -- 0:00:54 193000 -- (-2242.284) (-2244.353) (-2242.334) [-2245.489] * (-2243.906) (-2243.101) (-2248.236) [-2242.284] -- 0:00:54 193500 -- (-2244.076) [-2242.282] (-2242.382) (-2244.617) * [-2242.853] (-2243.639) (-2246.607) (-2243.008) -- 0:00:54 194000 -- [-2244.074] (-2242.282) (-2242.325) (-2243.869) * (-2242.775) [-2242.987] (-2245.595) (-2242.378) -- 0:00:54 194500 -- [-2247.291] (-2242.251) (-2242.228) (-2242.341) * (-2243.625) [-2246.925] (-2247.862) (-2244.002) -- 0:00:53 195000 -- (-2245.822) (-2245.851) (-2242.388) [-2243.002] * (-2243.492) (-2245.266) (-2245.453) [-2247.540] -- 0:00:53 Average standard deviation of split frequencies: 0.014564 195500 -- (-2247.805) [-2248.193] (-2243.614) (-2242.279) * [-2247.247] (-2246.885) (-2244.407) (-2245.586) -- 0:00:53 196000 -- [-2243.706] (-2243.456) (-2241.785) (-2242.355) * (-2248.019) (-2248.755) (-2245.568) [-2244.051] -- 0:00:53 196500 -- (-2244.715) [-2245.074] (-2242.075) (-2243.024) * (-2243.844) (-2247.385) (-2245.389) [-2245.841] -- 0:00:53 197000 -- (-2243.961) (-2243.651) (-2243.538) [-2242.335] * [-2243.041] (-2245.164) (-2243.372) (-2244.427) -- 0:00:52 197500 -- (-2244.629) [-2241.429] (-2243.833) (-2244.053) * (-2243.758) [-2242.802] (-2245.417) (-2249.858) -- 0:00:52 198000 -- (-2243.720) (-2241.898) (-2245.416) [-2245.091] * (-2254.337) (-2245.275) (-2243.562) [-2242.935] -- 0:00:52 198500 -- (-2243.878) [-2242.029] (-2243.039) (-2245.590) * (-2247.680) (-2243.197) [-2246.181] (-2244.284) -- 0:00:52 199000 -- (-2243.393) (-2242.001) [-2242.448] (-2246.815) * (-2246.124) (-2243.891) (-2251.218) [-2244.214] -- 0:00:52 199500 -- (-2244.854) (-2244.259) (-2242.533) [-2246.210] * (-2246.114) (-2242.905) (-2245.158) [-2244.670] -- 0:00:52 200000 -- (-2245.525) (-2243.433) [-2242.519] (-2242.137) * (-2246.220) [-2242.916] (-2245.288) (-2244.670) -- 0:00:55 Average standard deviation of split frequencies: 0.017488 200500 -- (-2250.220) (-2243.190) [-2241.962] (-2242.121) * (-2244.470) (-2243.991) (-2247.104) [-2243.153] -- 0:00:55 201000 -- (-2245.959) [-2244.126] (-2241.587) (-2244.647) * (-2242.874) [-2245.606] (-2244.812) (-2244.345) -- 0:00:55 201500 -- [-2242.485] (-2245.610) (-2241.772) (-2243.343) * (-2243.172) (-2246.848) (-2245.216) [-2243.047] -- 0:00:55 202000 -- [-2243.493] (-2245.917) (-2241.772) (-2243.937) * (-2243.528) (-2245.306) (-2244.786) [-2243.051] -- 0:00:55 202500 -- (-2246.603) (-2245.109) [-2241.570] (-2244.216) * [-2243.509] (-2244.165) (-2244.846) (-2243.153) -- 0:00:55 203000 -- (-2248.638) [-2244.268] (-2244.406) (-2244.402) * (-2244.135) (-2243.387) (-2243.678) [-2243.151] -- 0:00:54 203500 -- (-2243.144) (-2244.106) [-2243.883] (-2243.265) * (-2245.479) (-2243.577) [-2245.162] (-2244.848) -- 0:00:54 204000 -- (-2242.520) [-2244.468] (-2243.080) (-2244.110) * [-2244.892] (-2243.507) (-2247.081) (-2244.252) -- 0:00:54 204500 -- (-2242.341) (-2246.450) (-2242.562) [-2243.912] * (-2244.895) (-2243.501) (-2246.413) [-2248.994] -- 0:00:54 205000 -- [-2243.997] (-2243.030) (-2242.425) (-2246.075) * (-2244.860) [-2242.619] (-2244.799) (-2241.460) -- 0:00:54 Average standard deviation of split frequencies: 0.016400 205500 -- (-2244.187) (-2244.425) [-2243.341] (-2244.612) * [-2247.095] (-2242.764) (-2244.260) (-2243.999) -- 0:00:54 206000 -- (-2244.093) [-2244.135] (-2245.213) (-2243.772) * (-2244.931) [-2243.291] (-2242.034) (-2242.052) -- 0:00:53 206500 -- (-2245.063) (-2243.041) [-2242.878] (-2244.686) * (-2247.864) (-2242.187) (-2242.054) [-2241.868] -- 0:00:53 207000 -- (-2244.382) (-2248.361) (-2243.208) [-2243.828] * (-2244.040) [-2241.638] (-2243.222) (-2242.661) -- 0:00:53 207500 -- [-2243.672] (-2242.172) (-2243.194) (-2247.226) * (-2243.558) (-2243.552) [-2243.165] (-2242.640) -- 0:00:53 208000 -- [-2246.896] (-2242.331) (-2246.450) (-2244.608) * (-2244.809) (-2244.384) [-2243.630] (-2243.263) -- 0:00:53 208500 -- (-2244.736) [-2243.645] (-2244.634) (-2247.440) * [-2244.072] (-2244.088) (-2243.857) (-2246.559) -- 0:00:53 209000 -- (-2244.018) (-2242.756) [-2244.175] (-2246.112) * [-2245.387] (-2249.317) (-2245.431) (-2246.748) -- 0:00:52 209500 -- (-2243.151) (-2242.763) (-2242.737) [-2245.161] * [-2243.032] (-2244.917) (-2244.387) (-2249.363) -- 0:00:52 210000 -- (-2242.079) (-2242.093) (-2243.571) [-2243.626] * (-2242.679) [-2243.571] (-2244.839) (-2247.785) -- 0:00:52 Average standard deviation of split frequencies: 0.015664 210500 -- (-2243.744) (-2242.211) [-2243.486] (-2244.395) * (-2244.046) (-2244.041) [-2245.097] (-2246.620) -- 0:00:52 211000 -- (-2242.800) (-2241.827) [-2243.273] (-2243.247) * (-2242.294) [-2243.485] (-2244.108) (-2246.224) -- 0:00:52 211500 -- (-2244.241) [-2241.828] (-2241.649) (-2242.284) * (-2242.466) (-2241.714) [-2243.430] (-2243.169) -- 0:00:52 212000 -- (-2244.829) (-2243.708) [-2242.834] (-2243.306) * (-2241.881) [-2243.670] (-2246.574) (-2244.511) -- 0:00:52 212500 -- (-2243.620) [-2242.841] (-2242.420) (-2243.133) * [-2246.866] (-2242.344) (-2242.957) (-2243.898) -- 0:00:51 213000 -- (-2243.646) [-2242.371] (-2243.147) (-2242.146) * (-2244.574) [-2241.923] (-2244.525) (-2246.305) -- 0:00:51 213500 -- [-2243.014] (-2241.701) (-2243.503) (-2242.195) * (-2246.211) (-2241.923) (-2243.439) [-2245.033] -- 0:00:51 214000 -- [-2244.555] (-2246.053) (-2242.704) (-2247.349) * (-2246.223) (-2243.757) (-2241.981) [-2242.890] -- 0:00:51 214500 -- [-2242.685] (-2244.597) (-2242.858) (-2245.554) * (-2244.363) (-2243.756) (-2242.808) [-2243.011] -- 0:00:51 215000 -- (-2242.837) (-2248.962) [-2244.180] (-2243.934) * (-2242.874) (-2243.804) (-2242.213) [-2242.736] -- 0:00:54 Average standard deviation of split frequencies: 0.016432 215500 -- (-2243.146) (-2248.197) [-2245.470] (-2244.401) * (-2249.041) (-2245.971) (-2242.645) [-2243.113] -- 0:00:54 216000 -- [-2243.548] (-2249.433) (-2248.943) (-2245.627) * (-2253.233) (-2243.450) [-2241.805] (-2243.642) -- 0:00:54 216500 -- (-2244.097) (-2250.173) [-2244.361] (-2250.801) * (-2244.912) (-2243.815) [-2241.687] (-2243.075) -- 0:00:54 217000 -- [-2242.795] (-2246.721) (-2246.388) (-2241.949) * [-2243.792] (-2246.008) (-2241.749) (-2242.882) -- 0:00:54 217500 -- (-2243.315) [-2244.609] (-2243.995) (-2241.488) * (-2248.740) [-2248.711] (-2241.930) (-2242.573) -- 0:00:53 218000 -- (-2242.656) (-2245.530) [-2244.803] (-2244.648) * (-2246.802) (-2248.762) (-2241.682) [-2242.582] -- 0:00:53 218500 -- (-2242.655) [-2251.196] (-2243.189) (-2243.814) * (-2243.530) (-2243.459) [-2242.347] (-2248.758) -- 0:00:53 219000 -- (-2241.976) (-2248.187) (-2243.691) [-2245.630] * (-2243.647) (-2243.080) (-2242.852) [-2244.682] -- 0:00:53 219500 -- [-2242.799] (-2245.056) (-2243.463) (-2244.208) * [-2242.569] (-2243.079) (-2243.643) (-2244.202) -- 0:00:53 220000 -- (-2242.956) [-2243.961] (-2244.515) (-2242.943) * (-2244.284) (-2244.377) [-2241.745] (-2245.868) -- 0:00:53 Average standard deviation of split frequencies: 0.016734 220500 -- (-2242.913) (-2245.206) (-2245.266) [-2242.850] * (-2244.120) (-2243.854) [-2243.870] (-2242.744) -- 0:00:53 221000 -- (-2241.828) (-2245.292) [-2244.182] (-2242.911) * (-2243.097) [-2243.820] (-2243.436) (-2243.890) -- 0:00:52 221500 -- [-2244.612] (-2246.491) (-2241.922) (-2245.986) * (-2243.531) [-2244.103] (-2244.883) (-2243.849) -- 0:00:52 222000 -- (-2245.691) (-2243.751) [-2244.154] (-2242.533) * [-2244.225] (-2243.359) (-2244.800) (-2243.666) -- 0:00:52 222500 -- (-2244.634) [-2244.034] (-2242.669) (-2242.602) * (-2245.999) [-2245.314] (-2242.625) (-2245.118) -- 0:00:52 223000 -- (-2242.470) (-2245.171) [-2243.529] (-2244.053) * (-2243.411) (-2243.845) [-2242.833] (-2245.750) -- 0:00:52 223500 -- [-2244.352] (-2243.757) (-2248.527) (-2242.515) * [-2242.233] (-2243.711) (-2244.595) (-2245.757) -- 0:00:52 224000 -- (-2242.511) (-2243.885) (-2247.402) [-2245.230] * (-2242.526) [-2246.168] (-2243.276) (-2245.788) -- 0:00:51 224500 -- (-2243.238) (-2242.575) (-2244.723) [-2246.180] * [-2243.877] (-2243.055) (-2242.969) (-2245.401) -- 0:00:51 225000 -- (-2242.277) (-2242.622) (-2244.678) [-2242.913] * (-2244.217) (-2245.673) (-2242.905) [-2243.951] -- 0:00:51 Average standard deviation of split frequencies: 0.016455 225500 -- (-2242.843) (-2247.146) (-2245.802) [-2245.738] * (-2248.793) [-2243.994] (-2246.141) (-2249.316) -- 0:00:51 226000 -- [-2244.275] (-2249.035) (-2243.769) (-2246.901) * (-2246.606) (-2241.879) (-2248.225) [-2245.732] -- 0:00:51 226500 -- [-2244.204] (-2251.177) (-2244.451) (-2246.915) * (-2250.414) (-2242.350) [-2246.418] (-2246.796) -- 0:00:51 227000 -- (-2247.339) [-2243.997] (-2243.558) (-2242.786) * (-2254.397) [-2243.547] (-2246.716) (-2242.360) -- 0:00:51 227500 -- [-2244.900] (-2243.263) (-2242.777) (-2247.213) * (-2247.812) (-2243.530) [-2244.687] (-2242.994) -- 0:00:50 228000 -- (-2242.990) (-2242.651) [-2242.849] (-2246.753) * [-2247.554] (-2244.993) (-2243.287) (-2242.410) -- 0:00:50 228500 -- (-2242.886) [-2241.783] (-2246.196) (-2245.341) * (-2244.417) (-2244.445) [-2241.358] (-2244.879) -- 0:00:54 229000 -- [-2243.850] (-2241.953) (-2244.047) (-2241.663) * (-2246.955) [-2243.639] (-2241.363) (-2245.101) -- 0:00:53 229500 -- (-2243.905) [-2242.413] (-2242.933) (-2241.848) * [-2250.243] (-2247.162) (-2242.531) (-2243.490) -- 0:00:53 230000 -- (-2245.023) (-2242.405) (-2242.760) [-2241.734] * [-2244.707] (-2249.423) (-2245.543) (-2243.600) -- 0:00:53 Average standard deviation of split frequencies: 0.018285 230500 -- (-2243.780) (-2244.278) [-2242.072] (-2241.848) * (-2242.181) (-2248.802) (-2244.026) [-2242.579] -- 0:00:53 231000 -- (-2243.234) (-2243.276) (-2242.894) [-2242.303] * (-2242.291) (-2247.416) [-2243.061] (-2245.498) -- 0:00:53 231500 -- (-2244.937) (-2244.980) (-2246.185) [-2242.074] * (-2242.968) (-2247.739) [-2242.414] (-2246.168) -- 0:00:53 232000 -- (-2250.097) (-2243.996) (-2244.478) [-2242.132] * [-2244.099] (-2244.870) (-2244.569) (-2248.994) -- 0:00:52 232500 -- [-2242.541] (-2242.802) (-2242.726) (-2245.450) * [-2243.259] (-2246.801) (-2244.989) (-2243.757) -- 0:00:52 233000 -- (-2242.539) [-2244.964] (-2243.031) (-2246.299) * [-2244.340] (-2246.095) (-2244.893) (-2242.620) -- 0:00:52 233500 -- [-2242.097] (-2242.982) (-2243.366) (-2243.268) * (-2243.056) (-2247.103) [-2242.081] (-2243.298) -- 0:00:52 234000 -- (-2245.125) (-2249.186) (-2245.389) [-2242.923] * [-2242.390] (-2246.529) (-2242.697) (-2244.244) -- 0:00:52 234500 -- (-2246.088) [-2249.118] (-2244.061) (-2245.023) * (-2245.049) (-2243.495) (-2243.862) [-2241.899] -- 0:00:52 235000 -- [-2247.143] (-2244.709) (-2243.964) (-2245.882) * (-2245.867) (-2244.898) (-2243.057) [-2243.682] -- 0:00:52 Average standard deviation of split frequencies: 0.016400 235500 -- (-2246.644) (-2243.271) (-2243.581) [-2243.496] * (-2244.429) (-2245.241) [-2243.433] (-2245.857) -- 0:00:51 236000 -- (-2247.845) (-2242.542) [-2244.577] (-2244.201) * (-2245.843) (-2243.331) [-2244.658] (-2242.352) -- 0:00:51 236500 -- (-2248.213) [-2245.041] (-2244.745) (-2244.091) * (-2245.615) [-2243.103] (-2247.027) (-2242.059) -- 0:00:51 237000 -- (-2245.311) (-2245.007) [-2246.395] (-2245.575) * (-2243.199) (-2242.577) (-2247.091) [-2245.185] -- 0:00:51 237500 -- (-2245.311) (-2246.883) (-2245.652) [-2243.247] * [-2242.997] (-2242.692) (-2250.710) (-2246.628) -- 0:00:51 238000 -- (-2245.442) (-2247.407) (-2243.678) [-2243.859] * [-2243.644] (-2243.778) (-2244.617) (-2242.728) -- 0:00:51 238500 -- (-2247.122) [-2247.667] (-2243.147) (-2247.611) * (-2246.477) (-2244.931) (-2248.648) [-2242.772] -- 0:00:51 239000 -- (-2244.129) (-2242.605) [-2243.788] (-2244.500) * (-2242.448) [-2245.372] (-2247.014) (-2246.488) -- 0:00:50 239500 -- [-2247.237] (-2243.613) (-2245.595) (-2244.324) * (-2243.053) (-2243.620) [-2247.596] (-2246.693) -- 0:00:50 240000 -- (-2243.172) (-2243.699) (-2245.549) [-2243.533] * (-2244.229) (-2245.937) [-2245.715] (-2244.683) -- 0:00:50 Average standard deviation of split frequencies: 0.016082 240500 -- (-2244.132) [-2247.795] (-2247.783) (-2243.525) * (-2246.161) (-2244.326) [-2243.339] (-2244.551) -- 0:00:50 241000 -- (-2245.999) [-2246.327] (-2245.857) (-2245.798) * [-2243.327] (-2243.188) (-2245.902) (-2245.115) -- 0:00:50 241500 -- (-2247.171) [-2247.160] (-2243.584) (-2242.431) * (-2245.674) (-2242.829) (-2245.902) [-2243.377] -- 0:00:50 242000 -- [-2242.738] (-2243.908) (-2244.679) (-2243.472) * [-2243.603] (-2242.493) (-2242.523) (-2243.410) -- 0:00:50 242500 -- (-2242.308) (-2243.222) (-2243.686) [-2242.054] * (-2243.494) (-2242.493) [-2242.755] (-2245.547) -- 0:00:49 243000 -- [-2243.087] (-2246.181) (-2243.103) (-2243.995) * [-2244.219] (-2243.614) (-2243.383) (-2244.223) -- 0:00:52 243500 -- (-2242.426) (-2247.132) [-2244.736] (-2243.630) * (-2244.504) [-2245.383] (-2242.222) (-2255.186) -- 0:00:52 244000 -- [-2245.070] (-2245.700) (-2246.199) (-2242.810) * [-2244.494] (-2242.701) (-2242.820) (-2252.375) -- 0:00:52 244500 -- (-2242.838) [-2244.897] (-2248.381) (-2241.872) * (-2244.595) (-2242.761) [-2242.123] (-2243.575) -- 0:00:52 245000 -- (-2242.471) [-2242.815] (-2243.616) (-2242.683) * [-2243.819] (-2246.576) (-2243.850) (-2243.245) -- 0:00:52 Average standard deviation of split frequencies: 0.015618 245500 -- [-2243.021] (-2244.430) (-2243.514) (-2243.296) * [-2243.670] (-2243.242) (-2244.322) (-2243.706) -- 0:00:52 246000 -- (-2242.720) (-2244.684) [-2242.996] (-2242.648) * [-2242.465] (-2243.302) (-2243.947) (-2248.436) -- 0:00:52 246500 -- (-2242.351) (-2242.914) (-2242.879) [-2243.296] * (-2242.465) [-2243.263] (-2242.731) (-2248.303) -- 0:00:51 247000 -- (-2244.752) (-2245.380) [-2242.763] (-2246.943) * (-2242.325) [-2244.099] (-2242.330) (-2243.407) -- 0:00:51 247500 -- [-2245.701] (-2243.383) (-2245.586) (-2242.901) * (-2243.088) [-2244.429] (-2241.856) (-2245.089) -- 0:00:51 248000 -- [-2245.481] (-2245.939) (-2245.376) (-2250.677) * (-2241.866) (-2244.195) [-2242.778] (-2243.607) -- 0:00:51 248500 -- (-2245.572) [-2245.548] (-2245.231) (-2243.861) * (-2248.682) [-2243.877] (-2242.894) (-2243.067) -- 0:00:51 249000 -- (-2248.710) (-2245.861) (-2247.559) [-2243.503] * (-2249.562) (-2242.945) [-2243.937] (-2242.908) -- 0:00:51 249500 -- (-2248.034) (-2244.916) [-2244.043] (-2243.915) * (-2248.204) [-2241.729] (-2245.782) (-2242.751) -- 0:00:51 250000 -- [-2245.063] (-2245.039) (-2242.514) (-2245.187) * (-2250.141) (-2243.026) (-2243.925) [-2242.815] -- 0:00:51 Average standard deviation of split frequencies: 0.016549 250500 -- (-2246.297) (-2247.051) (-2242.522) [-2244.309] * [-2247.958] (-2244.928) (-2241.992) (-2243.156) -- 0:00:50 251000 -- (-2247.616) [-2246.530] (-2241.970) (-2245.025) * (-2243.884) (-2246.557) (-2241.987) [-2243.244] -- 0:00:50 251500 -- (-2247.130) (-2245.818) [-2242.010] (-2248.007) * (-2245.078) (-2244.587) [-2242.126] (-2244.867) -- 0:00:50 252000 -- [-2243.874] (-2245.760) (-2242.493) (-2246.477) * (-2244.851) [-2243.258] (-2242.565) (-2244.886) -- 0:00:50 252500 -- (-2244.341) (-2248.552) [-2241.523] (-2247.016) * (-2243.461) (-2247.475) (-2242.760) [-2245.469] -- 0:00:50 253000 -- (-2244.297) (-2248.638) [-2243.540] (-2243.517) * [-2243.162] (-2243.142) (-2242.269) (-2245.469) -- 0:00:50 253500 -- (-2245.109) (-2244.822) [-2241.854] (-2245.952) * (-2244.280) (-2245.551) [-2241.949] (-2244.054) -- 0:00:50 254000 -- [-2246.479] (-2246.401) (-2244.187) (-2244.845) * (-2243.251) (-2243.279) (-2243.986) [-2242.411] -- 0:00:49 254500 -- (-2243.857) [-2243.913] (-2242.490) (-2246.334) * (-2242.951) (-2245.904) [-2242.586] (-2244.032) -- 0:00:49 255000 -- (-2244.638) (-2242.688) (-2242.476) [-2246.466] * [-2242.501] (-2246.403) (-2242.991) (-2243.615) -- 0:00:49 Average standard deviation of split frequencies: 0.016849 255500 -- [-2244.817] (-2242.441) (-2242.603) (-2246.467) * (-2242.588) (-2245.777) (-2245.097) [-2243.206] -- 0:00:49 256000 -- (-2247.226) (-2243.299) (-2242.550) [-2243.088] * [-2242.005] (-2244.473) (-2244.182) (-2242.989) -- 0:00:49 256500 -- (-2245.559) (-2243.509) (-2242.643) [-2242.236] * (-2242.964) [-2245.638] (-2242.958) (-2243.565) -- 0:00:49 257000 -- (-2243.980) (-2247.210) (-2241.647) [-2242.668] * (-2246.649) [-2244.305] (-2244.501) (-2242.413) -- 0:00:52 257500 -- (-2245.321) [-2243.038] (-2242.492) (-2243.271) * (-2243.191) [-2242.166] (-2244.253) (-2242.530) -- 0:00:51 258000 -- (-2242.907) (-2244.273) [-2242.564] (-2243.606) * (-2243.702) [-2242.124] (-2243.112) (-2242.284) -- 0:00:51 258500 -- (-2247.903) [-2243.063] (-2242.620) (-2247.447) * (-2243.755) [-2243.503] (-2245.770) (-2242.171) -- 0:00:51 259000 -- [-2244.677] (-2243.787) (-2241.955) (-2243.550) * [-2243.525] (-2244.494) (-2246.094) (-2243.123) -- 0:00:51 259500 -- (-2244.182) (-2242.412) [-2242.043] (-2243.592) * (-2244.811) (-2245.092) [-2245.147] (-2252.228) -- 0:00:51 260000 -- [-2243.532] (-2242.439) (-2242.043) (-2243.118) * (-2242.994) (-2244.729) (-2242.502) [-2243.927] -- 0:00:51 Average standard deviation of split frequencies: 0.015705 260500 -- [-2242.655] (-2242.795) (-2242.920) (-2245.450) * (-2245.979) (-2242.100) [-2241.504] (-2244.873) -- 0:00:51 261000 -- (-2243.122) [-2242.646] (-2242.524) (-2244.000) * (-2242.494) (-2242.890) (-2242.927) [-2242.991] -- 0:00:50 261500 -- (-2244.605) (-2243.561) (-2242.672) [-2243.328] * (-2243.810) (-2243.690) [-2243.817] (-2242.612) -- 0:00:50 262000 -- [-2242.257] (-2246.270) (-2241.685) (-2245.017) * [-2242.924] (-2244.548) (-2244.928) (-2243.430) -- 0:00:50 262500 -- (-2248.228) (-2246.896) [-2241.698] (-2244.168) * (-2241.980) [-2243.018] (-2242.455) (-2243.017) -- 0:00:50 263000 -- (-2244.057) (-2243.101) (-2244.524) [-2244.672] * (-2245.164) (-2242.357) [-2242.807] (-2244.971) -- 0:00:50 263500 -- (-2243.999) [-2245.594] (-2243.685) (-2242.899) * [-2246.240] (-2245.084) (-2245.059) (-2245.392) -- 0:00:50 264000 -- (-2254.676) (-2242.425) (-2242.059) [-2243.564] * (-2246.580) (-2245.281) [-2243.596] (-2243.383) -- 0:00:50 264500 -- [-2243.311] (-2242.210) (-2242.584) (-2243.897) * (-2242.079) (-2245.868) (-2243.414) [-2244.154] -- 0:00:50 265000 -- [-2244.679] (-2242.970) (-2244.876) (-2243.350) * (-2242.079) (-2244.683) [-2243.497] (-2243.629) -- 0:00:49 Average standard deviation of split frequencies: 0.015483 265500 -- (-2243.390) [-2242.143] (-2244.340) (-2244.067) * (-2244.789) (-2244.379) (-2243.490) [-2243.574] -- 0:00:49 266000 -- (-2242.783) (-2242.673) [-2242.410] (-2245.481) * (-2244.811) (-2244.947) [-2242.526] (-2245.246) -- 0:00:49 266500 -- (-2242.970) (-2243.127) (-2241.830) [-2243.815] * (-2248.402) (-2242.008) (-2243.501) [-2246.026] -- 0:00:49 267000 -- (-2242.981) (-2243.468) (-2242.317) [-2243.766] * [-2243.502] (-2243.008) (-2241.834) (-2244.251) -- 0:00:49 267500 -- [-2243.216] (-2243.300) (-2245.972) (-2247.674) * (-2241.873) [-2242.284] (-2243.880) (-2247.002) -- 0:00:49 268000 -- (-2242.770) [-2243.448] (-2244.749) (-2245.203) * (-2243.591) (-2244.426) [-2243.920] (-2245.878) -- 0:00:49 268500 -- (-2243.111) (-2244.658) [-2246.288] (-2243.981) * [-2242.707] (-2241.862) (-2244.111) (-2244.812) -- 0:00:49 269000 -- [-2243.688] (-2242.243) (-2246.289) (-2243.707) * (-2242.968) (-2244.929) [-2243.771] (-2243.757) -- 0:00:48 269500 -- (-2243.177) (-2242.243) [-2243.108] (-2243.542) * [-2243.036] (-2244.090) (-2243.331) (-2243.344) -- 0:00:48 270000 -- (-2246.439) (-2242.288) (-2245.445) [-2245.025] * [-2244.724] (-2243.284) (-2242.078) (-2242.793) -- 0:00:48 Average standard deviation of split frequencies: 0.014116 270500 -- (-2244.943) [-2243.104] (-2243.316) (-2246.105) * (-2244.995) (-2242.942) [-2242.035] (-2244.586) -- 0:00:48 271000 -- (-2243.430) [-2247.569] (-2242.454) (-2249.701) * [-2243.815] (-2243.968) (-2242.880) (-2243.223) -- 0:00:48 271500 -- (-2243.168) [-2245.928] (-2243.817) (-2244.516) * (-2242.672) (-2243.978) [-2244.415] (-2242.295) -- 0:00:50 272000 -- (-2243.647) (-2244.214) (-2247.573) [-2245.307] * (-2243.872) (-2243.517) (-2245.434) [-2242.450] -- 0:00:50 272500 -- [-2244.506] (-2243.064) (-2246.560) (-2244.373) * [-2246.103] (-2243.517) (-2244.827) (-2242.890) -- 0:00:50 273000 -- [-2245.368] (-2244.800) (-2244.257) (-2241.657) * (-2241.860) (-2241.840) [-2245.165] (-2242.576) -- 0:00:50 273500 -- [-2246.839] (-2247.774) (-2242.678) (-2243.059) * (-2241.740) [-2241.781] (-2245.894) (-2243.418) -- 0:00:50 274000 -- (-2244.896) [-2244.173] (-2242.642) (-2243.681) * (-2242.264) [-2242.745] (-2247.183) (-2244.750) -- 0:00:50 274500 -- (-2245.847) (-2244.016) [-2242.288] (-2243.456) * (-2243.503) [-2246.766] (-2243.617) (-2243.466) -- 0:00:50 275000 -- (-2244.631) (-2242.699) [-2242.521] (-2244.013) * (-2243.077) [-2247.460] (-2245.100) (-2243.134) -- 0:00:50 Average standard deviation of split frequencies: 0.013754 275500 -- [-2242.263] (-2242.563) (-2243.063) (-2247.438) * (-2242.254) (-2241.698) [-2243.610] (-2244.004) -- 0:00:49 276000 -- (-2244.619) [-2245.393] (-2243.268) (-2245.406) * (-2242.272) (-2247.565) (-2243.601) [-2246.053] -- 0:00:49 276500 -- (-2245.651) [-2242.033] (-2244.147) (-2242.488) * (-2242.882) (-2244.455) (-2245.066) [-2243.482] -- 0:00:49 277000 -- (-2243.643) (-2241.940) (-2242.207) [-2242.251] * (-2241.978) (-2245.838) (-2243.781) [-2243.394] -- 0:00:49 277500 -- (-2244.607) (-2242.244) (-2246.831) [-2242.254] * (-2241.519) (-2246.157) (-2243.908) [-2243.502] -- 0:00:49 278000 -- (-2244.658) (-2243.521) (-2247.306) [-2243.632] * (-2241.519) (-2244.876) (-2243.084) [-2244.619] -- 0:00:49 278500 -- (-2245.367) [-2242.856] (-2246.406) (-2243.834) * [-2243.362] (-2241.665) (-2245.265) (-2243.959) -- 0:00:49 279000 -- (-2247.490) (-2243.080) [-2243.878] (-2243.418) * (-2246.814) [-2242.365] (-2244.275) (-2246.810) -- 0:00:49 279500 -- (-2245.299) (-2245.845) [-2243.089] (-2241.864) * (-2247.201) (-2242.478) [-2244.042] (-2245.125) -- 0:00:48 280000 -- (-2244.318) (-2242.616) (-2245.042) [-2241.986] * (-2245.429) (-2244.639) [-2242.449] (-2246.173) -- 0:00:48 Average standard deviation of split frequencies: 0.012553 280500 -- [-2243.727] (-2242.616) (-2244.695) (-2242.932) * [-2250.522] (-2244.519) (-2243.289) (-2243.021) -- 0:00:48 281000 -- (-2242.995) (-2243.353) [-2242.973] (-2245.115) * (-2251.260) [-2242.270] (-2243.448) (-2243.965) -- 0:00:48 281500 -- [-2244.190] (-2242.886) (-2243.637) (-2244.944) * (-2246.273) (-2241.553) (-2243.179) [-2243.959] -- 0:00:48 282000 -- [-2243.382] (-2241.973) (-2243.597) (-2246.150) * (-2243.189) [-2242.549] (-2243.296) (-2246.044) -- 0:00:48 282500 -- [-2243.694] (-2242.592) (-2241.961) (-2242.771) * [-2243.633] (-2245.263) (-2244.585) (-2245.230) -- 0:00:48 283000 -- (-2242.657) (-2251.670) [-2241.922] (-2244.409) * (-2244.258) (-2245.969) [-2242.567] (-2246.737) -- 0:00:48 283500 -- [-2242.889] (-2250.246) (-2242.710) (-2243.051) * (-2246.854) (-2245.828) [-2242.854] (-2247.913) -- 0:00:48 284000 -- (-2242.765) (-2249.394) (-2241.673) [-2242.660] * (-2245.523) (-2244.027) [-2245.247] (-2245.678) -- 0:00:47 284500 -- (-2242.404) [-2241.825] (-2241.778) (-2243.245) * (-2246.822) (-2245.501) (-2243.791) [-2244.721] -- 0:00:47 285000 -- (-2243.441) (-2242.217) (-2242.311) [-2242.528] * (-2243.471) (-2243.066) [-2242.695] (-2244.765) -- 0:00:47 Average standard deviation of split frequencies: 0.011885 285500 -- [-2242.764] (-2242.303) (-2242.560) (-2241.794) * (-2245.073) (-2242.746) (-2246.495) [-2241.835] -- 0:00:47 286000 -- (-2245.477) (-2247.008) [-2242.081] (-2241.831) * [-2243.540] (-2241.931) (-2249.320) (-2242.249) -- 0:00:47 286500 -- [-2244.122] (-2244.511) (-2242.554) (-2242.887) * (-2243.925) [-2241.763] (-2246.447) (-2244.671) -- 0:00:49 287000 -- (-2247.719) (-2246.991) (-2243.348) [-2242.546] * (-2245.139) [-2242.014] (-2245.666) (-2244.145) -- 0:00:49 287500 -- (-2246.287) [-2246.688] (-2242.850) (-2241.789) * (-2247.271) [-2242.687] (-2244.567) (-2244.412) -- 0:00:49 288000 -- (-2251.575) (-2246.158) (-2242.101) [-2242.236] * [-2242.628] (-2244.269) (-2244.924) (-2244.802) -- 0:00:49 288500 -- (-2250.795) (-2246.251) [-2242.170] (-2248.267) * (-2242.795) [-2244.361] (-2245.065) (-2243.866) -- 0:00:49 289000 -- (-2244.207) (-2246.718) [-2242.211] (-2248.682) * (-2242.752) (-2246.725) [-2245.035] (-2246.808) -- 0:00:49 289500 -- (-2246.571) (-2243.876) (-2243.156) [-2242.783] * (-2243.987) (-2243.527) [-2246.483] (-2244.354) -- 0:00:49 290000 -- [-2242.341] (-2244.546) (-2243.503) (-2246.846) * (-2243.420) (-2241.793) [-2245.701] (-2255.714) -- 0:00:48 Average standard deviation of split frequencies: 0.011694 290500 -- (-2245.317) (-2243.373) (-2242.859) [-2243.843] * (-2243.900) [-2242.965] (-2245.935) (-2244.163) -- 0:00:48 291000 -- (-2243.202) (-2244.853) [-2243.883] (-2243.012) * (-2243.269) (-2243.329) [-2246.515] (-2244.575) -- 0:00:48 291500 -- (-2243.333) [-2243.700] (-2243.281) (-2244.260) * (-2242.638) (-2242.532) (-2244.347) [-2242.091] -- 0:00:48 292000 -- (-2243.451) (-2245.141) (-2243.879) [-2244.351] * (-2242.638) (-2243.843) [-2247.446] (-2245.208) -- 0:00:48 292500 -- (-2243.425) [-2242.468] (-2246.763) (-2244.195) * (-2243.549) (-2244.242) [-2245.116] (-2241.880) -- 0:00:48 293000 -- [-2242.292] (-2243.878) (-2245.417) (-2243.943) * [-2244.468] (-2243.753) (-2245.409) (-2246.637) -- 0:00:48 293500 -- (-2242.764) (-2248.173) (-2243.514) [-2245.461] * [-2242.643] (-2243.389) (-2244.170) (-2242.999) -- 0:00:48 294000 -- [-2242.257] (-2244.568) (-2245.169) (-2246.377) * (-2243.771) [-2242.049] (-2245.466) (-2242.409) -- 0:00:48 294500 -- [-2242.415] (-2243.593) (-2244.374) (-2242.311) * [-2243.040] (-2241.928) (-2245.811) (-2241.752) -- 0:00:47 295000 -- [-2242.631] (-2242.793) (-2241.817) (-2245.853) * (-2243.040) (-2243.725) (-2253.805) [-2241.750] -- 0:00:47 Average standard deviation of split frequencies: 0.011567 295500 -- (-2242.609) (-2241.984) [-2242.924] (-2246.219) * (-2247.026) (-2243.262) [-2247.363] (-2243.141) -- 0:00:47 296000 -- (-2242.274) (-2241.986) [-2243.398] (-2244.099) * (-2244.810) (-2242.583) [-2244.045] (-2242.167) -- 0:00:47 296500 -- (-2245.664) [-2242.331] (-2245.172) (-2246.141) * (-2245.160) (-2243.212) [-2242.823] (-2242.466) -- 0:00:47 297000 -- [-2244.402] (-2242.020) (-2242.745) (-2246.083) * (-2247.435) (-2241.780) [-2242.108] (-2242.466) -- 0:00:47 297500 -- (-2245.505) (-2243.688) [-2242.858] (-2243.888) * [-2242.645] (-2243.347) (-2245.884) (-2247.044) -- 0:00:47 298000 -- (-2243.889) [-2245.444] (-2243.860) (-2241.959) * (-2244.827) [-2241.959] (-2247.296) (-2243.553) -- 0:00:47 298500 -- (-2242.394) [-2243.722] (-2242.975) (-2242.451) * (-2243.340) (-2241.960) (-2245.322) [-2242.342] -- 0:00:47 299000 -- (-2243.420) [-2245.745] (-2242.664) (-2246.646) * (-2242.832) [-2243.934] (-2246.284) (-2241.764) -- 0:00:46 299500 -- [-2242.145] (-2246.813) (-2242.765) (-2245.422) * (-2244.283) (-2242.922) [-2246.246] (-2242.031) -- 0:00:46 300000 -- [-2243.225] (-2246.853) (-2243.161) (-2243.086) * (-2242.661) (-2247.778) (-2245.154) [-2242.020] -- 0:00:46 Average standard deviation of split frequencies: 0.011073 300500 -- (-2244.546) (-2248.819) [-2244.130] (-2243.066) * [-2242.862] (-2243.782) (-2243.755) (-2242.161) -- 0:00:46 301000 -- (-2245.887) (-2248.143) [-2243.337] (-2243.043) * (-2242.941) (-2245.467) [-2245.102] (-2242.441) -- 0:00:48 301500 -- (-2247.493) (-2242.518) [-2243.703] (-2244.996) * (-2242.752) [-2246.754] (-2242.883) (-2242.988) -- 0:00:48 302000 -- (-2243.981) (-2246.852) (-2243.645) [-2247.694] * (-2242.305) (-2245.826) [-2244.336] (-2241.663) -- 0:00:48 302500 -- (-2243.635) (-2243.748) [-2243.871] (-2245.113) * [-2245.157] (-2245.833) (-2244.689) (-2242.132) -- 0:00:48 303000 -- (-2243.888) (-2243.815) [-2243.732] (-2244.982) * [-2243.672] (-2245.361) (-2246.565) (-2245.692) -- 0:00:48 303500 -- (-2243.789) (-2245.401) [-2243.122] (-2242.268) * [-2244.011] (-2250.049) (-2247.607) (-2246.501) -- 0:00:48 304000 -- [-2243.135] (-2243.561) (-2243.408) (-2243.547) * [-2242.124] (-2248.986) (-2244.138) (-2248.895) -- 0:00:48 304500 -- (-2245.084) [-2243.028] (-2246.535) (-2244.276) * (-2242.223) (-2244.913) [-2242.233] (-2243.561) -- 0:00:47 305000 -- (-2242.543) (-2242.722) (-2244.428) [-2242.932] * (-2242.217) (-2246.615) [-2242.165] (-2242.250) -- 0:00:47 Average standard deviation of split frequencies: 0.010512 305500 -- (-2243.627) (-2244.545) (-2243.477) [-2243.578] * (-2242.201) (-2242.305) [-2242.497] (-2243.645) -- 0:00:47 306000 -- (-2242.039) [-2245.025] (-2244.313) (-2243.577) * [-2244.206] (-2243.721) (-2244.242) (-2243.340) -- 0:00:47 306500 -- (-2242.040) (-2244.952) [-2244.223] (-2245.858) * (-2243.787) [-2244.562] (-2246.675) (-2244.054) -- 0:00:47 307000 -- (-2243.960) (-2244.446) (-2245.958) [-2244.680] * [-2243.736] (-2244.267) (-2242.273) (-2244.037) -- 0:00:47 307500 -- (-2242.419) [-2244.104] (-2245.620) (-2246.709) * (-2245.370) [-2243.899] (-2242.438) (-2244.037) -- 0:00:47 308000 -- [-2243.620] (-2245.538) (-2245.606) (-2245.464) * (-2245.158) (-2246.257) (-2242.446) [-2244.911] -- 0:00:47 308500 -- (-2243.621) (-2246.918) (-2245.586) [-2248.476] * (-2246.825) [-2246.224] (-2244.154) (-2244.609) -- 0:00:47 309000 -- (-2241.712) (-2245.637) [-2243.514] (-2248.044) * (-2243.403) [-2244.799] (-2244.484) (-2243.499) -- 0:00:46 309500 -- [-2241.778] (-2245.739) (-2243.663) (-2243.032) * (-2243.607) (-2243.330) (-2244.683) [-2242.444] -- 0:00:46 310000 -- (-2241.779) (-2243.266) (-2243.227) [-2243.570] * [-2244.237] (-2244.103) (-2245.744) (-2242.358) -- 0:00:46 Average standard deviation of split frequencies: 0.010533 310500 -- (-2241.941) (-2243.070) (-2242.632) [-2243.568] * [-2242.954] (-2243.419) (-2252.686) (-2243.030) -- 0:00:46 311000 -- (-2242.927) [-2243.464] (-2243.186) (-2243.852) * [-2242.299] (-2242.155) (-2248.794) (-2245.299) -- 0:00:46 311500 -- (-2243.680) (-2242.313) (-2243.296) [-2247.581] * (-2242.405) (-2242.235) (-2246.491) [-2244.983] -- 0:00:46 312000 -- (-2242.565) (-2245.317) [-2242.843] (-2243.670) * (-2244.028) (-2242.422) [-2244.777] (-2245.846) -- 0:00:46 312500 -- (-2241.622) (-2243.270) [-2242.914] (-2245.094) * (-2243.575) (-2241.588) (-2244.821) [-2245.192] -- 0:00:46 313000 -- (-2244.715) (-2243.584) [-2242.665] (-2248.510) * (-2248.595) (-2242.465) (-2244.190) [-2245.084] -- 0:00:46 313500 -- (-2246.134) [-2243.282] (-2243.442) (-2243.520) * (-2245.970) [-2243.450] (-2242.935) (-2244.222) -- 0:00:45 314000 -- [-2244.457] (-2244.719) (-2245.060) (-2242.081) * (-2247.989) (-2243.862) (-2242.919) [-2244.665] -- 0:00:45 314500 -- (-2245.734) [-2244.024] (-2244.542) (-2243.471) * (-2245.249) [-2242.617] (-2243.803) (-2245.582) -- 0:00:45 315000 -- (-2245.682) [-2243.673] (-2244.939) (-2242.538) * (-2245.081) (-2244.293) (-2247.215) [-2241.699] -- 0:00:45 Average standard deviation of split frequencies: 0.010530 315500 -- (-2243.619) [-2242.581] (-2244.614) (-2243.493) * [-2242.893] (-2250.921) (-2243.619) (-2242.274) -- 0:00:47 316000 -- (-2244.974) (-2243.829) [-2243.648] (-2246.400) * (-2243.302) [-2242.593] (-2246.665) (-2241.985) -- 0:00:47 316500 -- (-2247.346) [-2242.147] (-2243.002) (-2243.803) * (-2251.936) (-2243.380) (-2256.839) [-2242.982] -- 0:00:47 317000 -- (-2245.308) (-2244.338) [-2242.816] (-2245.805) * (-2246.385) [-2242.127] (-2245.168) (-2243.165) -- 0:00:47 317500 -- (-2246.002) (-2245.434) [-2243.356] (-2245.356) * (-2247.540) [-2241.974] (-2245.210) (-2244.204) -- 0:00:47 318000 -- [-2242.729] (-2243.464) (-2242.924) (-2245.932) * (-2248.073) (-2244.925) (-2243.886) [-2243.439] -- 0:00:47 318500 -- (-2246.887) (-2243.808) (-2243.221) [-2245.931] * (-2249.122) [-2244.893] (-2245.720) (-2243.276) -- 0:00:47 319000 -- (-2243.115) (-2243.844) (-2243.800) [-2242.924] * (-2245.913) (-2245.052) (-2247.549) [-2244.266] -- 0:00:46 319500 -- (-2246.244) [-2242.464] (-2243.631) (-2246.116) * [-2244.654] (-2245.049) (-2244.819) (-2245.659) -- 0:00:46 320000 -- (-2246.797) (-2243.540) (-2243.580) [-2244.028] * (-2245.026) (-2251.094) (-2244.763) [-2245.293] -- 0:00:46 Average standard deviation of split frequencies: 0.011761 320500 -- (-2244.686) (-2244.208) (-2244.424) [-2245.277] * (-2244.645) (-2246.432) [-2246.296] (-2245.067) -- 0:00:46 321000 -- (-2245.452) [-2242.900] (-2244.094) (-2247.643) * (-2242.786) (-2252.348) [-2246.447] (-2245.067) -- 0:00:46 321500 -- (-2245.577) [-2245.101] (-2243.395) (-2246.592) * (-2245.452) (-2241.507) (-2246.727) [-2243.443] -- 0:00:46 322000 -- (-2242.140) [-2242.575] (-2244.563) (-2245.954) * (-2246.661) (-2244.216) (-2246.129) [-2243.572] -- 0:00:46 322500 -- [-2243.942] (-2242.376) (-2245.222) (-2245.542) * [-2242.299] (-2242.398) (-2245.053) (-2243.592) -- 0:00:46 323000 -- (-2245.383) [-2242.149] (-2244.893) (-2246.399) * [-2244.581] (-2243.730) (-2243.058) (-2243.356) -- 0:00:46 323500 -- [-2245.506] (-2242.167) (-2243.838) (-2244.322) * (-2246.337) [-2242.158] (-2243.694) (-2243.703) -- 0:00:46 324000 -- (-2247.477) (-2242.253) (-2244.072) [-2243.484] * [-2243.070] (-2242.816) (-2244.717) (-2245.543) -- 0:00:45 324500 -- (-2244.390) (-2242.714) [-2245.135] (-2243.771) * (-2243.468) [-2243.859] (-2244.229) (-2243.806) -- 0:00:45 325000 -- (-2245.927) [-2244.030] (-2243.188) (-2242.792) * (-2243.868) (-2242.748) (-2246.689) [-2243.560] -- 0:00:45 Average standard deviation of split frequencies: 0.010888 325500 -- (-2246.725) (-2247.639) [-2242.062] (-2243.505) * [-2242.884] (-2243.614) (-2246.056) (-2249.190) -- 0:00:45 326000 -- (-2244.908) [-2244.384] (-2245.263) (-2244.692) * (-2244.561) [-2243.373] (-2245.202) (-2249.784) -- 0:00:45 326500 -- [-2242.858] (-2242.977) (-2246.059) (-2242.510) * (-2245.578) (-2243.696) (-2245.181) [-2247.717] -- 0:00:45 327000 -- [-2243.467] (-2243.112) (-2245.703) (-2246.480) * [-2246.329] (-2242.842) (-2245.142) (-2248.205) -- 0:00:45 327500 -- (-2245.058) (-2243.027) [-2243.944] (-2248.514) * (-2243.444) (-2245.565) (-2242.835) [-2245.606] -- 0:00:45 328000 -- [-2243.601] (-2242.706) (-2246.099) (-2249.836) * [-2243.997] (-2247.278) (-2242.601) (-2245.145) -- 0:00:45 328500 -- [-2241.841] (-2242.666) (-2246.153) (-2247.124) * (-2245.299) (-2246.736) [-2242.099] (-2244.109) -- 0:00:44 329000 -- (-2242.419) [-2241.867] (-2247.943) (-2247.177) * (-2245.090) (-2246.608) (-2244.241) [-2243.105] -- 0:00:44 329500 -- (-2243.032) [-2244.479] (-2247.868) (-2246.377) * (-2243.279) (-2247.143) [-2242.671] (-2246.769) -- 0:00:44 330000 -- (-2241.742) (-2244.959) [-2247.534] (-2246.676) * [-2242.725] (-2256.496) (-2243.095) (-2245.502)