--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 09:12:20 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/acn/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/1res/acn/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/acn/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/1res/acn/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -3890.35         -3893.90
2      -3890.40         -3893.32
--------------------------------------
TOTAL    -3890.38         -3893.65
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/1res/acn/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/acn/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/acn/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.908209    0.094962    0.341975    1.508191    0.877929   1342.81   1394.13    1.000
r(A<->C){all}   0.172096    0.020795    0.000102    0.457929    0.135538    218.34    287.27    1.002
r(A<->G){all}   0.169629    0.019688    0.000051    0.451838    0.134647    221.20    325.22    1.004
r(A<->T){all}   0.164344    0.018225    0.000127    0.433107    0.130932    202.33    231.74    1.000
r(C<->G){all}   0.172967    0.019590    0.000086    0.446562    0.140795    225.64    317.04    1.000
r(C<->T){all}   0.167955    0.020124    0.000157    0.449460    0.129769    207.45    210.12    1.000
r(G<->T){all}   0.153008    0.017094    0.000472    0.415862    0.116485    347.43    364.41    1.000
pi(A){all}      0.240526    0.000064    0.224054    0.256112    0.240267   1165.84   1197.51    1.000
pi(C){all}      0.290839    0.000077    0.274940    0.309029    0.290685    944.92   1168.41    1.000
pi(G){all}      0.279741    0.000076    0.262904    0.296507    0.279578   1076.22   1209.82    1.002
pi(T){all}      0.188894    0.000055    0.174888    0.203881    0.188896   1294.31   1397.66    1.001
alpha{1,2}      0.437720    0.234171    0.000192    1.416090    0.269598   1012.01   1027.55    1.000
alpha{3}        0.485711    0.267072    0.000124    1.485366    0.318777   1084.97   1240.01    1.000
pinvar{all}     0.999485    0.000000    0.998344    1.000000    0.999674    852.33    885.52    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-3726.366754
Model 2: PositiveSelection	-3726.366754
Model 0: one-ratio	-3726.366755
Model 7: beta	-3726.366754
Model 8: beta&w>1	-3726.367483


Model 0 vs 1	1.99999976757681E-6

Model 2 vs 1	0.0

Model 8 vs 7	0.001457999999729509
>C1
VISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN
>C2
VISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN
>C3
VISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN
>C4
VISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN
>C5
ISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLLR
NEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDLA
TMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEYQ
RNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQGT
VVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWVV
GFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLANR
ATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGMW
HDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPKY
VDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGRV
SNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAVE
KGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCIG
NSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLVI
AYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQEM
FTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPKP
VRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYNS
FGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYDA
AQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIHR
SNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHVK
ASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSNo
>C6
ISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLLR
NEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDLA
TMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEYQ
RNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQGT
VVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWVV
GFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLANR
ATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGMW
HDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPKY
VDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGRV
SNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAVE
KGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCIG
NSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLVI
AYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQEM
FTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPKP
VRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYNS
FGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYDA
AQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIHR
SNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHVK
ASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSNo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=945 

C1              VISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
C2              VISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
C3              VISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
C4              VISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
C5              -ISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
C6              -ISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
                 *************************************************

C1              RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
C2              RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
C3              RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
C4              RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
C5              RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
C6              RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
                **************************************************

C1              ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
C2              ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
C3              ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
C4              ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
C5              ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
C6              ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
                **************************************************

C1              QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
C2              QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
C3              QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
C4              QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
C5              QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
C6              QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
                **************************************************

C1              TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
C2              TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
C3              TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
C4              TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
C5              TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
C6              TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
                **************************************************

C1              VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
C2              VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
C3              VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
C4              VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
C5              VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
C6              VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
                **************************************************

C1              RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
C2              RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
C3              RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
C4              RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
C5              RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
C6              RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
                **************************************************

C1              WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
C2              WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
C3              WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
C4              WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
C5              WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
C6              WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
                **************************************************

C1              YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
C2              YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
C3              YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
C4              YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
C5              YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
C6              YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
                **************************************************

C1              VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
C2              VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
C3              VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
C4              VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
C5              VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
C6              VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
                **************************************************

C1              EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
C2              EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
C3              EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
C4              EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
C5              EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
C6              EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
                **************************************************

C1              GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
C2              GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
C3              GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
C4              GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
C5              GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
C6              GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
                **************************************************

C1              IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
C2              IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
C3              IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
C4              IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
C5              IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
C6              IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
                **************************************************

C1              MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
C2              MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
C3              MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
C4              MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
C5              MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
C6              MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
                **************************************************

C1              PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
C2              PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
C3              PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
C4              PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
C5              PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
C6              PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
                **************************************************

C1              SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
C2              SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
C3              SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
C4              SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
C5              SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
C6              SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
                **************************************************

C1              AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
C2              AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
C3              AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
C4              AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
C5              AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
C6              AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
                **************************************************

C1              RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
C2              RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
C3              RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
C4              RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
C5              RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
C6              RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
                **************************************************

C1              KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN-
C2              KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN-
C3              KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN-
C4              KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN-
C5              KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSNo
C6              KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSNo
                ******************************************** 




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  944 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  944 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28400]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [28400]--->[28400]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.678 Mb, Max= 31.686 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              ISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLLR
C2              ISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLLR
C3              ISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLLR
C4              ISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLLR
C5              ISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLLR
C6              ISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLLR
                **************************************************

C1              NEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDLA
C2              NEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDLA
C3              NEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDLA
C4              NEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDLA
C5              NEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDLA
C6              NEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDLA
                **************************************************

C1              TMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEYQ
C2              TMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEYQ
C3              TMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEYQ
C4              TMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEYQ
C5              TMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEYQ
C6              TMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEYQ
                **************************************************

C1              RNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQGT
C2              RNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQGT
C3              RNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQGT
C4              RNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQGT
C5              RNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQGT
C6              RNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQGT
                **************************************************

C1              VVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWVV
C2              VVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWVV
C3              VVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWVV
C4              VVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWVV
C5              VVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWVV
C6              VVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWVV
                **************************************************

C1              GFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLANR
C2              GFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLANR
C3              GFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLANR
C4              GFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLANR
C5              GFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLANR
C6              GFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLANR
                **************************************************

C1              ATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGMW
C2              ATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGMW
C3              ATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGMW
C4              ATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGMW
C5              ATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGMW
C6              ATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGMW
                **************************************************

C1              HDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPKY
C2              HDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPKY
C3              HDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPKY
C4              HDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPKY
C5              HDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPKY
C6              HDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPKY
                **************************************************

C1              VDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGRV
C2              VDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGRV
C3              VDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGRV
C4              VDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGRV
C5              VDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGRV
C6              VDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGRV
                **************************************************

C1              SNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAVE
C2              SNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAVE
C3              SNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAVE
C4              SNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAVE
C5              SNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAVE
C6              SNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAVE
                **************************************************

C1              KGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCIG
C2              KGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCIG
C3              KGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCIG
C4              KGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCIG
C5              KGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCIG
C6              KGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCIG
                **************************************************

C1              NSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLVI
C2              NSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLVI
C3              NSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLVI
C4              NSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLVI
C5              NSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLVI
C6              NSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLVI
                **************************************************

C1              AYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQEM
C2              AYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQEM
C3              AYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQEM
C4              AYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQEM
C5              AYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQEM
C6              AYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQEM
                **************************************************

C1              FTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPKP
C2              FTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPKP
C3              FTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPKP
C4              FTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPKP
C5              FTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPKP
C6              FTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPKP
                **************************************************

C1              VRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYNS
C2              VRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYNS
C3              VRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYNS
C4              VRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYNS
C5              VRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYNS
C6              VRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYNS
                **************************************************

C1              FGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYDA
C2              FGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYDA
C3              FGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYDA
C4              FGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYDA
C5              FGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYDA
C6              FGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYDA
                **************************************************

C1              AQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIHR
C2              AQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIHR
C3              AQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIHR
C4              AQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIHR
C5              AQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIHR
C6              AQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIHR
                **************************************************

C1              SNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHVK
C2              SNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHVK
C3              SNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHVK
C4              SNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHVK
C5              SNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHVK
C6              SNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHVK
                **************************************************

C1              ASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN
C2              ASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN
C3              ASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN
C4              ASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN
C5              ASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN
C6              ASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN
                *******************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGATAAGTAGCAAAGATTCGGTGAACTCGTTTTCAGCCCGCGACACCCT
C2              GTGATAAGTAGCAAAGATTCGGTGAACTCGTTTTCAGCCCGCGACACCCT
C3              GTGATAAGTAGCAAAGATTCGGTGAACTCGTTTTCAGCCCGCGACACCCT
C4              GTGATAAGTAGCAAAGATTCGGTGAACTCGTTTTCAGCCCGCGACACCCT
C5              ---ATAAGTAGCAAAGATTCGGTGAACTCGTTTTCAGCCCGCGACACCCT
C6              ---ATAAGTAGCAAAGATTCGGTGAACTCGTTTTCAGCCCGCGACACCCT
                   ***********************************************

C1              GAAAATCGGCGACAACAGTTACCAAATCTATCGTCTGGACGCCGTCTCCA
C2              GAAAATCGGCGACAACAGTTACCAAATCTATCGTCTGGACGCCGTCTCCA
C3              GAAAATCGGCGACAACAGTTACCAAATCTATCGTCTGGACGCCGTCTCCA
C4              GAAAATCGGCGACAACAGTTACCAAATCTATCGTCTGGACGCCGTCTCCA
C5              GAAAATCGGCGACAACAGTTACCAAATCTATCGTCTGGACGCCGTCTCCA
C6              GAAAATCGGCGACAACAGTTACCAAATCTATCGTCTGGACGCCGTCTCCA
                **************************************************

C1              ATACCAAGAGACTTCCATACAGTCTCAAAGTACTCGCCGAAAACCTACTA
C2              ATACCAAGAGACTTCCATACAGTCTCAAAGTACTCGCCGAAAACCTACTA
C3              ATACCAAGAGACTTCCATACAGTCTCAAAGTACTCGCCGAAAACCTACTA
C4              ATACCAAGAGACTTCCATACAGTCTCAAAGTACTCGCCGAAAACCTACTA
C5              ATACCAAGAGACTTCCATACAGTCTCAAAGTACTCGCCGAAAACCTACTA
C6              ATACCAAGAGACTTCCATACAGTCTCAAAGTACTCGCCGAAAACCTACTA
                **************************************************

C1              CGCAACGAAGACGGCAAGAATATCACCAAAGATCACATCGAAGCGATAGC
C2              CGCAACGAAGACGGCAAGAATATCACCAAAGATCACATCGAAGCGATAGC
C3              CGCAACGAAGACGGCAAGAATATCACCAAAGATCACATCGAAGCGATAGC
C4              CGCAACGAAGACGGCAAGAATATCACCAAAGATCACATCGAAGCGATAGC
C5              CGCAACGAAGACGGCAAGAATATCACCAAAGATCACATCGAAGCGATAGC
C6              CGCAACGAAGACGGCAAGAATATCACCAAAGATCACATCGAAGCGATAGC
                **************************************************

C1              AAACTGGGATAGGCAGGCGGAACCCAGCATCGAAATCCAGTACACGCCGG
C2              AAACTGGGATAGGCAGGCGGAACCCAGCATCGAAATCCAGTACACGCCGG
C3              AAACTGGGATAGGCAGGCGGAACCCAGCATCGAAATCCAGTACACGCCGG
C4              AAACTGGGATAGGCAGGCGGAACCCAGCATCGAAATCCAGTACACGCCGG
C5              AAACTGGGATAGGCAGGCGGAACCCAGCATCGAAATCCAGTACACGCCGG
C6              AAACTGGGATAGGCAGGCGGAACCCAGCATCGAAATCCAGTACACGCCGG
                **************************************************

C1              CCCGTATCGTCATGCAGGACTTCACAGGCGTGCCGTGTATCGTCGACTTG
C2              CCCGTATCGTCATGCAGGACTTCACAGGCGTGCCGTGTATCGTCGACTTG
C3              CCCGTATCGTCATGCAGGACTTCACAGGCGTGCCGTGTATCGTCGACTTG
C4              CCCGTATCGTCATGCAGGACTTCACAGGCGTGCCGTGTATCGTCGACTTG
C5              CCCGTATCGTCATGCAGGACTTCACAGGCGTGCCGTGTATCGTCGACTTG
C6              CCCGTATCGTCATGCAGGACTTCACAGGCGTGCCGTGTATCGTCGACTTG
                **************************************************

C1              GCCACCATGCGGGAGGCCATCGGGGATCTCGGCGGCAACCCGGAAAAAGT
C2              GCCACCATGCGGGAGGCCATCGGGGATCTCGGCGGCAACCCGGAAAAAGT
C3              GCCACCATGCGGGAGGCCATCGGGGATCTCGGCGGCAACCCGGAAAAAGT
C4              GCCACCATGCGGGAGGCCATCGGGGATCTCGGCGGCAACCCGGAAAAAGT
C5              GCCACCATGCGGGAGGCCATCGGGGATCTCGGCGGCAACCCGGAAAAAGT
C6              GCCACCATGCGGGAGGCCATCGGGGATCTCGGCGGCAACCCGGAAAAAGT
                **************************************************

C1              CAACCCACTGGCGCGGGTTGACTTGGTGATTGACCACTCAGTGATCGCCG
C2              CAACCCACTGGCGCGGGTTGACTTGGTGATTGACCACTCAGTGATCGCCG
C3              CAACCCACTGGCGCGGGTTGACTTGGTGATTGACCACTCAGTGATCGCCG
C4              CAACCCACTGGCGCGGGTTGACTTGGTGATTGACCACTCAGTGATCGCCG
C5              CAACCCACTGGCGCGGGTTGACTTGGTGATTGACCACTCAGTGATCGCCG
C6              CAACCCACTGGCGCGGGTTGACTTGGTGATTGACCACTCAGTGATCGCCG
                **************************************************

C1              ATCTGTTTGGCCGCGCCGACGCGTTCGAGCGCAATGTTGAAATCGAGTAC
C2              ATCTGTTTGGCCGCGCCGACGCGTTCGAGCGCAATGTTGAAATCGAGTAC
C3              ATCTGTTTGGCCGCGCCGACGCGTTCGAGCGCAATGTTGAAATCGAGTAC
C4              ATCTGTTTGGCCGCGCCGACGCGTTCGAGCGCAATGTTGAAATCGAGTAC
C5              ATCTGTTTGGCCGCGCCGACGCGTTCGAGCGCAATGTTGAAATCGAGTAC
C6              ATCTGTTTGGCCGCGCCGACGCGTTCGAGCGCAATGTTGAAATCGAGTAC
                **************************************************

C1              CAGCGCAACGGCGAGCGTTATCAGTTCCTGCGCTGGGGACAAGGAGCGTT
C2              CAGCGCAACGGCGAGCGTTATCAGTTCCTGCGCTGGGGACAAGGAGCGTT
C3              CAGCGCAACGGCGAGCGTTATCAGTTCCTGCGCTGGGGACAAGGAGCGTT
C4              CAGCGCAACGGCGAGCGTTATCAGTTCCTGCGCTGGGGACAAGGAGCGTT
C5              CAGCGCAACGGCGAGCGTTATCAGTTCCTGCGCTGGGGACAAGGAGCGTT
C6              CAGCGCAACGGCGAGCGTTATCAGTTCCTGCGCTGGGGACAAGGAGCGTT
                **************************************************

C1              CAACGACTTCAAGGTGGTACCACCGGGCACCGGCATTGTGCACCAGGTAA
C2              CAACGACTTCAAGGTGGTACCACCGGGCACCGGCATTGTGCACCAGGTAA
C3              CAACGACTTCAAGGTGGTACCACCGGGCACCGGCATTGTGCACCAGGTAA
C4              CAACGACTTCAAGGTGGTACCACCGGGCACCGGCATTGTGCACCAGGTAA
C5              CAACGACTTCAAGGTGGTACCACCGGGCACCGGCATTGTGCACCAGGTAA
C6              CAACGACTTCAAGGTGGTACCACCGGGCACCGGCATTGTGCACCAGGTAA
                **************************************************

C1              ACATCGAATATCTGGCTAGTGTCGTGATGACTCAGGAGAATACCCAAGGA
C2              ACATCGAATATCTGGCTAGTGTCGTGATGACTCAGGAGAATACCCAAGGA
C3              ACATCGAATATCTGGCTAGTGTCGTGATGACTCAGGAGAATACCCAAGGA
C4              ACATCGAATATCTGGCTAGTGTCGTGATGACTCAGGAGAATACCCAAGGA
C5              ACATCGAATATCTGGCTAGTGTCGTGATGACTCAGGAGAATACCCAAGGA
C6              ACATCGAATATCTGGCTAGTGTCGTGATGACTCAGGAGAATACCCAAGGA
                **************************************************

C1              ACAGTAGTGGCATACCCCGACACCTGCGTAGGCACCGACTCGCACACCAC
C2              ACAGTAGTGGCATACCCCGACACCTGCGTAGGCACCGACTCGCACACCAC
C3              ACAGTAGTGGCATACCCCGACACCTGCGTAGGCACCGACTCGCACACCAC
C4              ACAGTAGTGGCATACCCCGACACCTGCGTAGGCACCGACTCGCACACCAC
C5              ACAGTAGTGGCATACCCCGACACCTGCGTAGGCACCGACTCGCACACCAC
C6              ACAGTAGTGGCATACCCCGACACCTGCGTAGGCACCGACTCGCACACCAC
                **************************************************

C1              GATGGTCAACGGGCTCGGCGTCCTAGGCTGGGGCGTAGGTGGCATCGAAG
C2              GATGGTCAACGGGCTCGGCGTCCTAGGCTGGGGCGTAGGTGGCATCGAAG
C3              GATGGTCAACGGGCTCGGCGTCCTAGGCTGGGGCGTAGGTGGCATCGAAG
C4              GATGGTCAACGGGCTCGGCGTCCTAGGCTGGGGCGTAGGTGGCATCGAAG
C5              GATGGTCAACGGGCTCGGCGTCCTAGGCTGGGGCGTAGGTGGCATCGAAG
C6              GATGGTCAACGGGCTCGGCGTCCTAGGCTGGGGCGTAGGTGGCATCGAAG
                **************************************************

C1              CTGAGGCCGCCATGTTGGGCCAGCCGGTGTCGATGCTGATCCCGTGGGTG
C2              CTGAGGCCGCCATGTTGGGCCAGCCGGTGTCGATGCTGATCCCGTGGGTG
C3              CTGAGGCCGCCATGTTGGGCCAGCCGGTGTCGATGCTGATCCCGTGGGTG
C4              CTGAGGCCGCCATGTTGGGCCAGCCGGTGTCGATGCTGATCCCGTGGGTG
C5              CTGAGGCCGCCATGTTGGGCCAGCCGGTGTCGATGCTGATCCCGTGGGTG
C6              CTGAGGCCGCCATGTTGGGCCAGCCGGTGTCGATGCTGATCCCGTGGGTG
                **************************************************

C1              GTCGGCTTCAAGCTGAGTGGTGAGATTCAGCCAGGTGTTACAGCCACCGA
C2              GTCGGCTTCAAGCTGAGTGGTGAGATTCAGCCAGGTGTTACAGCCACCGA
C3              GTCGGCTTCAAGCTGAGTGGTGAGATTCAGCCAGGTGTTACAGCCACCGA
C4              GTCGGCTTCAAGCTGAGTGGTGAGATTCAGCCAGGTGTTACAGCCACCGA
C5              GTCGGCTTCAAGCTGAGTGGTGAGATTCAGCCAGGTGTTACAGCCACCGA
C6              GTCGGCTTCAAGCTGAGTGGTGAGATTCAGCCAGGTGTTACAGCCACCGA
                **************************************************

C1              CGTCGTACTGACTGTCACCGAAATGTTGCGCAGGCACGGTGTTGTTGGCA
C2              CGTCGTACTGACTGTCACCGAAATGTTGCGCAGGCACGGTGTTGTTGGCA
C3              CGTCGTACTGACTGTCACCGAAATGTTGCGCAGGCACGGTGTTGTTGGCA
C4              CGTCGTACTGACTGTCACCGAAATGTTGCGCAGGCACGGTGTTGTTGGCA
C5              CGTCGTACTGACTGTCACCGAAATGTTGCGCAGGCACGGTGTTGTTGGCA
C6              CGTCGTACTGACTGTCACCGAAATGTTGCGCAGGCACGGTGTTGTTGGCA
                **************************************************

C1              AGTTCGTCGAGTTCTACGGCGAGGGCGTGGCCGAGGTACCGCTGGCCAAT
C2              AGTTCGTCGAGTTCTACGGCGAGGGCGTGGCCGAGGTACCGCTGGCCAAT
C3              AGTTCGTCGAGTTCTACGGCGAGGGCGTGGCCGAGGTACCGCTGGCCAAT
C4              AGTTCGTCGAGTTCTACGGCGAGGGCGTGGCCGAGGTACCGCTGGCCAAT
C5              AGTTCGTCGAGTTCTACGGCGAGGGCGTGGCCGAGGTACCGCTGGCCAAT
C6              AGTTCGTCGAGTTCTACGGCGAGGGCGTGGCCGAGGTACCGCTGGCCAAT
                **************************************************

C1              CGCGCCACTCTGGGCAATATGAGCCCTGAATTCGGTTCCACTGCAGCAAT
C2              CGCGCCACTCTGGGCAATATGAGCCCTGAATTCGGTTCCACTGCAGCAAT
C3              CGCGCCACTCTGGGCAATATGAGCCCTGAATTCGGTTCCACTGCAGCAAT
C4              CGCGCCACTCTGGGCAATATGAGCCCTGAATTCGGTTCCACTGCAGCAAT
C5              CGCGCCACTCTGGGCAATATGAGCCCTGAATTCGGTTCCACTGCAGCAAT
C6              CGCGCCACTCTGGGCAATATGAGCCCTGAATTCGGTTCCACTGCAGCAAT
                **************************************************

C1              TTTTCCGATCGACGAAGAGACGATTAACTACCTGCGGTTCACCGGGCGCA
C2              TTTTCCGATCGACGAAGAGACGATTAACTACCTGCGGTTCACCGGGCGCA
C3              TTTTCCGATCGACGAAGAGACGATTAACTACCTGCGGTTCACCGGGCGCA
C4              TTTTCCGATCGACGAAGAGACGATTAACTACCTGCGGTTCACCGGGCGCA
C5              TTTTCCGATCGACGAAGAGACGATTAACTACCTGCGGTTCACCGGGCGCA
C6              TTTTCCGATCGACGAAGAGACGATTAACTACCTGCGGTTCACCGGGCGCA
                **************************************************

C1              CGCCTGAGCAAGTTGCCCTGGTCGAGGGTTACGCCAAAGAGCAAGGCATG
C2              CGCCTGAGCAAGTTGCCCTGGTCGAGGGTTACGCCAAAGAGCAAGGCATG
C3              CGCCTGAGCAAGTTGCCCTGGTCGAGGGTTACGCCAAAGAGCAAGGCATG
C4              CGCCTGAGCAAGTTGCCCTGGTCGAGGGTTACGCCAAAGAGCAAGGCATG
C5              CGCCTGAGCAAGTTGCCCTGGTCGAGGGTTACGCCAAAGAGCAAGGCATG
C6              CGCCTGAGCAAGTTGCCCTGGTCGAGGGTTACGCCAAAGAGCAAGGCATG
                **************************************************

C1              TGGCACGACCCCAAGAATGAGCCGACGTTCTCCGAATACCTCGAACTAAA
C2              TGGCACGACCCCAAGAATGAGCCGACGTTCTCCGAATACCTCGAACTAAA
C3              TGGCACGACCCCAAGAATGAGCCGACGTTCTCCGAATACCTCGAACTAAA
C4              TGGCACGACCCCAAGAATGAGCCGACGTTCTCCGAATACCTCGAACTAAA
C5              TGGCACGACCCCAAGAATGAGCCGACGTTCTCCGAATACCTCGAACTAAA
C6              TGGCACGACCCCAAGAATGAGCCGACGTTCTCCGAATACCTCGAACTAAA
                **************************************************

C1              CCTCTCCGATGTGGTACCGTCGATCTCCGGACCGAAACGTCCGCAGGACC
C2              CCTCTCCGATGTGGTACCGTCGATCTCCGGACCGAAACGTCCGCAGGACC
C3              CCTCTCCGATGTGGTACCGTCGATCTCCGGACCGAAACGTCCGCAGGACC
C4              CCTCTCCGATGTGGTACCGTCGATCTCCGGACCGAAACGTCCGCAGGACC
C5              CCTCTCCGATGTGGTACCGTCGATCTCCGGACCGAAACGTCCGCAGGACC
C6              CCTCTCCGATGTGGTACCGTCGATCTCCGGACCGAAACGTCCGCAGGACC
                **************************************************

C1              GAATCTGCTTGGCGCAAGCCAAGTCCACGTTCCGCGCGCAAATTCCTAAG
C2              GAATCTGCTTGGCGCAAGCCAAGTCCACGTTCCGCGCGCAAATTCCTAAG
C3              GAATCTGCTTGGCGCAAGCCAAGTCCACGTTCCGCGCGCAAATTCCTAAG
C4              GAATCTGCTTGGCGCAAGCCAAGTCCACGTTCCGCGCGCAAATTCCTAAG
C5              GAATCTGCTTGGCGCAAGCCAAGTCCACGTTCCGCGCGCAAATTCCTAAG
C6              GAATCTGCTTGGCGCAAGCCAAGTCCACGTTCCGCGCGCAAATTCCTAAG
                **************************************************

C1              TATGTTGACGGCAGTTCGCTCCACAACCAACATTCGAAGTTGGACGAGGT
C2              TATGTTGACGGCAGTTCGCTCCACAACCAACATTCGAAGTTGGACGAGGT
C3              TATGTTGACGGCAGTTCGCTCCACAACCAACATTCGAAGTTGGACGAGGT
C4              TATGTTGACGGCAGTTCGCTCCACAACCAACATTCGAAGTTGGACGAGGT
C5              TATGTTGACGGCAGTTCGCTCCACAACCAACATTCGAAGTTGGACGAGGT
C6              TATGTTGACGGCAGTTCGCTCCACAACCAACATTCGAAGTTGGACGAGGT
                **************************************************

C1              AGTCGAGGAGACATGCCCAGCCAGCGACCCGGGGAAGCTGTCGTTCACCA
C2              AGTCGAGGAGACATGCCCAGCCAGCGACCCGGGGAAGCTGTCGTTCACCA
C3              AGTCGAGGAGACATGCCCAGCCAGCGACCCGGGGAAGCTGTCGTTCACCA
C4              AGTCGAGGAGACATGCCCAGCCAGCGACCCGGGGAAGCTGTCGTTCACCA
C5              AGTCGAGGAGACATGCCCAGCCAGCGACCCGGGGAAGCTGTCGTTCACCA
C6              AGTCGAGGAGACATGCCCAGCCAGCGACCCGGGGAAGCTGTCGTTCACCA
                **************************************************

C1              ACAACGATGAGGTGGTAATGCAATCTGCGGCCGCGCATGCGAACGGCCGA
C2              ACAACGATGAGGTGGTAATGCAATCTGCGGCCGCGCATGCGAACGGCCGA
C3              ACAACGATGAGGTGGTAATGCAATCTGCGGCCGCGCATGCGAACGGCCGA
C4              ACAACGATGAGGTGGTAATGCAATCTGCGGCCGCGCATGCGAACGGCCGA
C5              ACAACGATGAGGTGGTAATGCAATCTGCGGCCGCGCATGCGAACGGCCGA
C6              ACAACGATGAGGTGGTAATGCAATCTGCGGCCGCGCATGCGAACGGCCGA
                **************************************************

C1              GTAAGCAACCCGGTGCGCATCAAGACGCAAGAACTCGGTGAGTTCGTGCT
C2              GTAAGCAACCCGGTGCGCATCAAGACGCAAGAACTCGGTGAGTTCGTGCT
C3              GTAAGCAACCCGGTGCGCATCAAGACGCAAGAACTCGGTGAGTTCGTGCT
C4              GTAAGCAACCCGGTGCGCATCAAGACGCAAGAACTCGGTGAGTTCGTGCT
C5              GTAAGCAACCCGGTGCGCATCAAGACGCAAGAACTCGGTGAGTTCGTGCT
C6              GTAAGCAACCCGGTGCGCATCAAGACGCAAGAACTCGGTGAGTTCGTGCT
                **************************************************

C1              CGACCACGGCGCGGTGGTGATCGCCGCGATCACATCTTGCACCAACACCT
C2              CGACCACGGCGCGGTGGTGATCGCCGCGATCACATCTTGCACCAACACCT
C3              CGACCACGGCGCGGTGGTGATCGCCGCGATCACATCTTGCACCAACACCT
C4              CGACCACGGCGCGGTGGTGATCGCCGCGATCACATCTTGCACCAACACCT
C5              CGACCACGGCGCGGTGGTGATCGCCGCGATCACATCTTGCACCAACACCT
C6              CGACCACGGCGCGGTGGTGATCGCCGCGATCACATCTTGCACCAACACCT
                **************************************************

C1              CCAATCCTGAGGTTATGTTGTGTGCGGCGCTGCTGGCCCGCAACGCCGTC
C2              CCAATCCTGAGGTTATGTTGTGTGCGGCGCTGCTGGCCCGCAACGCCGTC
C3              CCAATCCTGAGGTTATGTTGTGTGCGGCGCTGCTGGCCCGCAACGCCGTC
C4              CCAATCCTGAGGTTATGTTGTGTGCGGCGCTGCTGGCCCGCAACGCCGTC
C5              CCAATCCTGAGGTTATGTTGTGTGCGGCGCTGCTGGCCCGCAACGCCGTC
C6              CCAATCCTGAGGTTATGTTGTGTGCGGCGCTGCTGGCCCGCAACGCCGTC
                **************************************************

C1              GAAAAGGGACTGGCCTCCAAACCATGGGTGAAAACCACGATGGCGCCGGG
C2              GAAAAGGGACTGGCCTCCAAACCATGGGTGAAAACCACGATGGCGCCGGG
C3              GAAAAGGGACTGGCCTCCAAACCATGGGTGAAAACCACGATGGCGCCGGG
C4              GAAAAGGGACTGGCCTCCAAACCATGGGTGAAAACCACGATGGCGCCGGG
C5              GAAAAGGGACTGGCCTCCAAACCATGGGTGAAAACCACGATGGCGCCGGG
C6              GAAAAGGGACTGGCCTCCAAACCATGGGTGAAAACCACGATGGCGCCGGG
                **************************************************

C1              CTCGCAGGTGGTCAACGACTACTACGACCGGTCCGGTCTGTGGCCGTATT
C2              CTCGCAGGTGGTCAACGACTACTACGACCGGTCCGGTCTGTGGCCGTATT
C3              CTCGCAGGTGGTCAACGACTACTACGACCGGTCCGGTCTGTGGCCGTATT
C4              CTCGCAGGTGGTCAACGACTACTACGACCGGTCCGGTCTGTGGCCGTATT
C5              CTCGCAGGTGGTCAACGACTACTACGACCGGTCCGGTCTGTGGCCGTATT
C6              CTCGCAGGTGGTCAACGACTACTACGACCGGTCCGGTCTGTGGCCGTATT
                **************************************************

C1              TGGAAAAGCTCGGCTTCTATCTGGTCGGCTACGGCTGCACCACGTGTATT
C2              TGGAAAAGCTCGGCTTCTATCTGGTCGGCTACGGCTGCACCACGTGTATT
C3              TGGAAAAGCTCGGCTTCTATCTGGTCGGCTACGGCTGCACCACGTGTATT
C4              TGGAAAAGCTCGGCTTCTATCTGGTCGGCTACGGCTGCACCACGTGTATT
C5              TGGAAAAGCTCGGCTTCTATCTGGTCGGCTACGGCTGCACCACGTGTATT
C6              TGGAAAAGCTCGGCTTCTATCTGGTCGGCTACGGCTGCACCACGTGTATT
                **************************************************

C1              GGCAACTCTGGCCCACTTCCCGAGGAGATTTCGAAAGCGATCAACTACAA
C2              GGCAACTCTGGCCCACTTCCCGAGGAGATTTCGAAAGCGATCAACTACAA
C3              GGCAACTCTGGCCCACTTCCCGAGGAGATTTCGAAAGCGATCAACTACAA
C4              GGCAACTCTGGCCCACTTCCCGAGGAGATTTCGAAAGCGATCAACTACAA
C5              GGCAACTCTGGCCCACTTCCCGAGGAGATTTCGAAAGCGATCAACTACAA
C6              GGCAACTCTGGCCCACTTCCCGAGGAGATTTCGAAAGCGATCAACTACAA
                **************************************************

C1              CAACCTTTCGGTGACCGCTGTGTTGTCGGGCAACCGAAACTTCGAGGGTC
C2              CAACCTTTCGGTGACCGCTGTGTTGTCGGGCAACCGAAACTTCGAGGGTC
C3              CAACCTTTCGGTGACCGCTGTGTTGTCGGGCAACCGAAACTTCGAGGGTC
C4              CAACCTTTCGGTGACCGCTGTGTTGTCGGGCAACCGAAACTTCGAGGGTC
C5              CAACCTTTCGGTGACCGCTGTGTTGTCGGGCAACCGAAACTTCGAGGGTC
C6              CAACCTTTCGGTGACCGCTGTGTTGTCGGGCAACCGAAACTTCGAGGGTC
                **************************************************

C1              GCATCAACCCCGATGTGAAGATGAACTACTTGGCCTCGCCACCACTAGTG
C2              GCATCAACCCCGATGTGAAGATGAACTACTTGGCCTCGCCACCACTAGTG
C3              GCATCAACCCCGATGTGAAGATGAACTACTTGGCCTCGCCACCACTAGTG
C4              GCATCAACCCCGATGTGAAGATGAACTACTTGGCCTCGCCACCACTAGTG
C5              GCATCAACCCCGATGTGAAGATGAACTACTTGGCCTCGCCACCACTAGTG
C6              GCATCAACCCCGATGTGAAGATGAACTACTTGGCCTCGCCACCACTAGTG
                **************************************************

C1              ATCGCCTACGCACTAGCCGGGACAATGGACTTCGACTTCGAGAGCCAGCC
C2              ATCGCCTACGCACTAGCCGGGACAATGGACTTCGACTTCGAGAGCCAGCC
C3              ATCGCCTACGCACTAGCCGGGACAATGGACTTCGACTTCGAGAGCCAGCC
C4              ATCGCCTACGCACTAGCCGGGACAATGGACTTCGACTTCGAGAGCCAGCC
C5              ATCGCCTACGCACTAGCCGGGACAATGGACTTCGACTTCGAGAGCCAGCC
C6              ATCGCCTACGCACTAGCCGGGACAATGGACTTCGACTTCGAGAGCCAGCC
                **************************************************

C1              GTTGGACACAGATAAAAACGGCAAGGCCGTCTACTTGAAAGACATCTGGC
C2              GTTGGACACAGATAAAAACGGCAAGGCCGTCTACTTGAAAGACATCTGGC
C3              GTTGGACACAGATAAAAACGGCAAGGCCGTCTACTTGAAAGACATCTGGC
C4              GTTGGACACAGATAAAAACGGCAAGGCCGTCTACTTGAAAGACATCTGGC
C5              GTTGGACACAGATAAAAACGGCAAGGCCGTCTACTTGAAAGACATCTGGC
C6              GTTGGACACAGATAAAAACGGCAAGGCCGTCTACTTGAAAGACATCTGGC
                **************************************************

C1              CCTCGCAAAAAGACGTCACCGACACCATCGCCTCGGCAATCAATCAAGAG
C2              CCTCGCAAAAAGACGTCACCGACACCATCGCCTCGGCAATCAATCAAGAG
C3              CCTCGCAAAAAGACGTCACCGACACCATCGCCTCGGCAATCAATCAAGAG
C4              CCTCGCAAAAAGACGTCACCGACACCATCGCCTCGGCAATCAATCAAGAG
C5              CCTCGCAAAAAGACGTCACCGACACCATCGCCTCGGCAATCAATCAAGAG
C6              CCTCGCAAAAAGACGTCACCGACACCATCGCCTCGGCAATCAATCAAGAG
                **************************************************

C1              ATGTTCACCAAGAACTATGCCGACGTTTTCAAGGGCGATGAACGCTGGCG
C2              ATGTTCACCAAGAACTATGCCGACGTTTTCAAGGGCGATGAACGCTGGCG
C3              ATGTTCACCAAGAACTATGCCGACGTTTTCAAGGGCGATGAACGCTGGCG
C4              ATGTTCACCAAGAACTATGCCGACGTTTTCAAGGGCGATGAACGCTGGCG
C5              ATGTTCACCAAGAACTATGCCGACGTTTTCAAGGGCGATGAACGCTGGCG
C6              ATGTTCACCAAGAACTATGCCGACGTTTTCAAGGGCGATGAACGCTGGCG
                **************************************************

C1              CAACTTGCCAACACCGAGCGGCAATACCTTTGATTGGGAACAGAATTCGA
C2              CAACTTGCCAACACCGAGCGGCAATACCTTTGATTGGGAACAGAATTCGA
C3              CAACTTGCCAACACCGAGCGGCAATACCTTTGATTGGGAACAGAATTCGA
C4              CAACTTGCCAACACCGAGCGGCAATACCTTTGATTGGGAACAGAATTCGA
C5              CAACTTGCCAACACCGAGCGGCAATACCTTTGATTGGGAACAGAATTCGA
C6              CAACTTGCCAACACCGAGCGGCAATACCTTTGATTGGGAACAGAATTCGA
                **************************************************

C1              CGTATGTGCGCAAACCTCCTTACTTCGAGGGAATGTCCGTAGAGCCCAAG
C2              CGTATGTGCGCAAACCTCCTTACTTCGAGGGAATGTCCGTAGAGCCCAAG
C3              CGTATGTGCGCAAACCTCCTTACTTCGAGGGAATGTCCGTAGAGCCCAAG
C4              CGTATGTGCGCAAACCTCCTTACTTCGAGGGAATGTCCGTAGAGCCCAAG
C5              CGTATGTGCGCAAACCTCCTTACTTCGAGGGAATGTCCGTAGAGCCCAAG
C6              CGTATGTGCGCAAACCTCCTTACTTCGAGGGAATGTCCGTAGAGCCCAAG
                **************************************************

C1              CCAGTGCGTAACATCACCGGCGCTCGAGTGCTAGCGCTGCTGGACGACTC
C2              CCAGTGCGTAACATCACCGGCGCTCGAGTGCTAGCGCTGCTGGACGACTC
C3              CCAGTGCGTAACATCACCGGCGCTCGAGTGCTAGCGCTGCTGGACGACTC
C4              CCAGTGCGTAACATCACCGGCGCTCGAGTGCTAGCGCTGCTGGACGACTC
C5              CCAGTGCGTAACATCACCGGCGCTCGAGTGCTAGCGCTGCTGGACGACTC
C6              CCAGTGCGTAACATCACCGGCGCTCGAGTGCTAGCGCTGCTGGACGACTC
                **************************************************

C1              AGTGACCACCGACCACATCTCCCCCGCCAGCACCATCAAGCCGGGTACCC
C2              AGTGACCACCGACCACATCTCCCCCGCCAGCACCATCAAGCCGGGTACCC
C3              AGTGACCACCGACCACATCTCCCCCGCCAGCACCATCAAGCCGGGTACCC
C4              AGTGACCACCGACCACATCTCCCCCGCCAGCACCATCAAGCCGGGTACCC
C5              AGTGACCACCGACCACATCTCCCCCGCCAGCACCATCAAGCCGGGTACCC
C6              AGTGACCACCGACCACATCTCCCCCGCCAGCACCATCAAGCCGGGTACCC
                **************************************************

C1              CGGCAGCACAATACCTCGACACCCATGGCGTCGACCGCAAGGACTACAAT
C2              CGGCAGCACAATACCTCGACACCCATGGCGTCGACCGCAAGGACTACAAT
C3              CGGCAGCACAATACCTCGACACCCATGGCGTCGACCGCAAGGACTACAAT
C4              CGGCAGCACAATACCTCGACACCCATGGCGTCGACCGCAAGGACTACAAT
C5              CGGCAGCACAATACCTCGACACCCATGGCGTCGACCGCAAGGACTACAAT
C6              CGGCAGCACAATACCTCGACACCCATGGCGTCGACCGCAAGGACTACAAT
                **************************************************

C1              TCCTTCGGGTCACGTCGCGGCAACCACGAAGTCATGATCCGTGGCACATT
C2              TCCTTCGGGTCACGTCGCGGCAACCACGAAGTCATGATCCGTGGCACATT
C3              TCCTTCGGGTCACGTCGCGGCAACCACGAAGTCATGATCCGTGGCACATT
C4              TCCTTCGGGTCACGTCGCGGCAACCACGAAGTCATGATCCGTGGCACATT
C5              TCCTTCGGGTCACGTCGCGGCAACCACGAAGTCATGATCCGTGGCACATT
C6              TCCTTCGGGTCACGTCGCGGCAACCACGAAGTCATGATCCGTGGCACATT
                **************************************************

C1              TGCCAACATCAGACTGCGCAATATGCTGCTGAACGGCGTTGCGGGCGGGT
C2              TGCCAACATCAGACTGCGCAATATGCTGCTGAACGGCGTTGCGGGCGGGT
C3              TGCCAACATCAGACTGCGCAATATGCTGCTGAACGGCGTTGCGGGCGGGT
C4              TGCCAACATCAGACTGCGCAATATGCTGCTGAACGGCGTTGCGGGCGGGT
C5              TGCCAACATCAGACTGCGCAATATGCTGCTGAACGGCGTTGCGGGCGGGT
C6              TGCCAACATCAGACTGCGCAATATGCTGCTGAACGGCGTTGCGGGCGGGT
                **************************************************

C1              ACACCCGCGACTTCACCAAACCCGGTGCTCCGCAGGCGTTCATCTACGAC
C2              ACACCCGCGACTTCACCAAACCCGGTGCTCCGCAGGCGTTCATCTACGAC
C3              ACACCCGCGACTTCACCAAACCCGGTGCTCCGCAGGCGTTCATCTACGAC
C4              ACACCCGCGACTTCACCAAACCCGGTGCTCCGCAGGCGTTCATCTACGAC
C5              ACACCCGCGACTTCACCAAACCCGGTGCTCCGCAGGCGTTCATCTACGAC
C6              ACACCCGCGACTTCACCAAACCCGGTGCTCCGCAGGCGTTCATCTACGAC
                **************************************************

C1              GCGGCACAAAACTATGCGGCAGAAAACATTCCGTTGGTGGTACTCAGCGG
C2              GCGGCACAAAACTATGCGGCAGAAAACATTCCGTTGGTGGTACTCAGCGG
C3              GCGGCACAAAACTATGCGGCAGAAAACATTCCGTTGGTGGTACTCAGCGG
C4              GCGGCACAAAACTATGCGGCAGAAAACATTCCGTTGGTGGTACTCAGCGG
C5              GCGGCACAAAACTATGCGGCAGAAAACATTCCGTTGGTGGTACTCAGCGG
C6              GCGGCACAAAACTATGCGGCAGAAAACATTCCGTTGGTGGTACTCAGCGG
                **************************************************

C1              CAAGGAATATGGGTCCGGGTCATCGCGCGACTGGGCGGCCAAGGGCACGT
C2              CAAGGAATATGGGTCCGGGTCATCGCGCGACTGGGCGGCCAAGGGCACGT
C3              CAAGGAATATGGGTCCGGGTCATCGCGCGACTGGGCGGCCAAGGGCACGT
C4              CAAGGAATATGGGTCCGGGTCATCGCGCGACTGGGCGGCCAAGGGCACGT
C5              CAAGGAATATGGGTCCGGGTCATCGCGCGACTGGGCGGCCAAGGGCACGT
C6              CAAGGAATATGGGTCCGGGTCATCGCGCGACTGGGCGGCCAAGGGCACGT
                **************************************************

C1              TGCTGTTAGGAGTGCGTGCGGTGATCGCCGAGTCGTTCGAACGCATCCAC
C2              TGCTGTTAGGAGTGCGTGCGGTGATCGCCGAGTCGTTCGAACGCATCCAC
C3              TGCTGTTAGGAGTGCGTGCGGTGATCGCCGAGTCGTTCGAACGCATCCAC
C4              TGCTGTTAGGAGTGCGTGCGGTGATCGCCGAGTCGTTCGAACGCATCCAC
C5              TGCTGTTAGGAGTGCGTGCGGTGATCGCCGAGTCGTTCGAACGCATCCAC
C6              TGCTGTTAGGAGTGCGTGCGGTGATCGCCGAGTCGTTCGAACGCATCCAC
                **************************************************

C1              CGCTCCAACTTGATTGGTATGGGTGTGATCCCGCTACAATTCCCGCAGGG
C2              CGCTCCAACTTGATTGGTATGGGTGTGATCCCGCTACAATTCCCGCAGGG
C3              CGCTCCAACTTGATTGGTATGGGTGTGATCCCGCTACAATTCCCGCAGGG
C4              CGCTCCAACTTGATTGGTATGGGTGTGATCCCGCTACAATTCCCGCAGGG
C5              CGCTCCAACTTGATTGGTATGGGTGTGATCCCGCTACAATTCCCGCAGGG
C6              CGCTCCAACTTGATTGGTATGGGTGTGATCCCGCTACAATTCCCGCAGGG
                **************************************************

C1              CGAGTCGGCTTCGTCGCTCGGACTGGACGGTACCGAAGTGTTCGAGATCA
C2              CGAGTCGGCTTCGTCGCTCGGACTGGACGGTACCGAAGTGTTCGAGATCA
C3              CGAGTCGGCTTCGTCGCTCGGACTGGACGGTACCGAAGTGTTCGAGATCA
C4              CGAGTCGGCTTCGTCGCTCGGACTGGACGGTACCGAAGTGTTCGAGATCA
C5              CGAGTCGGCTTCGTCGCTCGGACTGGACGGTACCGAAGTGTTCGAGATCA
C6              CGAGTCGGCTTCGTCGCTCGGACTGGACGGTACCGAAGTGTTCGAGATCA
                **************************************************

C1              ACGGTATCGATGTGTTCAATAATGGCAAGACACCAAAAACTGTGCATGTC
C2              ACGGTATCGATGTGTTCAATAATGGCAAGACACCAAAAACTGTGCATGTC
C3              ACGGTATCGATGTGTTCAATAATGGCAAGACACCAAAAACTGTGCATGTC
C4              ACGGTATCGATGTGTTCAATAATGGCAAGACACCAAAAACTGTGCATGTC
C5              ACGGTATCGATGTGTTCAATAATGGCAAGACACCAAAAACTGTGCATGTC
C6              ACGGTATCGATGTGTTCAATAATGGCAAGACACCAAAAACTGTGCATGTC
                **************************************************

C1              AAAGCCAGCAAGGCTAGCGGAACCACAGTGACGTTCGATGCGTTGGTGCG
C2              AAAGCCAGCAAGGCTAGCGGAACCACAGTGACGTTCGATGCGTTGGTGCG
C3              AAAGCCAGCAAGGCTAGCGGAACCACAGTGACGTTCGATGCGTTGGTGCG
C4              AAAGCCAGCAAGGCTAGCGGAACCACAGTGACGTTCGATGCGTTGGTGCG
C5              AAAGCCAGCAAGGCTAGCGGAACCACAGTGACGTTCGATGCGTTGGTGCG
C6              AAAGCCAGCAAGGCTAGCGGAACCACAGTGACGTTCGATGCGTTGGTGCG
                **************************************************

C1              CATAGACACCCCCGGTGAGGCCGACTACTACCGCAACGGCGGAATTCTGC
C2              CATAGACACCCCCGGTGAGGCCGACTACTACCGCAACGGCGGAATTCTGC
C3              CATAGACACCCCCGGTGAGGCCGACTACTACCGCAACGGCGGAATTCTGC
C4              CATAGACACCCCCGGTGAGGCCGACTACTACCGCAACGGCGGAATTCTGC
C5              CATAGACACCCCCGGTGAGGCCGACTACTACCGCAACGGCGGAATTCTGC
C6              CATAGACACCCCCGGTGAGGCCGACTACTACCGCAACGGCGGAATTCTGC
                **************************************************

C1              ATTACGTGTTGCGCAACATACTGAAGTCAAAC---
C2              ATTACGTGTTGCGCAACATACTGAAGTCAAAC---
C3              ATTACGTGTTGCGCAACATACTGAAGTCAAAC---
C4              ATTACGTGTTGCGCAACATACTGAAGTCAAAC---
C5              ATTACGTGTTGCGCAACATACTGAAGTCAAAC---
C6              ATTACGTGTTGCGCAACATACTGAAGTCAAAC---
                ********************************   



>C1
GTGATAAGTAGCAAAGATTCGGTGAACTCGTTTTCAGCCCGCGACACCCT
GAAAATCGGCGACAACAGTTACCAAATCTATCGTCTGGACGCCGTCTCCA
ATACCAAGAGACTTCCATACAGTCTCAAAGTACTCGCCGAAAACCTACTA
CGCAACGAAGACGGCAAGAATATCACCAAAGATCACATCGAAGCGATAGC
AAACTGGGATAGGCAGGCGGAACCCAGCATCGAAATCCAGTACACGCCGG
CCCGTATCGTCATGCAGGACTTCACAGGCGTGCCGTGTATCGTCGACTTG
GCCACCATGCGGGAGGCCATCGGGGATCTCGGCGGCAACCCGGAAAAAGT
CAACCCACTGGCGCGGGTTGACTTGGTGATTGACCACTCAGTGATCGCCG
ATCTGTTTGGCCGCGCCGACGCGTTCGAGCGCAATGTTGAAATCGAGTAC
CAGCGCAACGGCGAGCGTTATCAGTTCCTGCGCTGGGGACAAGGAGCGTT
CAACGACTTCAAGGTGGTACCACCGGGCACCGGCATTGTGCACCAGGTAA
ACATCGAATATCTGGCTAGTGTCGTGATGACTCAGGAGAATACCCAAGGA
ACAGTAGTGGCATACCCCGACACCTGCGTAGGCACCGACTCGCACACCAC
GATGGTCAACGGGCTCGGCGTCCTAGGCTGGGGCGTAGGTGGCATCGAAG
CTGAGGCCGCCATGTTGGGCCAGCCGGTGTCGATGCTGATCCCGTGGGTG
GTCGGCTTCAAGCTGAGTGGTGAGATTCAGCCAGGTGTTACAGCCACCGA
CGTCGTACTGACTGTCACCGAAATGTTGCGCAGGCACGGTGTTGTTGGCA
AGTTCGTCGAGTTCTACGGCGAGGGCGTGGCCGAGGTACCGCTGGCCAAT
CGCGCCACTCTGGGCAATATGAGCCCTGAATTCGGTTCCACTGCAGCAAT
TTTTCCGATCGACGAAGAGACGATTAACTACCTGCGGTTCACCGGGCGCA
CGCCTGAGCAAGTTGCCCTGGTCGAGGGTTACGCCAAAGAGCAAGGCATG
TGGCACGACCCCAAGAATGAGCCGACGTTCTCCGAATACCTCGAACTAAA
CCTCTCCGATGTGGTACCGTCGATCTCCGGACCGAAACGTCCGCAGGACC
GAATCTGCTTGGCGCAAGCCAAGTCCACGTTCCGCGCGCAAATTCCTAAG
TATGTTGACGGCAGTTCGCTCCACAACCAACATTCGAAGTTGGACGAGGT
AGTCGAGGAGACATGCCCAGCCAGCGACCCGGGGAAGCTGTCGTTCACCA
ACAACGATGAGGTGGTAATGCAATCTGCGGCCGCGCATGCGAACGGCCGA
GTAAGCAACCCGGTGCGCATCAAGACGCAAGAACTCGGTGAGTTCGTGCT
CGACCACGGCGCGGTGGTGATCGCCGCGATCACATCTTGCACCAACACCT
CCAATCCTGAGGTTATGTTGTGTGCGGCGCTGCTGGCCCGCAACGCCGTC
GAAAAGGGACTGGCCTCCAAACCATGGGTGAAAACCACGATGGCGCCGGG
CTCGCAGGTGGTCAACGACTACTACGACCGGTCCGGTCTGTGGCCGTATT
TGGAAAAGCTCGGCTTCTATCTGGTCGGCTACGGCTGCACCACGTGTATT
GGCAACTCTGGCCCACTTCCCGAGGAGATTTCGAAAGCGATCAACTACAA
CAACCTTTCGGTGACCGCTGTGTTGTCGGGCAACCGAAACTTCGAGGGTC
GCATCAACCCCGATGTGAAGATGAACTACTTGGCCTCGCCACCACTAGTG
ATCGCCTACGCACTAGCCGGGACAATGGACTTCGACTTCGAGAGCCAGCC
GTTGGACACAGATAAAAACGGCAAGGCCGTCTACTTGAAAGACATCTGGC
CCTCGCAAAAAGACGTCACCGACACCATCGCCTCGGCAATCAATCAAGAG
ATGTTCACCAAGAACTATGCCGACGTTTTCAAGGGCGATGAACGCTGGCG
CAACTTGCCAACACCGAGCGGCAATACCTTTGATTGGGAACAGAATTCGA
CGTATGTGCGCAAACCTCCTTACTTCGAGGGAATGTCCGTAGAGCCCAAG
CCAGTGCGTAACATCACCGGCGCTCGAGTGCTAGCGCTGCTGGACGACTC
AGTGACCACCGACCACATCTCCCCCGCCAGCACCATCAAGCCGGGTACCC
CGGCAGCACAATACCTCGACACCCATGGCGTCGACCGCAAGGACTACAAT
TCCTTCGGGTCACGTCGCGGCAACCACGAAGTCATGATCCGTGGCACATT
TGCCAACATCAGACTGCGCAATATGCTGCTGAACGGCGTTGCGGGCGGGT
ACACCCGCGACTTCACCAAACCCGGTGCTCCGCAGGCGTTCATCTACGAC
GCGGCACAAAACTATGCGGCAGAAAACATTCCGTTGGTGGTACTCAGCGG
CAAGGAATATGGGTCCGGGTCATCGCGCGACTGGGCGGCCAAGGGCACGT
TGCTGTTAGGAGTGCGTGCGGTGATCGCCGAGTCGTTCGAACGCATCCAC
CGCTCCAACTTGATTGGTATGGGTGTGATCCCGCTACAATTCCCGCAGGG
CGAGTCGGCTTCGTCGCTCGGACTGGACGGTACCGAAGTGTTCGAGATCA
ACGGTATCGATGTGTTCAATAATGGCAAGACACCAAAAACTGTGCATGTC
AAAGCCAGCAAGGCTAGCGGAACCACAGTGACGTTCGATGCGTTGGTGCG
CATAGACACCCCCGGTGAGGCCGACTACTACCGCAACGGCGGAATTCTGC
ATTACGTGTTGCGCAACATACTGAAGTCAAAC---
>C2
GTGATAAGTAGCAAAGATTCGGTGAACTCGTTTTCAGCCCGCGACACCCT
GAAAATCGGCGACAACAGTTACCAAATCTATCGTCTGGACGCCGTCTCCA
ATACCAAGAGACTTCCATACAGTCTCAAAGTACTCGCCGAAAACCTACTA
CGCAACGAAGACGGCAAGAATATCACCAAAGATCACATCGAAGCGATAGC
AAACTGGGATAGGCAGGCGGAACCCAGCATCGAAATCCAGTACACGCCGG
CCCGTATCGTCATGCAGGACTTCACAGGCGTGCCGTGTATCGTCGACTTG
GCCACCATGCGGGAGGCCATCGGGGATCTCGGCGGCAACCCGGAAAAAGT
CAACCCACTGGCGCGGGTTGACTTGGTGATTGACCACTCAGTGATCGCCG
ATCTGTTTGGCCGCGCCGACGCGTTCGAGCGCAATGTTGAAATCGAGTAC
CAGCGCAACGGCGAGCGTTATCAGTTCCTGCGCTGGGGACAAGGAGCGTT
CAACGACTTCAAGGTGGTACCACCGGGCACCGGCATTGTGCACCAGGTAA
ACATCGAATATCTGGCTAGTGTCGTGATGACTCAGGAGAATACCCAAGGA
ACAGTAGTGGCATACCCCGACACCTGCGTAGGCACCGACTCGCACACCAC
GATGGTCAACGGGCTCGGCGTCCTAGGCTGGGGCGTAGGTGGCATCGAAG
CTGAGGCCGCCATGTTGGGCCAGCCGGTGTCGATGCTGATCCCGTGGGTG
GTCGGCTTCAAGCTGAGTGGTGAGATTCAGCCAGGTGTTACAGCCACCGA
CGTCGTACTGACTGTCACCGAAATGTTGCGCAGGCACGGTGTTGTTGGCA
AGTTCGTCGAGTTCTACGGCGAGGGCGTGGCCGAGGTACCGCTGGCCAAT
CGCGCCACTCTGGGCAATATGAGCCCTGAATTCGGTTCCACTGCAGCAAT
TTTTCCGATCGACGAAGAGACGATTAACTACCTGCGGTTCACCGGGCGCA
CGCCTGAGCAAGTTGCCCTGGTCGAGGGTTACGCCAAAGAGCAAGGCATG
TGGCACGACCCCAAGAATGAGCCGACGTTCTCCGAATACCTCGAACTAAA
CCTCTCCGATGTGGTACCGTCGATCTCCGGACCGAAACGTCCGCAGGACC
GAATCTGCTTGGCGCAAGCCAAGTCCACGTTCCGCGCGCAAATTCCTAAG
TATGTTGACGGCAGTTCGCTCCACAACCAACATTCGAAGTTGGACGAGGT
AGTCGAGGAGACATGCCCAGCCAGCGACCCGGGGAAGCTGTCGTTCACCA
ACAACGATGAGGTGGTAATGCAATCTGCGGCCGCGCATGCGAACGGCCGA
GTAAGCAACCCGGTGCGCATCAAGACGCAAGAACTCGGTGAGTTCGTGCT
CGACCACGGCGCGGTGGTGATCGCCGCGATCACATCTTGCACCAACACCT
CCAATCCTGAGGTTATGTTGTGTGCGGCGCTGCTGGCCCGCAACGCCGTC
GAAAAGGGACTGGCCTCCAAACCATGGGTGAAAACCACGATGGCGCCGGG
CTCGCAGGTGGTCAACGACTACTACGACCGGTCCGGTCTGTGGCCGTATT
TGGAAAAGCTCGGCTTCTATCTGGTCGGCTACGGCTGCACCACGTGTATT
GGCAACTCTGGCCCACTTCCCGAGGAGATTTCGAAAGCGATCAACTACAA
CAACCTTTCGGTGACCGCTGTGTTGTCGGGCAACCGAAACTTCGAGGGTC
GCATCAACCCCGATGTGAAGATGAACTACTTGGCCTCGCCACCACTAGTG
ATCGCCTACGCACTAGCCGGGACAATGGACTTCGACTTCGAGAGCCAGCC
GTTGGACACAGATAAAAACGGCAAGGCCGTCTACTTGAAAGACATCTGGC
CCTCGCAAAAAGACGTCACCGACACCATCGCCTCGGCAATCAATCAAGAG
ATGTTCACCAAGAACTATGCCGACGTTTTCAAGGGCGATGAACGCTGGCG
CAACTTGCCAACACCGAGCGGCAATACCTTTGATTGGGAACAGAATTCGA
CGTATGTGCGCAAACCTCCTTACTTCGAGGGAATGTCCGTAGAGCCCAAG
CCAGTGCGTAACATCACCGGCGCTCGAGTGCTAGCGCTGCTGGACGACTC
AGTGACCACCGACCACATCTCCCCCGCCAGCACCATCAAGCCGGGTACCC
CGGCAGCACAATACCTCGACACCCATGGCGTCGACCGCAAGGACTACAAT
TCCTTCGGGTCACGTCGCGGCAACCACGAAGTCATGATCCGTGGCACATT
TGCCAACATCAGACTGCGCAATATGCTGCTGAACGGCGTTGCGGGCGGGT
ACACCCGCGACTTCACCAAACCCGGTGCTCCGCAGGCGTTCATCTACGAC
GCGGCACAAAACTATGCGGCAGAAAACATTCCGTTGGTGGTACTCAGCGG
CAAGGAATATGGGTCCGGGTCATCGCGCGACTGGGCGGCCAAGGGCACGT
TGCTGTTAGGAGTGCGTGCGGTGATCGCCGAGTCGTTCGAACGCATCCAC
CGCTCCAACTTGATTGGTATGGGTGTGATCCCGCTACAATTCCCGCAGGG
CGAGTCGGCTTCGTCGCTCGGACTGGACGGTACCGAAGTGTTCGAGATCA
ACGGTATCGATGTGTTCAATAATGGCAAGACACCAAAAACTGTGCATGTC
AAAGCCAGCAAGGCTAGCGGAACCACAGTGACGTTCGATGCGTTGGTGCG
CATAGACACCCCCGGTGAGGCCGACTACTACCGCAACGGCGGAATTCTGC
ATTACGTGTTGCGCAACATACTGAAGTCAAAC---
>C3
GTGATAAGTAGCAAAGATTCGGTGAACTCGTTTTCAGCCCGCGACACCCT
GAAAATCGGCGACAACAGTTACCAAATCTATCGTCTGGACGCCGTCTCCA
ATACCAAGAGACTTCCATACAGTCTCAAAGTACTCGCCGAAAACCTACTA
CGCAACGAAGACGGCAAGAATATCACCAAAGATCACATCGAAGCGATAGC
AAACTGGGATAGGCAGGCGGAACCCAGCATCGAAATCCAGTACACGCCGG
CCCGTATCGTCATGCAGGACTTCACAGGCGTGCCGTGTATCGTCGACTTG
GCCACCATGCGGGAGGCCATCGGGGATCTCGGCGGCAACCCGGAAAAAGT
CAACCCACTGGCGCGGGTTGACTTGGTGATTGACCACTCAGTGATCGCCG
ATCTGTTTGGCCGCGCCGACGCGTTCGAGCGCAATGTTGAAATCGAGTAC
CAGCGCAACGGCGAGCGTTATCAGTTCCTGCGCTGGGGACAAGGAGCGTT
CAACGACTTCAAGGTGGTACCACCGGGCACCGGCATTGTGCACCAGGTAA
ACATCGAATATCTGGCTAGTGTCGTGATGACTCAGGAGAATACCCAAGGA
ACAGTAGTGGCATACCCCGACACCTGCGTAGGCACCGACTCGCACACCAC
GATGGTCAACGGGCTCGGCGTCCTAGGCTGGGGCGTAGGTGGCATCGAAG
CTGAGGCCGCCATGTTGGGCCAGCCGGTGTCGATGCTGATCCCGTGGGTG
GTCGGCTTCAAGCTGAGTGGTGAGATTCAGCCAGGTGTTACAGCCACCGA
CGTCGTACTGACTGTCACCGAAATGTTGCGCAGGCACGGTGTTGTTGGCA
AGTTCGTCGAGTTCTACGGCGAGGGCGTGGCCGAGGTACCGCTGGCCAAT
CGCGCCACTCTGGGCAATATGAGCCCTGAATTCGGTTCCACTGCAGCAAT
TTTTCCGATCGACGAAGAGACGATTAACTACCTGCGGTTCACCGGGCGCA
CGCCTGAGCAAGTTGCCCTGGTCGAGGGTTACGCCAAAGAGCAAGGCATG
TGGCACGACCCCAAGAATGAGCCGACGTTCTCCGAATACCTCGAACTAAA
CCTCTCCGATGTGGTACCGTCGATCTCCGGACCGAAACGTCCGCAGGACC
GAATCTGCTTGGCGCAAGCCAAGTCCACGTTCCGCGCGCAAATTCCTAAG
TATGTTGACGGCAGTTCGCTCCACAACCAACATTCGAAGTTGGACGAGGT
AGTCGAGGAGACATGCCCAGCCAGCGACCCGGGGAAGCTGTCGTTCACCA
ACAACGATGAGGTGGTAATGCAATCTGCGGCCGCGCATGCGAACGGCCGA
GTAAGCAACCCGGTGCGCATCAAGACGCAAGAACTCGGTGAGTTCGTGCT
CGACCACGGCGCGGTGGTGATCGCCGCGATCACATCTTGCACCAACACCT
CCAATCCTGAGGTTATGTTGTGTGCGGCGCTGCTGGCCCGCAACGCCGTC
GAAAAGGGACTGGCCTCCAAACCATGGGTGAAAACCACGATGGCGCCGGG
CTCGCAGGTGGTCAACGACTACTACGACCGGTCCGGTCTGTGGCCGTATT
TGGAAAAGCTCGGCTTCTATCTGGTCGGCTACGGCTGCACCACGTGTATT
GGCAACTCTGGCCCACTTCCCGAGGAGATTTCGAAAGCGATCAACTACAA
CAACCTTTCGGTGACCGCTGTGTTGTCGGGCAACCGAAACTTCGAGGGTC
GCATCAACCCCGATGTGAAGATGAACTACTTGGCCTCGCCACCACTAGTG
ATCGCCTACGCACTAGCCGGGACAATGGACTTCGACTTCGAGAGCCAGCC
GTTGGACACAGATAAAAACGGCAAGGCCGTCTACTTGAAAGACATCTGGC
CCTCGCAAAAAGACGTCACCGACACCATCGCCTCGGCAATCAATCAAGAG
ATGTTCACCAAGAACTATGCCGACGTTTTCAAGGGCGATGAACGCTGGCG
CAACTTGCCAACACCGAGCGGCAATACCTTTGATTGGGAACAGAATTCGA
CGTATGTGCGCAAACCTCCTTACTTCGAGGGAATGTCCGTAGAGCCCAAG
CCAGTGCGTAACATCACCGGCGCTCGAGTGCTAGCGCTGCTGGACGACTC
AGTGACCACCGACCACATCTCCCCCGCCAGCACCATCAAGCCGGGTACCC
CGGCAGCACAATACCTCGACACCCATGGCGTCGACCGCAAGGACTACAAT
TCCTTCGGGTCACGTCGCGGCAACCACGAAGTCATGATCCGTGGCACATT
TGCCAACATCAGACTGCGCAATATGCTGCTGAACGGCGTTGCGGGCGGGT
ACACCCGCGACTTCACCAAACCCGGTGCTCCGCAGGCGTTCATCTACGAC
GCGGCACAAAACTATGCGGCAGAAAACATTCCGTTGGTGGTACTCAGCGG
CAAGGAATATGGGTCCGGGTCATCGCGCGACTGGGCGGCCAAGGGCACGT
TGCTGTTAGGAGTGCGTGCGGTGATCGCCGAGTCGTTCGAACGCATCCAC
CGCTCCAACTTGATTGGTATGGGTGTGATCCCGCTACAATTCCCGCAGGG
CGAGTCGGCTTCGTCGCTCGGACTGGACGGTACCGAAGTGTTCGAGATCA
ACGGTATCGATGTGTTCAATAATGGCAAGACACCAAAAACTGTGCATGTC
AAAGCCAGCAAGGCTAGCGGAACCACAGTGACGTTCGATGCGTTGGTGCG
CATAGACACCCCCGGTGAGGCCGACTACTACCGCAACGGCGGAATTCTGC
ATTACGTGTTGCGCAACATACTGAAGTCAAAC---
>C4
GTGATAAGTAGCAAAGATTCGGTGAACTCGTTTTCAGCCCGCGACACCCT
GAAAATCGGCGACAACAGTTACCAAATCTATCGTCTGGACGCCGTCTCCA
ATACCAAGAGACTTCCATACAGTCTCAAAGTACTCGCCGAAAACCTACTA
CGCAACGAAGACGGCAAGAATATCACCAAAGATCACATCGAAGCGATAGC
AAACTGGGATAGGCAGGCGGAACCCAGCATCGAAATCCAGTACACGCCGG
CCCGTATCGTCATGCAGGACTTCACAGGCGTGCCGTGTATCGTCGACTTG
GCCACCATGCGGGAGGCCATCGGGGATCTCGGCGGCAACCCGGAAAAAGT
CAACCCACTGGCGCGGGTTGACTTGGTGATTGACCACTCAGTGATCGCCG
ATCTGTTTGGCCGCGCCGACGCGTTCGAGCGCAATGTTGAAATCGAGTAC
CAGCGCAACGGCGAGCGTTATCAGTTCCTGCGCTGGGGACAAGGAGCGTT
CAACGACTTCAAGGTGGTACCACCGGGCACCGGCATTGTGCACCAGGTAA
ACATCGAATATCTGGCTAGTGTCGTGATGACTCAGGAGAATACCCAAGGA
ACAGTAGTGGCATACCCCGACACCTGCGTAGGCACCGACTCGCACACCAC
GATGGTCAACGGGCTCGGCGTCCTAGGCTGGGGCGTAGGTGGCATCGAAG
CTGAGGCCGCCATGTTGGGCCAGCCGGTGTCGATGCTGATCCCGTGGGTG
GTCGGCTTCAAGCTGAGTGGTGAGATTCAGCCAGGTGTTACAGCCACCGA
CGTCGTACTGACTGTCACCGAAATGTTGCGCAGGCACGGTGTTGTTGGCA
AGTTCGTCGAGTTCTACGGCGAGGGCGTGGCCGAGGTACCGCTGGCCAAT
CGCGCCACTCTGGGCAATATGAGCCCTGAATTCGGTTCCACTGCAGCAAT
TTTTCCGATCGACGAAGAGACGATTAACTACCTGCGGTTCACCGGGCGCA
CGCCTGAGCAAGTTGCCCTGGTCGAGGGTTACGCCAAAGAGCAAGGCATG
TGGCACGACCCCAAGAATGAGCCGACGTTCTCCGAATACCTCGAACTAAA
CCTCTCCGATGTGGTACCGTCGATCTCCGGACCGAAACGTCCGCAGGACC
GAATCTGCTTGGCGCAAGCCAAGTCCACGTTCCGCGCGCAAATTCCTAAG
TATGTTGACGGCAGTTCGCTCCACAACCAACATTCGAAGTTGGACGAGGT
AGTCGAGGAGACATGCCCAGCCAGCGACCCGGGGAAGCTGTCGTTCACCA
ACAACGATGAGGTGGTAATGCAATCTGCGGCCGCGCATGCGAACGGCCGA
GTAAGCAACCCGGTGCGCATCAAGACGCAAGAACTCGGTGAGTTCGTGCT
CGACCACGGCGCGGTGGTGATCGCCGCGATCACATCTTGCACCAACACCT
CCAATCCTGAGGTTATGTTGTGTGCGGCGCTGCTGGCCCGCAACGCCGTC
GAAAAGGGACTGGCCTCCAAACCATGGGTGAAAACCACGATGGCGCCGGG
CTCGCAGGTGGTCAACGACTACTACGACCGGTCCGGTCTGTGGCCGTATT
TGGAAAAGCTCGGCTTCTATCTGGTCGGCTACGGCTGCACCACGTGTATT
GGCAACTCTGGCCCACTTCCCGAGGAGATTTCGAAAGCGATCAACTACAA
CAACCTTTCGGTGACCGCTGTGTTGTCGGGCAACCGAAACTTCGAGGGTC
GCATCAACCCCGATGTGAAGATGAACTACTTGGCCTCGCCACCACTAGTG
ATCGCCTACGCACTAGCCGGGACAATGGACTTCGACTTCGAGAGCCAGCC
GTTGGACACAGATAAAAACGGCAAGGCCGTCTACTTGAAAGACATCTGGC
CCTCGCAAAAAGACGTCACCGACACCATCGCCTCGGCAATCAATCAAGAG
ATGTTCACCAAGAACTATGCCGACGTTTTCAAGGGCGATGAACGCTGGCG
CAACTTGCCAACACCGAGCGGCAATACCTTTGATTGGGAACAGAATTCGA
CGTATGTGCGCAAACCTCCTTACTTCGAGGGAATGTCCGTAGAGCCCAAG
CCAGTGCGTAACATCACCGGCGCTCGAGTGCTAGCGCTGCTGGACGACTC
AGTGACCACCGACCACATCTCCCCCGCCAGCACCATCAAGCCGGGTACCC
CGGCAGCACAATACCTCGACACCCATGGCGTCGACCGCAAGGACTACAAT
TCCTTCGGGTCACGTCGCGGCAACCACGAAGTCATGATCCGTGGCACATT
TGCCAACATCAGACTGCGCAATATGCTGCTGAACGGCGTTGCGGGCGGGT
ACACCCGCGACTTCACCAAACCCGGTGCTCCGCAGGCGTTCATCTACGAC
GCGGCACAAAACTATGCGGCAGAAAACATTCCGTTGGTGGTACTCAGCGG
CAAGGAATATGGGTCCGGGTCATCGCGCGACTGGGCGGCCAAGGGCACGT
TGCTGTTAGGAGTGCGTGCGGTGATCGCCGAGTCGTTCGAACGCATCCAC
CGCTCCAACTTGATTGGTATGGGTGTGATCCCGCTACAATTCCCGCAGGG
CGAGTCGGCTTCGTCGCTCGGACTGGACGGTACCGAAGTGTTCGAGATCA
ACGGTATCGATGTGTTCAATAATGGCAAGACACCAAAAACTGTGCATGTC
AAAGCCAGCAAGGCTAGCGGAACCACAGTGACGTTCGATGCGTTGGTGCG
CATAGACACCCCCGGTGAGGCCGACTACTACCGCAACGGCGGAATTCTGC
ATTACGTGTTGCGCAACATACTGAAGTCAAAC---
>C5
---ATAAGTAGCAAAGATTCGGTGAACTCGTTTTCAGCCCGCGACACCCT
GAAAATCGGCGACAACAGTTACCAAATCTATCGTCTGGACGCCGTCTCCA
ATACCAAGAGACTTCCATACAGTCTCAAAGTACTCGCCGAAAACCTACTA
CGCAACGAAGACGGCAAGAATATCACCAAAGATCACATCGAAGCGATAGC
AAACTGGGATAGGCAGGCGGAACCCAGCATCGAAATCCAGTACACGCCGG
CCCGTATCGTCATGCAGGACTTCACAGGCGTGCCGTGTATCGTCGACTTG
GCCACCATGCGGGAGGCCATCGGGGATCTCGGCGGCAACCCGGAAAAAGT
CAACCCACTGGCGCGGGTTGACTTGGTGATTGACCACTCAGTGATCGCCG
ATCTGTTTGGCCGCGCCGACGCGTTCGAGCGCAATGTTGAAATCGAGTAC
CAGCGCAACGGCGAGCGTTATCAGTTCCTGCGCTGGGGACAAGGAGCGTT
CAACGACTTCAAGGTGGTACCACCGGGCACCGGCATTGTGCACCAGGTAA
ACATCGAATATCTGGCTAGTGTCGTGATGACTCAGGAGAATACCCAAGGA
ACAGTAGTGGCATACCCCGACACCTGCGTAGGCACCGACTCGCACACCAC
GATGGTCAACGGGCTCGGCGTCCTAGGCTGGGGCGTAGGTGGCATCGAAG
CTGAGGCCGCCATGTTGGGCCAGCCGGTGTCGATGCTGATCCCGTGGGTG
GTCGGCTTCAAGCTGAGTGGTGAGATTCAGCCAGGTGTTACAGCCACCGA
CGTCGTACTGACTGTCACCGAAATGTTGCGCAGGCACGGTGTTGTTGGCA
AGTTCGTCGAGTTCTACGGCGAGGGCGTGGCCGAGGTACCGCTGGCCAAT
CGCGCCACTCTGGGCAATATGAGCCCTGAATTCGGTTCCACTGCAGCAAT
TTTTCCGATCGACGAAGAGACGATTAACTACCTGCGGTTCACCGGGCGCA
CGCCTGAGCAAGTTGCCCTGGTCGAGGGTTACGCCAAAGAGCAAGGCATG
TGGCACGACCCCAAGAATGAGCCGACGTTCTCCGAATACCTCGAACTAAA
CCTCTCCGATGTGGTACCGTCGATCTCCGGACCGAAACGTCCGCAGGACC
GAATCTGCTTGGCGCAAGCCAAGTCCACGTTCCGCGCGCAAATTCCTAAG
TATGTTGACGGCAGTTCGCTCCACAACCAACATTCGAAGTTGGACGAGGT
AGTCGAGGAGACATGCCCAGCCAGCGACCCGGGGAAGCTGTCGTTCACCA
ACAACGATGAGGTGGTAATGCAATCTGCGGCCGCGCATGCGAACGGCCGA
GTAAGCAACCCGGTGCGCATCAAGACGCAAGAACTCGGTGAGTTCGTGCT
CGACCACGGCGCGGTGGTGATCGCCGCGATCACATCTTGCACCAACACCT
CCAATCCTGAGGTTATGTTGTGTGCGGCGCTGCTGGCCCGCAACGCCGTC
GAAAAGGGACTGGCCTCCAAACCATGGGTGAAAACCACGATGGCGCCGGG
CTCGCAGGTGGTCAACGACTACTACGACCGGTCCGGTCTGTGGCCGTATT
TGGAAAAGCTCGGCTTCTATCTGGTCGGCTACGGCTGCACCACGTGTATT
GGCAACTCTGGCCCACTTCCCGAGGAGATTTCGAAAGCGATCAACTACAA
CAACCTTTCGGTGACCGCTGTGTTGTCGGGCAACCGAAACTTCGAGGGTC
GCATCAACCCCGATGTGAAGATGAACTACTTGGCCTCGCCACCACTAGTG
ATCGCCTACGCACTAGCCGGGACAATGGACTTCGACTTCGAGAGCCAGCC
GTTGGACACAGATAAAAACGGCAAGGCCGTCTACTTGAAAGACATCTGGC
CCTCGCAAAAAGACGTCACCGACACCATCGCCTCGGCAATCAATCAAGAG
ATGTTCACCAAGAACTATGCCGACGTTTTCAAGGGCGATGAACGCTGGCG
CAACTTGCCAACACCGAGCGGCAATACCTTTGATTGGGAACAGAATTCGA
CGTATGTGCGCAAACCTCCTTACTTCGAGGGAATGTCCGTAGAGCCCAAG
CCAGTGCGTAACATCACCGGCGCTCGAGTGCTAGCGCTGCTGGACGACTC
AGTGACCACCGACCACATCTCCCCCGCCAGCACCATCAAGCCGGGTACCC
CGGCAGCACAATACCTCGACACCCATGGCGTCGACCGCAAGGACTACAAT
TCCTTCGGGTCACGTCGCGGCAACCACGAAGTCATGATCCGTGGCACATT
TGCCAACATCAGACTGCGCAATATGCTGCTGAACGGCGTTGCGGGCGGGT
ACACCCGCGACTTCACCAAACCCGGTGCTCCGCAGGCGTTCATCTACGAC
GCGGCACAAAACTATGCGGCAGAAAACATTCCGTTGGTGGTACTCAGCGG
CAAGGAATATGGGTCCGGGTCATCGCGCGACTGGGCGGCCAAGGGCACGT
TGCTGTTAGGAGTGCGTGCGGTGATCGCCGAGTCGTTCGAACGCATCCAC
CGCTCCAACTTGATTGGTATGGGTGTGATCCCGCTACAATTCCCGCAGGG
CGAGTCGGCTTCGTCGCTCGGACTGGACGGTACCGAAGTGTTCGAGATCA
ACGGTATCGATGTGTTCAATAATGGCAAGACACCAAAAACTGTGCATGTC
AAAGCCAGCAAGGCTAGCGGAACCACAGTGACGTTCGATGCGTTGGTGCG
CATAGACACCCCCGGTGAGGCCGACTACTACCGCAACGGCGGAATTCTGC
ATTACGTGTTGCGCAACATACTGAAGTCAAAC---
>C6
---ATAAGTAGCAAAGATTCGGTGAACTCGTTTTCAGCCCGCGACACCCT
GAAAATCGGCGACAACAGTTACCAAATCTATCGTCTGGACGCCGTCTCCA
ATACCAAGAGACTTCCATACAGTCTCAAAGTACTCGCCGAAAACCTACTA
CGCAACGAAGACGGCAAGAATATCACCAAAGATCACATCGAAGCGATAGC
AAACTGGGATAGGCAGGCGGAACCCAGCATCGAAATCCAGTACACGCCGG
CCCGTATCGTCATGCAGGACTTCACAGGCGTGCCGTGTATCGTCGACTTG
GCCACCATGCGGGAGGCCATCGGGGATCTCGGCGGCAACCCGGAAAAAGT
CAACCCACTGGCGCGGGTTGACTTGGTGATTGACCACTCAGTGATCGCCG
ATCTGTTTGGCCGCGCCGACGCGTTCGAGCGCAATGTTGAAATCGAGTAC
CAGCGCAACGGCGAGCGTTATCAGTTCCTGCGCTGGGGACAAGGAGCGTT
CAACGACTTCAAGGTGGTACCACCGGGCACCGGCATTGTGCACCAGGTAA
ACATCGAATATCTGGCTAGTGTCGTGATGACTCAGGAGAATACCCAAGGA
ACAGTAGTGGCATACCCCGACACCTGCGTAGGCACCGACTCGCACACCAC
GATGGTCAACGGGCTCGGCGTCCTAGGCTGGGGCGTAGGTGGCATCGAAG
CTGAGGCCGCCATGTTGGGCCAGCCGGTGTCGATGCTGATCCCGTGGGTG
GTCGGCTTCAAGCTGAGTGGTGAGATTCAGCCAGGTGTTACAGCCACCGA
CGTCGTACTGACTGTCACCGAAATGTTGCGCAGGCACGGTGTTGTTGGCA
AGTTCGTCGAGTTCTACGGCGAGGGCGTGGCCGAGGTACCGCTGGCCAAT
CGCGCCACTCTGGGCAATATGAGCCCTGAATTCGGTTCCACTGCAGCAAT
TTTTCCGATCGACGAAGAGACGATTAACTACCTGCGGTTCACCGGGCGCA
CGCCTGAGCAAGTTGCCCTGGTCGAGGGTTACGCCAAAGAGCAAGGCATG
TGGCACGACCCCAAGAATGAGCCGACGTTCTCCGAATACCTCGAACTAAA
CCTCTCCGATGTGGTACCGTCGATCTCCGGACCGAAACGTCCGCAGGACC
GAATCTGCTTGGCGCAAGCCAAGTCCACGTTCCGCGCGCAAATTCCTAAG
TATGTTGACGGCAGTTCGCTCCACAACCAACATTCGAAGTTGGACGAGGT
AGTCGAGGAGACATGCCCAGCCAGCGACCCGGGGAAGCTGTCGTTCACCA
ACAACGATGAGGTGGTAATGCAATCTGCGGCCGCGCATGCGAACGGCCGA
GTAAGCAACCCGGTGCGCATCAAGACGCAAGAACTCGGTGAGTTCGTGCT
CGACCACGGCGCGGTGGTGATCGCCGCGATCACATCTTGCACCAACACCT
CCAATCCTGAGGTTATGTTGTGTGCGGCGCTGCTGGCCCGCAACGCCGTC
GAAAAGGGACTGGCCTCCAAACCATGGGTGAAAACCACGATGGCGCCGGG
CTCGCAGGTGGTCAACGACTACTACGACCGGTCCGGTCTGTGGCCGTATT
TGGAAAAGCTCGGCTTCTATCTGGTCGGCTACGGCTGCACCACGTGTATT
GGCAACTCTGGCCCACTTCCCGAGGAGATTTCGAAAGCGATCAACTACAA
CAACCTTTCGGTGACCGCTGTGTTGTCGGGCAACCGAAACTTCGAGGGTC
GCATCAACCCCGATGTGAAGATGAACTACTTGGCCTCGCCACCACTAGTG
ATCGCCTACGCACTAGCCGGGACAATGGACTTCGACTTCGAGAGCCAGCC
GTTGGACACAGATAAAAACGGCAAGGCCGTCTACTTGAAAGACATCTGGC
CCTCGCAAAAAGACGTCACCGACACCATCGCCTCGGCAATCAATCAAGAG
ATGTTCACCAAGAACTATGCCGACGTTTTCAAGGGCGATGAACGCTGGCG
CAACTTGCCAACACCGAGCGGCAATACCTTTGATTGGGAACAGAATTCGA
CGTATGTGCGCAAACCTCCTTACTTCGAGGGAATGTCCGTAGAGCCCAAG
CCAGTGCGTAACATCACCGGCGCTCGAGTGCTAGCGCTGCTGGACGACTC
AGTGACCACCGACCACATCTCCCCCGCCAGCACCATCAAGCCGGGTACCC
CGGCAGCACAATACCTCGACACCCATGGCGTCGACCGCAAGGACTACAAT
TCCTTCGGGTCACGTCGCGGCAACCACGAAGTCATGATCCGTGGCACATT
TGCCAACATCAGACTGCGCAATATGCTGCTGAACGGCGTTGCGGGCGGGT
ACACCCGCGACTTCACCAAACCCGGTGCTCCGCAGGCGTTCATCTACGAC
GCGGCACAAAACTATGCGGCAGAAAACATTCCGTTGGTGGTACTCAGCGG
CAAGGAATATGGGTCCGGGTCATCGCGCGACTGGGCGGCCAAGGGCACGT
TGCTGTTAGGAGTGCGTGCGGTGATCGCCGAGTCGTTCGAACGCATCCAC
CGCTCCAACTTGATTGGTATGGGTGTGATCCCGCTACAATTCCCGCAGGG
CGAGTCGGCTTCGTCGCTCGGACTGGACGGTACCGAAGTGTTCGAGATCA
ACGGTATCGATGTGTTCAATAATGGCAAGACACCAAAAACTGTGCATGTC
AAAGCCAGCAAGGCTAGCGGAACCACAGTGACGTTCGATGCGTTGGTGCG
CATAGACACCCCCGGTGAGGCCGACTACTACCGCAACGGCGGAATTCTGC
ATTACGTGTTGCGCAACATACTGAAGTCAAAC---
>C1
VISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN
>C2
VISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN
>C3
VISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN
>C4
VISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN
>C5
oISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN
>C6
oISSKDSVNSFSARDTLKIGDNSYQIYRLDAVSNTKRLPYSLKVLAENLL
RNEDGKNITKDHIEAIANWDRQAEPSIEIQYTPARIVMQDFTGVPCIVDL
ATMREAIGDLGGNPEKVNPLARVDLVIDHSVIADLFGRADAFERNVEIEY
QRNGERYQFLRWGQGAFNDFKVVPPGTGIVHQVNIEYLASVVMTQENTQG
TVVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPWV
VGFKLSGEIQPGVTATDVVLTVTEMLRRHGVVGKFVEFYGEGVAEVPLAN
RATLGNMSPEFGSTAAIFPIDEETINYLRFTGRTPEQVALVEGYAKEQGM
WHDPKNEPTFSEYLELNLSDVVPSISGPKRPQDRICLAQAKSTFRAQIPK
YVDGSSLHNQHSKLDEVVEETCPASDPGKLSFTNNDEVVMQSAAAHANGR
VSNPVRIKTQELGEFVLDHGAVVIAAITSCTNTSNPEVMLCAALLARNAV
EKGLASKPWVKTTMAPGSQVVNDYYDRSGLWPYLEKLGFYLVGYGCTTCI
GNSGPLPEEISKAINYNNLSVTAVLSGNRNFEGRINPDVKMNYLASPPLV
IAYALAGTMDFDFESQPLDTDKNGKAVYLKDIWPSQKDVTDTIASAINQE
MFTKNYADVFKGDERWRNLPTPSGNTFDWEQNSTYVRKPPYFEGMSVEPK
PVRNITGARVLALLDDSVTTDHISPASTIKPGTPAAQYLDTHGVDRKDYN
SFGSRRGNHEVMIRGTFANIRLRNMLLNGVAGGYTRDFTKPGAPQAFIYD
AAQNYAAENIPLVVLSGKEYGSGSSRDWAAKGTLLLGVRAVIAESFERIH
RSNLIGMGVIPLQFPQGESASSLGLDGTEVFEINGIDVFNNGKTPKTVHV
KASKASGTTVTFDALVRIDTPGEADYYRNGGILHYVLRNILKSN


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/1res/acn/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 2835 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579770643
      Setting output file names to "/data/1res/acn/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1174325378
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 8168256282
      Seed = 389306987
      Swapseed = 1579770643
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 6 unique site patterns
      Division 2 has 6 unique site patterns
      Division 3 has 6 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -6337.567191 -- -24.965149
         Chain 2 -- -6337.578290 -- -24.965149
         Chain 3 -- -6337.576860 -- -24.965149
         Chain 4 -- -6337.577431 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -6337.577927 -- -24.965149
         Chain 2 -- -6337.576860 -- -24.965149
         Chain 3 -- -6337.567191 -- -24.965149
         Chain 4 -- -6337.567191 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-6337.567] (-6337.578) (-6337.577) (-6337.577) * [-6337.578] (-6337.577) (-6337.567) (-6337.567) 
        500 -- [-3906.510] (-3912.686) (-3942.317) (-3919.930) * [-3904.358] (-3932.793) (-3917.487) (-3925.400) -- 0:00:00
       1000 -- (-3896.776) [-3900.818] (-3900.383) (-3912.924) * (-3895.986) (-3919.107) (-3908.585) [-3906.945] -- 0:00:00
       1500 -- (-3908.147) [-3897.920] (-3904.751) (-3899.326) * [-3898.825] (-3904.371) (-3902.021) (-3897.501) -- 0:00:00
       2000 -- (-3898.760) [-3894.891] (-3900.872) (-3897.743) * (-3899.563) (-3901.675) [-3903.232] (-3904.299) -- 0:00:00
       2500 -- (-3902.112) [-3904.183] (-3899.389) (-3914.270) * (-3904.292) (-3908.230) [-3905.686] (-3908.320) -- 0:00:00
       3000 -- (-3900.838) [-3902.930] (-3904.848) (-3895.080) * (-3902.786) (-3911.820) [-3902.431] (-3898.695) -- 0:00:00
       3500 -- (-3896.239) [-3900.723] (-3912.601) (-3900.173) * (-3907.099) (-3904.018) (-3900.760) [-3903.400] -- 0:00:00
       4000 -- (-3897.192) (-3894.652) [-3894.766] (-3900.050) * [-3896.564] (-3895.544) (-3909.860) (-3898.682) -- 0:00:00
       4500 -- [-3898.265] (-3897.711) (-3901.113) (-3903.444) * (-3896.399) (-3898.786) (-3906.817) [-3901.176] -- 0:00:00
       5000 -- (-3898.385) [-3895.699] (-3894.960) (-3900.334) * (-3906.709) [-3902.458] (-3909.540) (-3899.516) -- 0:00:00

      Average standard deviation of split frequencies: 0.095647

       5500 -- (-3905.311) (-3904.670) [-3896.869] (-3900.978) * [-3897.804] (-3894.724) (-3901.048) (-3902.077) -- 0:00:00
       6000 -- (-3905.900) (-3899.868) [-3901.833] (-3896.934) * (-3894.414) (-3904.019) [-3902.256] (-3897.580) -- 0:00:00
       6500 -- (-3898.671) [-3898.378] (-3898.382) (-3900.174) * (-3900.096) (-3900.880) (-3906.754) [-3897.848] -- 0:00:00
       7000 -- [-3900.955] (-3897.119) (-3896.158) (-3898.167) * (-3897.086) (-3908.782) [-3904.826] (-3899.456) -- 0:02:21
       7500 -- [-3898.750] (-3897.593) (-3897.533) (-3900.597) * (-3901.751) (-3902.060) [-3907.238] (-3898.866) -- 0:02:12
       8000 -- (-3902.168) (-3900.159) (-3900.394) [-3894.681] * [-3895.369] (-3900.079) (-3900.729) (-3902.321) -- 0:02:04
       8500 -- [-3895.466] (-3898.938) (-3900.993) (-3898.971) * (-3905.977) (-3901.663) [-3905.455] (-3901.327) -- 0:01:56
       9000 -- (-3894.464) [-3900.445] (-3900.246) (-3897.229) * (-3897.307) (-3910.629) (-3900.651) [-3893.868] -- 0:01:50
       9500 -- [-3905.501] (-3901.898) (-3897.081) (-3903.078) * (-3896.342) (-3896.586) [-3898.754] (-3903.393) -- 0:01:44
      10000 -- (-3898.456) (-3902.180) [-3896.755] (-3906.950) * (-3899.267) (-3896.513) (-3917.797) [-3899.409] -- 0:01:39

      Average standard deviation of split frequencies: 0.075761

      10500 -- (-3907.637) [-3907.007] (-3896.553) (-3898.745) * (-3897.831) (-3903.989) (-3902.510) [-3902.320] -- 0:01:34
      11000 -- (-3896.000) [-3898.050] (-3898.873) (-3900.471) * (-3897.404) [-3900.117] (-3895.099) (-3913.087) -- 0:01:29
      11500 -- [-3899.597] (-3899.194) (-3902.956) (-3898.707) * [-3903.295] (-3898.957) (-3906.382) (-3900.620) -- 0:01:25
      12000 -- (-3895.981) [-3893.350] (-3898.554) (-3899.305) * (-3906.156) (-3904.038) (-3897.898) [-3901.514] -- 0:01:22
      12500 -- [-3898.205] (-3902.144) (-3898.855) (-3900.838) * (-3903.514) (-3897.285) [-3897.401] (-3904.001) -- 0:01:19
      13000 -- (-3895.679) (-3893.568) (-3897.879) [-3899.152] * (-3901.397) (-3897.129) [-3899.634] (-3901.023) -- 0:01:15
      13500 -- (-3899.551) (-3895.021) (-3908.579) [-3899.676] * (-3901.801) (-3902.823) [-3905.227] (-3898.660) -- 0:01:13
      14000 -- (-3897.378) [-3898.077] (-3897.144) (-3909.619) * (-3899.724) (-3900.192) [-3902.325] (-3895.904) -- 0:01:10
      14500 -- [-3902.527] (-3902.179) (-3895.819) (-3904.700) * (-3906.511) (-3902.092) [-3898.443] (-3899.951) -- 0:01:07
      15000 -- (-3896.397) [-3904.873] (-3896.363) (-3908.642) * [-3896.606] (-3897.476) (-3895.862) (-3900.732) -- 0:01:05

      Average standard deviation of split frequencies: 0.069780

      15500 -- [-3898.789] (-3904.537) (-3898.569) (-3898.712) * (-3909.473) (-3899.059) (-3895.487) [-3898.150] -- 0:01:03
      16000 -- [-3897.362] (-3909.096) (-3898.160) (-3895.376) * (-3898.899) (-3895.505) (-3890.000) [-3897.074] -- 0:01:01
      16500 -- (-3900.853) (-3899.096) [-3901.262] (-3894.422) * [-3897.850] (-3900.745) (-3889.163) (-3896.152) -- 0:00:59
      17000 -- (-3898.759) (-3901.380) [-3904.054] (-3903.121) * (-3897.039) [-3897.771] (-3891.252) (-3899.087) -- 0:00:57
      17500 -- (-3902.662) [-3895.236] (-3901.459) (-3899.000) * (-3906.355) (-3903.577) (-3891.654) [-3900.458] -- 0:00:56
      18000 -- (-3905.334) (-3907.392) [-3900.017] (-3906.235) * (-3902.512) (-3898.693) (-3892.049) [-3900.497] -- 0:01:49
      18500 -- (-3901.808) (-3898.356) (-3900.086) [-3897.831] * [-3902.808] (-3901.528) (-3891.951) (-3898.626) -- 0:01:46
      19000 -- (-3896.731) (-3900.513) (-3899.066) [-3893.486] * (-3903.093) (-3899.252) (-3893.686) [-3898.357] -- 0:01:43
      19500 -- (-3905.659) (-3902.017) [-3894.921] (-3898.783) * (-3901.174) (-3899.669) [-3890.744] (-3898.899) -- 0:01:40
      20000 -- (-3898.592) (-3901.244) (-3897.121) [-3896.831] * (-3898.748) (-3901.697) (-3891.124) [-3897.456] -- 0:01:38

      Average standard deviation of split frequencies: 0.056424

      20500 -- (-3901.394) (-3904.026) (-3897.590) [-3894.919] * (-3896.587) (-3894.585) (-3893.316) [-3899.562] -- 0:01:35
      21000 -- (-3903.732) (-3897.670) [-3892.243] (-3900.377) * (-3908.723) (-3891.540) (-3892.073) [-3900.392] -- 0:01:33
      21500 -- (-3905.133) (-3899.202) [-3898.081] (-3899.409) * [-3900.338] (-3890.884) (-3894.267) (-3905.142) -- 0:01:31
      22000 -- (-3900.108) (-3896.088) (-3897.311) [-3896.626] * [-3899.128] (-3891.696) (-3890.371) (-3899.076) -- 0:01:28
      22500 -- (-3899.445) [-3903.168] (-3898.519) (-3900.863) * (-3899.511) (-3892.241) (-3889.993) [-3898.676] -- 0:01:26
      23000 -- (-3903.836) (-3899.498) (-3903.112) [-3900.841] * (-3899.430) (-3891.677) [-3889.578] (-3901.403) -- 0:01:24
      23500 -- (-3899.417) [-3901.781] (-3904.452) (-3903.146) * (-3906.443) (-3892.733) (-3892.436) [-3904.237] -- 0:01:23
      24000 -- (-3907.059) [-3898.596] (-3902.838) (-3898.378) * (-3896.963) (-3892.032) [-3895.896] (-3897.997) -- 0:01:21
      24500 -- [-3902.641] (-3895.701) (-3901.254) (-3901.468) * [-3902.993] (-3890.983) (-3895.896) (-3901.829) -- 0:01:19
      25000 -- [-3901.703] (-3901.717) (-3897.131) (-3899.116) * (-3912.129) (-3893.489) (-3890.361) [-3898.532] -- 0:01:18

      Average standard deviation of split frequencies: 0.045327

      25500 -- (-3894.205) (-3900.446) (-3901.575) [-3904.168] * (-3910.020) (-3893.491) (-3890.599) [-3898.153] -- 0:01:16
      26000 -- (-3911.162) (-3904.475) [-3895.726] (-3896.606) * (-3899.349) (-3891.462) (-3894.789) [-3901.415] -- 0:01:14
      26500 -- (-3895.573) (-3903.246) (-3899.232) [-3901.892] * [-3896.488] (-3891.222) (-3894.375) (-3898.300) -- 0:01:13
      27000 -- (-3904.032) (-3897.194) (-3895.501) [-3898.923] * (-3895.881) [-3890.788] (-3896.035) (-3911.140) -- 0:01:12
      27500 -- (-3901.947) [-3901.230] (-3901.514) (-3896.639) * [-3894.736] (-3890.784) (-3893.147) (-3911.746) -- 0:01:10
      28000 -- (-3902.635) (-3904.672) [-3902.320] (-3903.131) * [-3896.871] (-3890.765) (-3893.617) (-3905.885) -- 0:01:09
      28500 -- (-3899.446) (-3897.502) [-3898.339] (-3903.578) * (-3895.082) (-3890.440) [-3890.377] (-3896.221) -- 0:01:08
      29000 -- (-3904.067) (-3901.457) [-3899.378] (-3905.783) * (-3904.716) (-3890.366) [-3891.586] (-3897.346) -- 0:01:06
      29500 -- (-3906.891) [-3902.032] (-3900.501) (-3900.032) * (-3902.197) (-3890.575) (-3891.578) [-3896.574] -- 0:01:38
      30000 -- (-3902.164) (-3905.493) [-3898.720] (-3901.971) * [-3900.557] (-3892.515) (-3890.466) (-3897.666) -- 0:01:37

      Average standard deviation of split frequencies: 0.046814

      30500 -- (-3902.950) (-3896.709) (-3904.811) [-3897.581] * (-3899.545) [-3892.238] (-3890.617) (-3896.465) -- 0:01:35
      31000 -- (-3898.792) [-3897.961] (-3901.101) (-3904.124) * [-3903.912] (-3892.191) (-3892.216) (-3902.353) -- 0:01:33
      31500 -- (-3897.546) (-3896.634) [-3902.579] (-3902.460) * (-3897.744) (-3890.905) (-3890.070) [-3895.540] -- 0:01:32
      32000 -- [-3899.660] (-3896.292) (-3899.950) (-3892.676) * (-3901.479) [-3889.520] (-3890.831) (-3900.323) -- 0:01:30
      32500 -- [-3898.944] (-3900.977) (-3898.542) (-3900.880) * (-3904.009) (-3889.414) [-3890.338] (-3903.364) -- 0:01:29
      33000 -- [-3898.727] (-3898.878) (-3905.069) (-3900.583) * (-3903.468) (-3890.979) (-3890.475) [-3896.748] -- 0:01:27
      33500 -- (-3901.562) (-3893.792) (-3893.951) [-3896.317] * (-3904.972) [-3894.052] (-3889.591) (-3902.316) -- 0:01:26
      34000 -- (-3907.370) (-3894.045) (-3896.248) [-3897.763] * (-3902.560) (-3894.072) (-3890.016) [-3901.563] -- 0:01:25
      34500 -- (-3899.198) (-3889.583) (-3898.587) [-3899.569] * [-3904.036] (-3893.726) (-3889.983) (-3896.590) -- 0:01:23
      35000 -- [-3902.201] (-3889.582) (-3901.418) (-3899.175) * [-3894.434] (-3893.010) (-3895.183) (-3897.669) -- 0:01:22

      Average standard deviation of split frequencies: 0.048013

      35500 -- [-3898.021] (-3890.135) (-3903.168) (-3893.753) * (-3893.731) (-3890.143) (-3894.239) [-3895.790] -- 0:01:21
      36000 -- [-3897.308] (-3890.575) (-3905.953) (-3903.459) * (-3894.546) (-3888.945) (-3889.604) [-3900.309] -- 0:01:20
      36500 -- (-3904.191) (-3890.676) (-3895.262) [-3904.378] * (-3891.104) (-3888.982) (-3889.604) [-3898.821] -- 0:01:19
      37000 -- (-3899.123) (-3890.686) (-3901.636) [-3902.174] * [-3894.293] (-3888.982) (-3889.604) (-3902.637) -- 0:01:18
      37500 -- [-3900.469] (-3890.660) (-3897.471) (-3902.092) * (-3891.964) [-3889.013] (-3889.781) (-3901.915) -- 0:01:17
      38000 -- [-3898.436] (-3890.342) (-3897.548) (-3911.734) * [-3891.252] (-3889.331) (-3893.212) (-3900.107) -- 0:01:15
      38500 -- (-3899.418) (-3890.400) (-3895.574) [-3900.439] * (-3890.562) (-3890.449) (-3890.447) [-3901.357] -- 0:01:14
      39000 -- [-3892.835] (-3890.261) (-3903.424) (-3896.717) * (-3890.434) (-3892.071) (-3890.463) [-3902.663] -- 0:01:13
      39500 -- [-3899.314] (-3890.043) (-3899.092) (-3896.980) * (-3890.309) [-3890.445] (-3889.736) (-3909.306) -- 0:01:12
      40000 -- [-3900.575] (-3890.173) (-3900.229) (-3899.769) * [-3888.909] (-3892.427) (-3889.717) (-3904.557) -- 0:01:12

      Average standard deviation of split frequencies: 0.039413

      40500 -- (-3901.846) (-3890.849) (-3904.676) [-3898.644] * (-3890.776) (-3892.474) [-3891.286] (-3898.813) -- 0:01:34
      41000 -- (-3905.004) [-3890.730] (-3900.637) (-3901.549) * (-3895.812) [-3892.767] (-3892.796) (-3910.029) -- 0:01:33
      41500 -- (-3900.048) (-3891.406) (-3901.128) [-3901.054] * (-3890.325) (-3892.765) [-3892.780] (-3907.638) -- 0:01:32
      42000 -- [-3901.771] (-3891.431) (-3898.070) (-3898.949) * [-3890.323] (-3892.022) (-3889.859) (-3906.643) -- 0:01:31
      42500 -- (-3911.228) [-3891.587] (-3896.608) (-3898.459) * (-3890.181) (-3889.245) (-3893.893) [-3903.407] -- 0:01:30
      43000 -- (-3903.235) (-3895.256) (-3899.911) [-3896.490] * (-3893.331) [-3889.164] (-3890.506) (-3900.433) -- 0:01:29
      43500 -- [-3899.811] (-3894.986) (-3899.521) (-3903.019) * (-3892.214) (-3889.184) [-3893.985] (-3912.118) -- 0:01:27
      44000 -- (-3897.711) (-3892.632) (-3895.452) [-3902.826] * [-3890.197] (-3889.207) (-3892.180) (-3895.410) -- 0:01:26
      44500 -- [-3895.427] (-3893.587) (-3901.134) (-3905.324) * (-3890.532) [-3889.208] (-3890.351) (-3897.322) -- 0:01:25
      45000 -- (-3895.747) (-3894.334) [-3897.602] (-3890.909) * (-3890.361) (-3889.208) [-3890.280] (-3895.457) -- 0:01:24

      Average standard deviation of split frequencies: 0.036112

      45500 -- (-3903.033) (-3894.487) [-3904.276] (-3890.847) * (-3889.096) (-3892.530) [-3890.181] (-3899.195) -- 0:01:23
      46000 -- (-3896.798) (-3891.879) (-3905.431) [-3889.910] * (-3890.658) (-3892.488) (-3889.630) [-3899.366] -- 0:01:22
      46500 -- (-3897.568) (-3889.812) (-3903.401) [-3890.017] * (-3889.080) (-3894.132) [-3891.004] (-3909.019) -- 0:01:22
      47000 -- (-3897.274) (-3889.819) (-3906.836) [-3889.560] * (-3889.008) (-3894.838) [-3889.760] (-3897.873) -- 0:01:21
      47500 -- [-3895.799] (-3893.060) (-3907.432) (-3889.936) * (-3889.009) (-3897.010) [-3889.961] (-3901.010) -- 0:01:20
      48000 -- (-3901.479) (-3896.518) [-3894.980] (-3892.875) * [-3889.009] (-3889.411) (-3889.832) (-3897.893) -- 0:01:19
      48500 -- (-3903.507) (-3894.125) (-3895.722) [-3890.833] * (-3889.293) (-3890.798) (-3890.061) [-3902.871] -- 0:01:18
      49000 -- [-3896.975] (-3893.395) (-3895.986) (-3890.632) * [-3890.183] (-3890.843) (-3890.059) (-3899.067) -- 0:01:17
      49500 -- (-3896.281) (-3893.854) [-3895.574] (-3890.631) * (-3890.325) (-3893.030) (-3892.476) [-3900.656] -- 0:01:16
      50000 -- [-3896.270] (-3889.947) (-3896.673) (-3889.264) * [-3890.360] (-3890.874) (-3892.477) (-3900.362) -- 0:01:16

      Average standard deviation of split frequencies: 0.034115

      50500 -- [-3903.428] (-3889.193) (-3904.587) (-3889.374) * (-3890.278) (-3890.874) (-3892.357) [-3898.870] -- 0:01:15
      51000 -- (-3908.312) (-3889.180) (-3909.340) [-3892.814] * (-3891.813) (-3891.248) [-3890.659] (-3900.153) -- 0:01:14
      51500 -- (-3905.508) [-3890.132] (-3898.067) (-3894.598) * (-3889.712) (-3889.740) (-3890.728) [-3899.975] -- 0:01:13
      52000 -- (-3900.157) (-3894.781) (-3899.303) [-3891.448] * (-3889.712) (-3890.658) [-3889.742] (-3905.085) -- 0:01:31
      52500 -- [-3897.501] (-3889.543) (-3907.183) (-3891.448) * (-3890.131) [-3890.303] (-3895.640) (-3902.968) -- 0:01:30
      53000 -- (-3911.047) (-3889.085) (-3902.200) [-3893.170] * [-3890.181] (-3891.069) (-3895.589) (-3897.047) -- 0:01:29
      53500 -- (-3899.451) [-3889.169] (-3896.954) (-3892.490) * (-3890.193) [-3889.358] (-3890.005) (-3905.629) -- 0:01:28
      54000 -- (-3903.100) [-3895.340] (-3906.698) (-3893.493) * (-3890.476) (-3889.362) [-3891.180] (-3913.882) -- 0:01:27
      54500 -- (-3900.778) (-3891.077) [-3898.352] (-3892.175) * (-3890.332) [-3889.391] (-3891.903) (-3903.168) -- 0:01:26
      55000 -- [-3898.666] (-3889.879) (-3900.713) (-3891.257) * (-3890.245) (-3889.391) [-3891.902] (-3914.130) -- 0:01:25

      Average standard deviation of split frequencies: 0.030866

      55500 -- (-3905.490) (-3891.162) [-3898.552] (-3893.054) * [-3889.960] (-3890.150) (-3891.903) (-3903.907) -- 0:01:25
      56000 -- (-3904.625) [-3890.198] (-3903.583) (-3893.334) * (-3890.116) (-3889.508) [-3890.211] (-3906.207) -- 0:01:24
      56500 -- (-3895.398) [-3891.678] (-3895.738) (-3889.555) * (-3889.464) (-3889.814) [-3892.014] (-3902.604) -- 0:01:23
      57000 -- [-3902.586] (-3893.099) (-3898.518) (-3889.707) * (-3889.834) (-3891.779) (-3892.652) [-3900.357] -- 0:01:22
      57500 -- (-3901.288) [-3894.336] (-3897.741) (-3890.007) * [-3890.164] (-3892.182) (-3890.312) (-3903.838) -- 0:01:21
      58000 -- (-3913.123) (-3894.327) [-3896.957] (-3890.015) * (-3889.058) (-3895.286) [-3890.876] (-3898.063) -- 0:01:21
      58500 -- [-3898.096] (-3896.397) (-3899.662) (-3890.007) * (-3891.026) (-3889.132) (-3898.937) [-3896.366] -- 0:01:20
      59000 -- (-3897.779) (-3891.919) (-3904.821) [-3889.771] * (-3894.051) (-3890.966) [-3895.367] (-3904.298) -- 0:01:19
      59500 -- (-3899.444) (-3892.050) [-3902.294] (-3889.771) * (-3891.417) (-3890.545) [-3890.868] (-3901.718) -- 0:01:19
      60000 -- [-3894.678] (-3890.243) (-3905.660) (-3892.300) * [-3890.804] (-3891.168) (-3891.026) (-3901.749) -- 0:01:18

      Average standard deviation of split frequencies: 0.028060

      60500 -- [-3896.283] (-3890.300) (-3899.223) (-3891.447) * (-3891.475) (-3891.313) (-3890.125) [-3895.887] -- 0:01:17
      61000 -- (-3899.231) [-3892.698] (-3904.418) (-3891.133) * (-3890.309) (-3891.548) (-3892.871) [-3901.119] -- 0:01:16
      61500 -- (-3900.040) [-3892.120] (-3903.992) (-3891.625) * (-3890.541) (-3894.575) (-3892.413) [-3898.521] -- 0:01:16
      62000 -- (-3901.733) (-3891.799) [-3899.025] (-3892.592) * (-3889.539) (-3895.934) [-3890.618] (-3897.895) -- 0:01:15
      62500 -- [-3898.388] (-3889.969) (-3904.856) (-3890.245) * (-3889.539) (-3895.567) (-3889.762) [-3896.849] -- 0:01:15
      63000 -- [-3902.129] (-3889.969) (-3918.248) (-3891.110) * (-3889.637) (-3889.959) (-3889.763) [-3899.621] -- 0:01:14
      63500 -- (-3899.589) [-3890.341] (-3909.526) (-3890.645) * (-3889.637) [-3889.638] (-3892.443) (-3896.826) -- 0:01:28
      64000 -- [-3900.384] (-3891.182) (-3912.886) (-3890.566) * (-3890.949) (-3889.725) (-3892.012) [-3898.467] -- 0:01:27
      64500 -- (-3902.820) (-3891.009) (-3900.352) [-3892.027] * [-3889.128] (-3888.989) (-3893.488) (-3897.422) -- 0:01:27
      65000 -- (-3913.610) (-3889.773) (-3910.092) [-3892.027] * (-3889.128) (-3888.989) (-3893.689) [-3901.963] -- 0:01:26

      Average standard deviation of split frequencies: 0.023213

      65500 -- (-3904.016) (-3891.293) (-3898.690) [-3891.183] * (-3891.889) [-3888.897] (-3891.700) (-3904.021) -- 0:01:25
      66000 -- [-3896.581] (-3893.141) (-3904.390) (-3890.281) * [-3891.411] (-3889.386) (-3891.529) (-3895.372) -- 0:01:24
      66500 -- [-3899.667] (-3894.263) (-3899.925) (-3890.772) * (-3889.228) [-3889.704] (-3892.875) (-3902.447) -- 0:01:24
      67000 -- (-3904.279) [-3894.658] (-3900.047) (-3891.344) * [-3889.561] (-3890.380) (-3892.004) (-3901.836) -- 0:01:23
      67500 -- [-3902.393] (-3892.843) (-3897.752) (-3891.398) * (-3889.920) (-3890.414) [-3891.750] (-3901.385) -- 0:01:22
      68000 -- (-3896.627) (-3890.900) [-3900.093] (-3892.844) * (-3895.451) (-3892.063) (-3890.980) [-3900.228] -- 0:01:22
      68500 -- (-3903.650) (-3890.900) (-3899.838) [-3890.693] * (-3892.381) (-3891.815) [-3891.332] (-3894.289) -- 0:01:21
      69000 -- (-3900.324) (-3890.789) [-3900.686] (-3889.991) * [-3891.855] (-3892.081) (-3891.161) (-3905.416) -- 0:01:20
      69500 -- [-3899.755] (-3890.285) (-3901.346) (-3890.672) * (-3891.437) (-3890.511) [-3888.875] (-3900.647) -- 0:01:20
      70000 -- (-3904.976) (-3889.845) (-3905.749) [-3892.567] * [-3890.260] (-3890.485) (-3889.419) (-3904.677) -- 0:01:19

      Average standard deviation of split frequencies: 0.021417

      70500 -- (-3904.343) (-3890.881) (-3911.511) [-3893.021] * (-3890.259) (-3890.878) [-3890.266] (-3894.527) -- 0:01:19
      71000 -- [-3901.142] (-3890.936) (-3905.292) (-3892.491) * (-3889.403) (-3891.152) [-3890.413] (-3907.256) -- 0:01:18
      71500 -- (-3897.347) [-3890.715] (-3907.673) (-3892.416) * (-3893.146) (-3889.646) (-3892.676) [-3902.051] -- 0:01:17
      72000 -- [-3898.796] (-3890.356) (-3899.704) (-3891.646) * [-3893.086] (-3890.695) (-3890.796) (-3895.742) -- 0:01:17
      72500 -- [-3898.166] (-3890.048) (-3903.113) (-3893.640) * (-3892.806) (-3892.783) [-3890.620] (-3900.732) -- 0:01:16
      73000 -- (-3893.656) [-3892.221] (-3897.095) (-3893.460) * (-3893.210) (-3892.520) (-3890.172) [-3897.588] -- 0:01:16
      73500 -- (-3900.276) (-3892.478) (-3904.366) [-3892.060] * (-3893.123) (-3894.671) (-3893.700) [-3899.674] -- 0:01:15
      74000 -- (-3894.046) [-3892.481] (-3909.993) (-3892.444) * (-3891.820) (-3897.413) (-3894.986) [-3898.113] -- 0:01:15
      74500 -- (-3905.296) (-3892.698) (-3898.936) [-3890.911] * (-3891.894) [-3894.773] (-3891.989) (-3896.236) -- 0:01:14
      75000 -- [-3900.411] (-3891.208) (-3896.014) (-3891.086) * (-3890.711) (-3894.997) (-3889.737) [-3898.362] -- 0:01:14

      Average standard deviation of split frequencies: 0.023570

      75500 -- [-3898.979] (-3889.838) (-3896.387) (-3890.640) * (-3890.705) [-3893.349] (-3890.641) (-3901.410) -- 0:01:25
      76000 -- [-3905.483] (-3890.052) (-3898.727) (-3890.639) * (-3890.434) [-3893.155] (-3890.983) (-3900.794) -- 0:01:25
      76500 -- [-3895.713] (-3889.922) (-3899.855) (-3889.636) * (-3892.383) (-3890.864) [-3891.128] (-3898.871) -- 0:01:24
      77000 -- (-3898.709) [-3889.771] (-3897.474) (-3890.215) * (-3890.465) (-3890.729) [-3893.717] (-3905.079) -- 0:01:23
      77500 -- (-3903.266) (-3889.774) [-3898.202] (-3890.147) * (-3891.420) [-3890.452] (-3898.075) (-3902.460) -- 0:01:23
      78000 -- (-3896.647) (-3889.685) (-3899.792) [-3891.430] * (-3890.447) [-3889.682] (-3894.907) (-3905.302) -- 0:01:22
      78500 -- (-3906.846) (-3892.034) [-3907.329] (-3891.254) * [-3890.204] (-3891.771) (-3897.189) (-3892.282) -- 0:01:22
      79000 -- (-3897.474) (-3891.481) (-3899.688) [-3889.332] * [-3889.602] (-3893.034) (-3904.197) (-3893.567) -- 0:01:21
      79500 -- [-3904.264] (-3890.970) (-3904.437) (-3889.113) * [-3891.072] (-3892.508) (-3904.689) (-3894.612) -- 0:01:21
      80000 -- (-3897.200) (-3891.110) [-3898.792] (-3890.956) * [-3889.911] (-3893.634) (-3894.006) (-3889.836) -- 0:01:20

      Average standard deviation of split frequencies: 0.026005

      80500 -- [-3897.989] (-3890.807) (-3900.338) (-3890.740) * [-3889.979] (-3895.074) (-3890.316) (-3889.273) -- 0:01:19
      81000 -- (-3897.767) (-3889.871) (-3911.475) [-3890.750] * (-3892.050) (-3892.831) (-3889.392) [-3889.775] -- 0:01:19
      81500 -- (-3902.737) (-3890.185) [-3897.706] (-3889.810) * (-3891.122) [-3892.722] (-3893.028) (-3889.300) -- 0:01:18
      82000 -- (-3898.024) [-3891.817] (-3900.495) (-3890.245) * (-3891.359) (-3892.844) (-3893.223) [-3889.300] -- 0:01:18
      82500 -- [-3897.474] (-3892.996) (-3898.110) (-3894.718) * (-3891.325) [-3891.735] (-3890.607) (-3888.832) -- 0:01:17
      83000 -- (-3905.321) [-3893.165] (-3898.089) (-3893.611) * (-3891.422) (-3890.811) [-3891.962] (-3889.034) -- 0:01:17
      83500 -- [-3899.710] (-3890.490) (-3903.355) (-3893.145) * (-3889.946) [-3890.855] (-3891.272) (-3890.072) -- 0:01:16
      84000 -- (-3899.993) (-3890.763) [-3901.741] (-3894.839) * (-3889.946) (-3895.322) (-3889.785) [-3892.878] -- 0:01:16
      84500 -- [-3899.774] (-3892.367) (-3903.488) (-3894.798) * (-3892.619) [-3892.546] (-3890.465) (-3890.376) -- 0:01:15
      85000 -- (-3894.297) [-3892.155] (-3896.092) (-3895.325) * (-3895.347) (-3890.082) (-3890.386) [-3889.625] -- 0:01:15

      Average standard deviation of split frequencies: 0.027929

      85500 -- (-3904.222) (-3890.743) [-3902.051] (-3891.200) * (-3891.131) (-3892.811) [-3890.196] (-3890.057) -- 0:01:14
      86000 -- (-3902.187) (-3891.043) (-3903.873) [-3891.780] * [-3889.841] (-3890.573) (-3890.385) (-3889.820) -- 0:01:14
      86500 -- (-3895.406) [-3891.166] (-3903.590) (-3892.307) * (-3889.993) (-3890.696) (-3890.943) [-3889.447] -- 0:01:24
      87000 -- (-3898.847) [-3891.234] (-3897.080) (-3891.430) * [-3889.993] (-3890.425) (-3889.976) (-3889.444) -- 0:01:23
      87500 -- (-3895.647) [-3891.389] (-3903.492) (-3891.428) * (-3890.658) (-3890.159) [-3889.883] (-3892.611) -- 0:01:23
      88000 -- [-3899.846] (-3891.404) (-3898.411) (-3891.419) * [-3890.658] (-3890.109) (-3889.775) (-3894.267) -- 0:01:22
      88500 -- [-3898.508] (-3891.898) (-3902.834) (-3890.627) * (-3890.463) (-3894.816) [-3889.683] (-3891.903) -- 0:01:22
      89000 -- (-3899.980) (-3891.547) [-3900.011] (-3891.862) * (-3892.940) (-3892.470) (-3891.062) [-3891.394] -- 0:01:21
      89500 -- [-3897.663] (-3892.067) (-3901.793) (-3890.650) * (-3893.421) [-3891.175] (-3891.300) (-3891.365) -- 0:01:21
      90000 -- (-3901.440) (-3893.227) [-3894.811] (-3890.932) * (-3897.644) [-3889.358] (-3892.096) (-3891.881) -- 0:01:20

      Average standard deviation of split frequencies: 0.026818

      90500 -- [-3898.230] (-3893.532) (-3898.661) (-38