--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 09:45:50 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/adi/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/1res/adi/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/adi/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/1res/adi/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -3919.80         -3923.42
2      -3919.84         -3922.95
--------------------------------------
TOTAL    -3919.82         -3923.21
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/1res/adi/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/adi/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/adi/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.892221    0.090856    0.343788    1.472016    0.855877   1331.18   1416.09    1.000
r(A<->C){all}   0.153062    0.017561    0.000019    0.424047    0.117006    285.85    303.56    1.000
r(A<->G){all}   0.152871    0.019527    0.000075    0.425897    0.111755    157.00    230.00    1.002
r(A<->T){all}   0.160404    0.018147    0.000074    0.428947    0.125071    157.69    243.29    1.001
r(C<->G){all}   0.151636    0.017908    0.000018    0.419207    0.117061    187.24    271.14    1.000
r(C<->T){all}   0.211384    0.025681    0.000044    0.528968    0.175542    194.81    235.09    1.010
r(G<->T){all}   0.170643    0.020786    0.000098    0.468221    0.132115    192.26    219.02    1.000
pi(A){all}      0.194957    0.000056    0.180949    0.209990    0.194903   1048.26   1071.50    1.000
pi(C){all}      0.289300    0.000070    0.273576    0.306309    0.289158   1199.00   1317.45    1.000
pi(G){all}      0.298757    0.000073    0.282761    0.315609    0.298779    721.24    988.47    1.000
pi(T){all}      0.216985    0.000058    0.202596    0.231637    0.216901   1290.86   1386.71    1.000
alpha{1,2}      0.332502    0.159336    0.001568    1.172865    0.200982   1106.86   1193.48    1.000
alpha{3}        0.438101    0.259145    0.000155    1.465323    0.247265   1249.22   1257.28    1.000
pinvar{all}     0.998912    0.000001    0.997193    0.999983    0.999153   1076.52   1110.57    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-3777.558199
Model 2: PositiveSelection	-3777.185545
Model 0: one-ratio	-3777.185397
Model 7: beta	-3777.558199
Model 8: beta&w>1	-3777.185545


Model 0 vs 1	0.7456039999997301

Model 2 vs 1	0.7453080000004775

Model 8 vs 7	0.7453080000004775
>C1
MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA

>C2
MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA

>C3
MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA

>C4
MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA

>C5
MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA

>C6
MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRILV
STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA

CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=950 

C1              MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
C2              MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
C3              MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
C4              MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
C5              MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
C6              MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
                **************************************************

C1              AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
C2              AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
C3              AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
C4              AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
C5              AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
C6              AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
                **************************************************

C1              AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
C2              AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
C3              AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
C4              AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
C5              AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
C6              AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
                **************************************************

C1              CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
C2              CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
C3              CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
C4              CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
C5              CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
C6              CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
                **************************************************

C1              RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
C2              RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
C3              RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
C4              RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
C5              RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
C6              RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
                **************************************************

C1              TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
C2              TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
C3              TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
C4              TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
C5              TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
C6              TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
                **************************************************

C1              AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
C2              AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
C3              AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
C4              AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
C5              AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
C6              AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
                **************************************************

C1              DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
C2              DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
C3              DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
C4              DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
C5              DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
C6              DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
                **************************************************

C1              VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
C2              VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
C3              VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
C4              VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
C5              VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
C6              VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
                **************************************************

C1              LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
C2              LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
C3              LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
C4              LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
C5              LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
C6              LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
                **************************************************

C1              AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
C2              AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
C3              AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
C4              AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
C5              AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
C6              AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
                **************************************************

C1              DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
C2              DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
C3              DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
C4              DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
C5              DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
C6              DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
                **************************************************

C1              EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
C2              EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
C3              EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
C4              EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
C5              EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
C6              EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
                **************************************************

C1              DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
C2              DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
C3              DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
C4              DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
C5              DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
C6              DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
                **************************************************

C1              LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
C2              LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
C3              LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
C4              LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
C5              LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
C6              LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
                **************************************************

C1              WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
C2              WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
C3              WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
C4              WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
C5              WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
C6              WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
                **************************************************

C1              SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
C2              SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
C3              SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
C4              SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
C5              SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
C6              SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRILV
                *********************************************** **

C1              STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
C2              STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
C3              STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
C4              STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
C5              STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
C6              STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
                **************************************************

C1              EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA
C2              EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA
C3              EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA
C4              EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA
C5              EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA
C6              EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA
                **************************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  950 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  950 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [28500]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [28500]--->[28500]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.680 Mb, Max= 31.693 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
C2              MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
C3              MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
C4              MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
C5              MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
C6              MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
                **************************************************

C1              AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
C2              AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
C3              AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
C4              AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
C5              AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
C6              AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
                **************************************************

C1              AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
C2              AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
C3              AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
C4              AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
C5              AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
C6              AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
                **************************************************

C1              CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
C2              CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
C3              CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
C4              CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
C5              CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
C6              CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
                **************************************************

C1              RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
C2              RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
C3              RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
C4              RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
C5              RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
C6              RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
                **************************************************

C1              TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
C2              TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
C3              TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
C4              TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
C5              TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
C6              TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
                **************************************************

C1              AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
C2              AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
C3              AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
C4              AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
C5              AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
C6              AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
                **************************************************

C1              DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
C2              DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
C3              DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
C4              DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
C5              DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
C6              DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
                **************************************************

C1              VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
C2              VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
C3              VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
C4              VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
C5              VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
C6              VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
                **************************************************

C1              LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
C2              LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
C3              LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
C4              LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
C5              LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
C6              LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
                **************************************************

C1              AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
C2              AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
C3              AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
C4              AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
C5              AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
C6              AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
                **************************************************

C1              DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
C2              DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
C3              DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
C4              DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
C5              DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
C6              DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
                **************************************************

C1              EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
C2              EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
C3              EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
C4              EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
C5              EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
C6              EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
                **************************************************

C1              DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
C2              DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
C3              DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
C4              DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
C5              DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
C6              DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
                **************************************************

C1              LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
C2              LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
C3              LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
C4              LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
C5              LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
C6              LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
                **************************************************

C1              WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
C2              WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
C3              WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
C4              WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
C5              WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
C6              WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
                **************************************************

C1              SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
C2              SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
C3              SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
C4              SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
C5              SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
C6              SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRILV
                *********************************************** **

C1              STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
C2              STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
C3              STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
C4              STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
C5              STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
C6              STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
                **************************************************

C1              EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA
C2              EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA
C3              EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA
C4              EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA
C5              EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA
C6              EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA
                **************************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 99.89 C1	 C6	 99.89
TOP	    5    0	 99.89 C6	 C1	 99.89
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 99.89 C2	 C6	 99.89
TOP	    5    1	 99.89 C6	 C2	 99.89
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 99.89 C3	 C6	 99.89
TOP	    5    2	 99.89 C6	 C3	 99.89
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 99.89 C4	 C6	 99.89
TOP	    5    3	 99.89 C6	 C4	 99.89
BOT	    4    5	 99.89 C5	 C6	 99.89
TOP	    5    4	 99.89 C6	 C5	 99.89
AVG	 0	 C1	  *	 99.98
AVG	 1	 C2	  *	 99.98
AVG	 2	 C3	  *	 99.98
AVG	 3	 C4	  *	 99.98
AVG	 4	 C5	  *	 99.98
AVG	 5	 C6	  *	 99.89
TOT	 TOT	  *	 99.96
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAATCGAGACAGTGGCCATCCGCGACGACTTCGTGTTTCCGCGCTGGC
C2              ATGAATCGAGACAGTGGCCATCCGCGACGACTTCGTGTTTCCGCGCTGGC
C3              ATGAATCGAGACAGTGGCCATCCGCGACGACTTCGTGTTTCCGCGCTGGC
C4              ATGAATCGAGACAGTGGCCATCCGCGACGACTTCGTGTTTCCGCGCTGGC
C5              ATGAATCGAGACAGTGGCCATCCGCGACGACTTCGTGTTTCCGCGCTGGC
C6              ATGAATCGAGACAGTGGCCATCCGCGACGACTTCGTGTTTCCGCGCTGGC
                **************************************************

C1              GGCAGTAGCCAACCCGTCATACACGCGCATTGACACGTGGAACGTGCTCG
C2              GGCAGTAGCCAACCCGTCATACACGCGCATTGACACGTGGAACGTGCTCG
C3              GGCAGTAGCCAACCCGTCATACACGCGCATTGACACGTGGAACGTGCTCG
C4              GGCAGTAGCCAACCCGTCATACACGCGCATTGACACGTGGAACGTGCTCG
C5              GGCAGTAGCCAACCCGTCATACACGCGCATTGACACGTGGAACGTGCTCG
C6              GGCAGTAGCCAACCCGTCATACACGCGCATTGACACGTGGAACGTGCTCG
                **************************************************

C1              ATGACGCCTGCCGTCACTTGGCTGAGGTCGACCGCGCCGGGCTGGACACC
C2              ATGACGCCTGCCGTCACTTGGCTGAGGTCGACCGCGCCGGGCTGGACACC
C3              ATGACGCCTGCCGTCACTTGGCTGAGGTCGACCGCGCCGGGCTGGACACC
C4              ATGACGCCTGCCGTCACTTGGCTGAGGTCGACCGCGCCGGGCTGGACACC
C5              ATGACGCCTGCCGTCACTTGGCTGAGGTCGACCGCGCCGGGCTGGACACC
C6              ATGACGCCTGCCGTCACTTGGCTGAGGTCGACCGCGCCGGGCTGGACACC
                **************************************************

C1              GCCCACGATGTTGCGCGTGTTAAGCGTTTGCTCGACCGCATCGGTGCCTA
C2              GCCCACGATGTTGCGCGTGTTAAGCGTTTGCTCGACCGCATCGGTGCCTA
C3              GCCCACGATGTTGCGCGTGTTAAGCGTTTGCTCGACCGCATCGGTGCCTA
C4              GCCCACGATGTTGCGCGTGTTAAGCGTTTGCTCGACCGCATCGGTGCCTA
C5              GCCCACGATGTTGCGCGTGTTAAGCGTTTGCTCGACCGCATCGGTGCCTA
C6              GCCCACGATGTTGCGCGTGTTAAGCGTTTGCTCGACCGCATCGGTGCCTA
                **************************************************

C1              CGAACGGTACTGGCTGTACCCTGGTGCGGCAAATCTGGCGGCGTTCCGCG
C2              CGAACGGTACTGGCTGTACCCTGGTGCGGCAAATCTGGCGGCGTTCCGCG
C3              CGAACGGTACTGGCTGTACCCTGGTGCGGCAAATCTGGCGGCGTTCCGCG
C4              CGAACGGTACTGGCTGTACCCTGGTGCGGCAAATCTGGCGGCGTTCCGCG
C5              CGAACGGTACTGGCTGTACCCTGGTGCGGCAAATCTGGCGGCGTTCCGCG
C6              CGAACGGTACTGGCTGTACCCTGGTGCGGCAAATCTGGCGGCGTTCCGCG
                **************************************************

C1              GCTATCTTGCCACCATGGCGACGGTTCAGCTTACCGAAGAGGTATCGCTG
C2              GCTATCTTGCCACCATGGCGACGGTTCAGCTTACCGAAGAGGTATCGCTG
C3              GCTATCTTGCCACCATGGCGACGGTTCAGCTTACCGAAGAGGTATCGCTG
C4              GCTATCTTGCCACCATGGCGACGGTTCAGCTTACCGAAGAGGTATCGCTG
C5              GCTATCTTGCCACCATGGCGACGGTTCAGCTTACCGAAGAGGTATCGCTG
C6              GCTATCTTGCCACCATGGCGACGGTTCAGCTTACCGAAGAGGTATCGCTG
                **************************************************

C1              GCCGTCCGTCTGTTGTCTGAATATGGTGACCGCACAGCGCTTTTTGATAC
C2              GCCGTCCGTCTGTTGTCTGAATATGGTGACCGCACAGCGCTTTTTGATAC
C3              GCCGTCCGTCTGTTGTCTGAATATGGTGACCGCACAGCGCTTTTTGATAC
C4              GCCGTCCGTCTGTTGTCTGAATATGGTGACCGCACAGCGCTTTTTGATAC
C5              GCCGTCCGTCTGTTGTCTGAATATGGTGACCGCACAGCGCTTTTTGATAC
C6              GCCGTCCGTCTGTTGTCTGAATATGGTGACCGCACAGCGCTTTTTGATAC
                **************************************************

C1              TTCAGCGCCGCTGGCCGACCAGGAGCTGGTGGCCCAAGCCAAGCAGCAAC
C2              TTCAGCGCCGCTGGCCGACCAGGAGCTGGTGGCCCAAGCCAAGCAGCAAC
C3              TTCAGCGCCGCTGGCCGACCAGGAGCTGGTGGCCCAAGCCAAGCAGCAAC
C4              TTCAGCGCCGCTGGCCGACCAGGAGCTGGTGGCCCAAGCCAAGCAGCAAC
C5              TTCAGCGCCGCTGGCCGACCAGGAGCTGGTGGCCCAAGCCAAGCAGCAAC
C6              TTCAGCGCCGCTGGCCGACCAGGAGCTGGTGGCCCAAGCCAAGCAGCAAC
                **************************************************

C1              AGTTCTACACCGTGTTGCTCGCCGACGATGCCCCATCCACGGCTCCCGAC
C2              AGTTCTACACCGTGTTGCTCGCCGACGATGCCCCATCCACGGCTCCCGAC
C3              AGTTCTACACCGTGTTGCTCGCCGACGATGCCCCATCCACGGCTCCCGAC
C4              AGTTCTACACCGTGTTGCTCGCCGACGATGCCCCATCCACGGCTCCCGAC
C5              AGTTCTACACCGTGTTGCTCGCCGACGATGCCCCATCCACGGCTCCCGAC
C6              AGTTCTACACCGTGTTGCTCGCCGACGATGCCCCATCCACGGCTCCCGAC
                **************************************************

C1              TGTCTGGCAGAGAGCTTGCGGGAGCTGCGCAATCCATCCGACGATGTGCA
C2              TGTCTGGCAGAGAGCTTGCGGGAGCTGCGCAATCCATCCGACGATGTGCA
C3              TGTCTGGCAGAGAGCTTGCGGGAGCTGCGCAATCCATCCGACGATGTGCA
C4              TGTCTGGCAGAGAGCTTGCGGGAGCTGCGCAATCCATCCGACGATGTGCA
C5              TGTCTGGCAGAGAGCTTGCGGGAGCTGCGCAATCCATCCGACGATGTGCA
C6              TGTCTGGCAGAGAGCTTGCGGGAGCTGCGCAATCCATCCGACGATGTGCA
                **************************************************

C1              GTTCGAGCTCCTTGTTGTGTCCAGTGTTGAGGACGCCATCACCGCGGTCG
C2              GTTCGAGCTCCTTGTTGTGTCCAGTGTTGAGGACGCCATCACCGCGGTCG
C3              GTTCGAGCTCCTTGTTGTGTCCAGTGTTGAGGACGCCATCACCGCGGTCG
C4              GTTCGAGCTCCTTGTTGTGTCCAGTGTTGAGGACGCCATCACCGCGGTCG
C5              GTTCGAGCTCCTTGTTGTGTCCAGTGTTGAGGACGCCATCACCGCGGTCG
C6              GTTCGAGCTCCTTGTTGTGTCCAGTGTTGAGGACGCCATCACCGCGGTCG
                **************************************************

C1              CGCTGAACGGCGAGATTCAGGCTGCGATCATCCGCCATGACCTGCCACTG
C2              CGCTGAACGGCGAGATTCAGGCTGCGATCATCCGCCATGACCTGCCACTG
C3              CGCTGAACGGCGAGATTCAGGCTGCGATCATCCGCCATGACCTGCCACTG
C4              CGCTGAACGGCGAGATTCAGGCTGCGATCATCCGCCATGACCTGCCACTG
C5              CGCTGAACGGCGAGATTCAGGCTGCGATCATCCGCCATGACCTGCCACTG
C6              CGCTGAACGGCGAGATTCAGGCTGCGATCATCCGCCATGACCTGCCACTG
                **************************************************

C1              CGGTCCCGCGACCGGGTGCCGTTGATGAATACCTTGCTTGGGGCCAACGA
C2              CGGTCCCGCGACCGGGTGCCGTTGATGAATACCTTGCTTGGGGCCAACGA
C3              CGGTCCCGCGACCGGGTGCCGTTGATGAATACCTTGCTTGGGGCCAACGA
C4              CGGTCCCGCGACCGGGTGCCGTTGATGAATACCTTGCTTGGGGCCAACGA
C5              CGGTCCCGCGACCGGGTGCCGTTGATGAATACCTTGCTTGGGGCCAACGA
C6              CGGTCCCGCGACCGGGTGCCGTTGATGAATACCTTGCTTGGGGCCAACGA
                **************************************************

C1              CTCGGAGGGCGCACTGGTCACCATTGACCGCCCACACGACTGGGTCGAAT
C2              CTCGGAGGGCGCACTGGTCACCATTGACCGCCCACACGACTGGGTCGAAT
C3              CTCGGAGGGCGCACTGGTCACCATTGACCGCCCACACGACTGGGTCGAAT
C4              CTCGGAGGGCGCACTGGTCACCATTGACCGCCCACACGACTGGGTCGAAT
C5              CTCGGAGGGCGCACTGGTCACCATTGACCGCCCACACGACTGGGTCGAAT
C6              CTCGGAGGGCGCACTGGTCACCATTGACCGCCCACACGACTGGGTCGAAT
                **************************************************

C1              GCGGTGAGTGGATCAGGGAGCTGCGGCCCCATATCGACCTCTATCTGCTC
C2              GCGGTGAGTGGATCAGGGAGCTGCGGCCCCATATCGACCTCTATCTGCTC
C3              GCGGTGAGTGGATCAGGGAGCTGCGGCCCCATATCGACCTCTATCTGCTC
C4              GCGGTGAGTGGATCAGGGAGCTGCGGCCCCATATCGACCTCTATCTGCTC
C5              GCGGTGAGTGGATCAGGGAGCTGCGGCCCCATATCGACCTCTATCTGCTC
C6              GCGGTGAGTGGATCAGGGAGCTGCGGCCCCATATCGACCTCTATCTGCTC
                **************************************************

C1              ACCGACGAGTCGATCGCGGCGGGCAATGATGACGAGCCCGATGTCTACGA
C2              ACCGACGAGTCGATCGCGGCGGGCAATGATGACGAGCCCGATGTCTACGA
C3              ACCGACGAGTCGATCGCGGCGGGCAATGATGACGAGCCCGATGTCTACGA
C4              ACCGACGAGTCGATCGCGGCGGGCAATGATGACGAGCCCGATGTCTACGA
C5              ACCGACGAGTCGATCGCGGCGGGCAATGATGACGAGCCCGATGTCTACGA
C6              ACCGACGAGTCGATCGCGGCGGGCAATGATGACGAGCCCGATGTCTACGA
                **************************************************

C1              CCGGACGTTTTATCGACTCAACGACGTTACCGACCTAAACAGCACCGTAC
C2              CCGGACGTTTTATCGACTCAACGACGTTACCGACCTAAACAGCACCGTAC
C3              CCGGACGTTTTATCGACTCAACGACGTTACCGACCTAAACAGCACCGTAC
C4              CCGGACGTTTTATCGACTCAACGACGTTACCGACCTAAACAGCACCGTAC
C5              CCGGACGTTTTATCGACTCAACGACGTTACCGACCTAAACAGCACCGTAC
C6              CCGGACGTTTTATCGACTCAACGACGTTACCGACCTAAACAGCACCGTAC
                **************************************************

C1              TTGCAGGCTTGCGAAACCGTTTCGCCACACCATTTTTCGATGCCTTGCGC
C2              TTGCAGGCTTGCGAAACCGTTTCGCCACACCATTTTTCGATGCCTTGCGC
C3              TTGCAGGCTTGCGAAACCGTTTCGCCACACCATTTTTCGATGCCTTGCGC
C4              TTGCAGGCTTGCGAAACCGTTTCGCCACACCATTTTTCGATGCCTTGCGC
C5              TTGCAGGCTTGCGAAACCGTTTCGCCACACCATTTTTCGATGCCTTGCGC
C6              TTGCAGGCTTGCGAAACCGTTTCGCCACACCATTTTTCGATGCCTTGCGC
                **************************************************

C1              GCCTACGCAGCAGCACCGGTCGGCCAATTCCATGCTCTTCCGGTCGCGCG
C2              GCCTACGCAGCAGCACCGGTCGGCCAATTCCATGCTCTTCCGGTCGCGCG
C3              GCCTACGCAGCAGCACCGGTCGGCCAATTCCATGCTCTTCCGGTCGCGCG
C4              GCCTACGCAGCAGCACCGGTCGGCCAATTCCATGCTCTTCCGGTCGCGCG
C5              GCCTACGCAGCAGCACCGGTCGGCCAATTCCATGCTCTTCCGGTCGCGCG
C6              GCCTACGCAGCAGCACCGGTCGGCCAATTCCATGCTCTTCCGGTCGCGCG
                **************************************************

C1              TGGTGCCAGTATCTTTAACTCTAGGTCGCTGCAAGACATGGGCGAGTTCT
C2              TGGTGCCAGTATCTTTAACTCTAGGTCGCTGCAAGACATGGGCGAGTTCT
C3              TGGTGCCAGTATCTTTAACTCTAGGTCGCTGCAAGACATGGGCGAGTTCT
C4              TGGTGCCAGTATCTTTAACTCTAGGTCGCTGCAAGACATGGGCGAGTTCT
C5              TGGTGCCAGTATCTTTAACTCTAGGTCGCTGCAAGACATGGGCGAGTTCT
C6              TGGTGCCAGTATCTTTAACTCTAGGTCGCTGCAAGACATGGGCGAGTTCT
                **************************************************

C1              ACGGTCGGAACATCTTCATGGCCGAGACATCGACCACCTCTGGTGGCCTG
C2              ACGGTCGGAACATCTTCATGGCCGAGACATCGACCACCTCTGGTGGCCTG
C3              ACGGTCGGAACATCTTCATGGCCGAGACATCGACCACCTCTGGTGGCCTG
C4              ACGGTCGGAACATCTTCATGGCCGAGACATCGACCACCTCTGGTGGCCTG
C5              ACGGTCGGAACATCTTCATGGCCGAGACATCGACCACCTCTGGTGGCCTG
C6              ACGGTCGGAACATCTTCATGGCCGAGACATCGACCACCTCTGGTGGCCTG
                **************************************************

C1              GATTCGTTGCTGGATCCGCACGGCAACATCAAAAAAGCGATGGACAAAGC
C2              GATTCGTTGCTGGATCCGCACGGCAACATCAAAAAAGCGATGGACAAAGC
C3              GATTCGTTGCTGGATCCGCACGGCAACATCAAAAAAGCGATGGACAAAGC
C4              GATTCGTTGCTGGATCCGCACGGCAACATCAAAAAAGCGATGGACAAAGC
C5              GATTCGTTGCTGGATCCGCACGGCAACATCAAAAAAGCGATGGACAAAGC
C6              GATTCGTTGCTGGATCCGCACGGCAACATCAAAAAAGCGATGGACAAAGC
                **************************************************

C1              CGCAGTTACTTGGCGCGCCAACCACACCTACTTTGTCACCAACGGAACTT
C2              CGCAGTTACTTGGCGCGCCAACCACACCTACTTTGTCACCAACGGAACTT
C3              CGCAGTTACTTGGCGCGCCAACCACACCTACTTTGTCACCAACGGAACTT
C4              CGCAGTTACTTGGCGCGCCAACCACACCTACTTTGTCACCAACGGAACTT
C5              CGCAGTTACTTGGCGCGCCAACCACACCTACTTTGTCACCAACGGAACTT
C6              CGCAGTTACTTGGCGCGCCAACCACACCTACTTTGTCACCAACGGAACTT
                **************************************************

C1              CCACAGCCAACAAAATCGTCGTACAGTCGTTGACCCGGCCAGGTGACATT
C2              CCACAGCCAACAAAATCGTCGTACAGTCGTTGACCCGGCCAGGTGACATT
C3              CCACAGCCAACAAAATCGTCGTACAGTCGTTGACCCGGCCAGGTGACATT
C4              CCACAGCCAACAAAATCGTCGTACAGTCGTTGACCCGGCCAGGTGACATT
C5              CCACAGCCAACAAAATCGTCGTACAGTCGTTGACCCGGCCAGGTGACATT
C6              CCACAGCCAACAAAATCGTCGTACAGTCGTTGACCCGGCCAGGTGACATT
                **************************************************

C1              GTACTTATAGACCGCAACTGCCACAAGTCGCACCATTATGGCCTGGTATT
C2              GTACTTATAGACCGCAACTGCCACAAGTCGCACCATTATGGCCTGGTATT
C3              GTACTTATAGACCGCAACTGCCACAAGTCGCACCATTATGGCCTGGTATT
C4              GTACTTATAGACCGCAACTGCCACAAGTCGCACCATTATGGCCTGGTATT
C5              GTACTTATAGACCGCAACTGCCACAAGTCGCACCATTATGGCCTGGTATT
C6              GTACTTATAGACCGCAACTGCCACAAGTCGCACCATTATGGCCTGGTATT
                **************************************************

C1              GGCTGGTGCATACCCGATGTACTTGGATGCTTATCCGTTGCCGCAGTTCG
C2              GGCTGGTGCATACCCGATGTACTTGGATGCTTATCCGTTGCCGCAGTTCG
C3              GGCTGGTGCATACCCGATGTACTTGGATGCTTATCCGTTGCCGCAGTTCG
C4              GGCTGGTGCATACCCGATGTACTTGGATGCTTATCCGTTGCCGCAGTTCG
C5              GGCTGGTGCATACCCGATGTACTTGGATGCTTATCCGTTGCCGCAGTTCG
C6              GGCTGGTGCATACCCGATGTACTTGGATGCTTATCCGTTGCCGCAGTTCG
                **************************************************

C1              CGATCTATGGAGCGGTATCGCTGCGCACAATCAAGAAGGCGCTGCTGGAT
C2              CGATCTATGGAGCGGTATCGCTGCGCACAATCAAGAAGGCGCTGCTGGAT
C3              CGATCTATGGAGCGGTATCGCTGCGCACAATCAAGAAGGCGCTGCTGGAT
C4              CGATCTATGGAGCGGTATCGCTGCGCACAATCAAGAAGGCGCTGCTGGAT
C5              CGATCTATGGAGCGGTATCGCTGCGCACAATCAAGAAGGCGCTGCTGGAT
C6              CGATCTATGGAGCGGTATCGCTGCGCACAATCAAGAAGGCGCTGCTGGAT
                **************************************************

C1              CTAGAGGCAGTCCGACAACTGGATCGGGTCCGCATGTTGTTGCTCACCAA
C2              CTAGAGGCAGTCCGACAACTGGATCGGGTCCGCATGTTGTTGCTCACCAA
C3              CTAGAGGCAGTCCGACAACTGGATCGGGTCCGCATGTTGTTGCTCACCAA
C4              CTAGAGGCAGTCCGACAACTGGATCGGGTCCGCATGTTGTTGCTCACCAA
C5              CTAGAGGCAGTCCGACAACTGGATCGGGTCCGCATGTTGTTGCTCACCAA
C6              CTAGAGGCAGTCCGACAACTGGATCGGGTCCGCATGTTGTTGCTCACCAA
                **************************************************

C1              CTGCACTTTTGATGGCGTCGTCTGTAACCCGCAGCGGGTAATGGAGGAGG
C2              CTGCACTTTTGATGGCGTCGTCTGTAACCCGCAGCGGGTAATGGAGGAGG
C3              CTGCACTTTTGATGGCGTCGTCTGTAACCCGCAGCGGGTAATGGAGGAGG
C4              CTGCACTTTTGATGGCGTCGTCTGTAACCCGCAGCGGGTAATGGAGGAGG
C5              CTGCACTTTTGATGGCGTCGTCTGTAACCCGCAGCGGGTAATGGAGGAGG
C6              CTGCACTTTTGATGGCGTCGTCTGTAACCCGCAGCGGGTAATGGAGGAGG
                **************************************************

C1              TGCTGGCGATCAAGCCAGACATTTGCTTCCTATGGGACGAGGCGTGGTAT
C2              TGCTGGCGATCAAGCCAGACATTTGCTTCCTATGGGACGAGGCGTGGTAT
C3              TGCTGGCGATCAAGCCAGACATTTGCTTCCTATGGGACGAGGCGTGGTAT
C4              TGCTGGCGATCAAGCCAGACATTTGCTTCCTATGGGACGAGGCGTGGTAT
C5              TGCTGGCGATCAAGCCAGACATTTGCTTCCTATGGGACGAGGCGTGGTAT
C6              TGCTGGCGATCAAGCCAGACATTTGCTTCCTATGGGACGAGGCGTGGTAT
                **************************************************

C1              GCGTTTGCCACTGCCGTGCCGTGGGCTCGTCAGCGGACCGCAATGGTGTC
C2              GCGTTTGCCACTGCCGTGCCGTGGGCTCGTCAGCGGACCGCAATGGTGTC
C3              GCGTTTGCCACTGCCGTGCCGTGGGCTCGTCAGCGGACCGCAATGGTGTC
C4              GCGTTTGCCACTGCCGTGCCGTGGGCTCGTCAGCGGACCGCAATGGTGTC
C5              GCGTTTGCCACTGCCGTGCCGTGGGCTCGTCAGCGGACCGCAATGGTGTC
C6              GCGTTTGCCACTGCCGTGCCGTGGGCTCGTCAGCGGACCGCAATGGTGTC
                **************************************************

C1              TGCTGAGCAACTCGAACAGAAGTTGTGGTCTGTCGAATACGCCGAGGAAT
C2              TGCTGAGCAACTCGAACAGAAGTTGTGGTCTGTCGAATACGCCGAGGAAT
C3              TGCTGAGCAACTCGAACAGAAGTTGTGGTCTGTCGAATACGCCGAGGAAT
C4              TGCTGAGCAACTCGAACAGAAGTTGTGGTCTGTCGAATACGCCGAGGAAT
C5              TGCTGAGCAACTCGAACAGAAGTTGTGGTCTGTCGAATACGCCGAGGAAT
C6              TGCTGAGCAACTCGAACAGAAGTTGTGGTCTGTCGAATACGCCGAGGAAT
                **************************************************

C1              ATCGGAATTGGTGCGCATCGATGGCCGAGATCCCTCGGTCCCAGTGGGTT
C2              ATCGGAATTGGTGCGCATCGATGGCCGAGATCCCTCGGTCCCAGTGGGTT
C3              ATCGGAATTGGTGCGCATCGATGGCCGAGATCCCTCGGTCCCAGTGGGTT
C4              ATCGGAATTGGTGCGCATCGATGGCCGAGATCCCTCGGTCCCAGTGGGTT
C5              ATCGGAATTGGTGCGCATCGATGGCCGAGATCCCTCGGTCCCAGTGGGTT
C6              ATCGGAATTGGTGCGCATCGATGGCCGAGATCCCTCGGTCCCAGTGGGTT
                **************************************************

C1              GACCAGCGGCTACTGCCGGACCCCAATCGGGCGCGGATTCGCGTATATGC
C2              GACCAGCGGCTACTGCCGGACCCCAATCGGGCGCGGATTCGCGTATATGC
C3              GACCAGCGGCTACTGCCGGACCCCAATCGGGCGCGGATTCGCGTATATGC
C4              GACCAGCGGCTACTGCCGGACCCCAATCGGGCGCGGATTCGCGTATATGC
C5              GACCAGCGGCTACTGCCGGACCCCAATCGGGCGCGGATTCGCGTATATGC
C6              GACCAGCGGCTACTGCCGGACCCCAATCGGGCGCGGATTCGCGTATATGC
                **************************************************

C1              GACACACTCTACTCACAAGTCGCTGTCGGCGCTTCGGCAGGCGTCGATGA
C2              GACACACTCTACTCACAAGTCGCTGTCGGCGCTTCGGCAGGCGTCGATGA
C3              GACACACTCTACTCACAAGTCGCTGTCGGCGCTTCGGCAGGCGTCGATGA
C4              GACACACTCTACTCACAAGTCGCTGTCGGCGCTTCGGCAGGCGTCGATGA
C5              GACACACTCTACTCACAAGTCGCTGTCGGCGCTTCGGCAGGCGTCGATGA
C6              GACACACTCTACTCACAAGTCGCTGTCGGCGCTTCGGCAGGCGTCGATGA
                **************************************************

C1              TTCATGTCCGCGATCAAGATTTCAATGCGCTAGCCCGGGATGCGTTCGGT
C2              TTCATGTCCGCGATCAAGATTTCAATGCGCTAGCCCGGGATGCGTTCGGT
C3              TTCATGTCCGCGATCAAGATTTCAATGCGCTAGCCCGGGATGCGTTCGGT
C4              TTCATGTCCGCGATCAAGATTTCAATGCGCTAGCCCGGGATGCGTTCGGT
C5              TTCATGTCCGCGATCAAGATTTCAATGCGCTAGCCCGGGATGCGTTCGGT
C6              TTCATGTCCGCGATCAAGATTTCAATGCGCTAGCCCGGGATGCGTTCGGT
                **************************************************

C1              GAGGCATTCTTGACGCACACCTCGACATCGCCGAACCAACAACTTCTCGC
C2              GAGGCATTCTTGACGCACACCTCGACATCGCCGAACCAACAACTTCTCGC
C3              GAGGCATTCTTGACGCACACCTCGACATCGCCGAACCAACAACTTCTCGC
C4              GAGGCATTCTTGACGCACACCTCGACATCGCCGAACCAACAACTTCTCGC
C5              GAGGCATTCTTGACGCACACCTCGACATCGCCGAACCAACAACTTCTCGC
C6              GAGGCATTCTTGACGCACACCTCGACATCGCCGAACCAACAACTTCTCGC
                **************************************************

C1              GTCGTTGGATCTGGCGCGCCGCCAGGTTGACATCGAGGGATTTCAACTGG
C2              GTCGTTGGATCTGGCGCGCCGCCAGGTTGACATCGAGGGATTTCAACTGG
C3              GTCGTTGGATCTGGCGCGCCGCCAGGTTGACATCGAGGGATTTCAACTGG
C4              GTCGTTGGATCTGGCGCGCCGCCAGGTTGACATCGAGGGATTTCAACTGG
C5              GTCGTTGGATCTGGCGCGCCGCCAGGTTGACATCGAGGGATTTCAACTGG
C6              GTCGTTGGATCTGGCGCGCCGCCAGGTTGACATCGAGGGATTTCAACTGG
                **************************************************

C1              TCCGGCTGGTGTACGACATGGCGCTGGTCTTTCGTCACCGCGTCCGCAAA
C2              TCCGGCTGGTGTACGACATGGCGCTGGTCTTTCGTCACCGCGTCCGCAAA
C3              TCCGGCTGGTGTACGACATGGCGCTGGTCTTTCGTCACCGCGTCCGCAAA
C4              TCCGGCTGGTGTACGACATGGCGCTGGTCTTTCGTCACCGCGTCCGCAAA
C5              TCCGGCTGGTGTACGACATGGCGCTGGTCTTTCGTCACCGCGTCCGCAAA
C6              TCCGGCTGGTGTACGACATGGCGCTGGTCTTTCGTCACCGCGTCCGCAAA
                **************************************************

C1              GACCGGCTGATCAGCAAATGGTTCCGTATCCTCGATGAATCCGACCTGGT
C2              GACCGGCTGATCAGCAAATGGTTCCGTATCCTCGATGAATCCGACCTGGT
C3              GACCGGCTGATCAGCAAATGGTTCCGTATCCTCGATGAATCCGACCTGGT
C4              GACCGGCTGATCAGCAAATGGTTCCGTATCCTCGATGAATCCGACCTGGT
C5              GACCGGCTGATCAGCAAATGGTTCCGTATCCTCGATGAATCCGACCTGGT
C6              GACCGGCTGATCAGCAAATGGTTCCGTATCCTCGATGAATCCGACCTGGT
                **************************************************

C1              GCCCGACGAGTACCGGGCATCGGCGGTCAGCTCGTACCGTCAGGTTCGGC
C2              GCCCGACGAGTACCGGGCATCGGCGGTCAGCTCGTACCGTCAGGTTCGGC
C3              GCCCGACGAGTACCGGGCATCGGCGGTCAGCTCGTACCGTCAGGTTCGGC
C4              GCCCGACGAGTACCGGGCATCGGCGGTCAGCTCGTACCGTCAGGTTCGGC
C5              GCCCGACGAGTACCGGGCATCGGCGGTCAGCTCGTACCGTCAGGTTCGGC
C6              GCCCGACGAGTACCGGGCATCGGCGGTCAGCTCGTACCGTCAGGTTCGGC
                **************************************************

C1              AGGGTGCTCTGGCGGAGTGGAATGAGGCATGGCGGTCCGACCAGTTCGTG
C2              AGGGTGCTCTGGCGGAGTGGAATGAGGCATGGCGGTCCGACCAGTTCGTG
C3              AGGGTGCTCTGGCGGAGTGGAATGAGGCATGGCGGTCCGACCAGTTCGTG
C4              AGGGTGCTCTGGCGGAGTGGAATGAGGCATGGCGGTCCGACCAGTTCGTG
C5              AGGGTGCTCTGGCGGAGTGGAATGAGGCATGGCGGTCCGACCAGTTCGTG
C6              AGGGTGCTCTGGCGGAGTGGAATGAGGCATGGCGGTCCGACCAGTTCGTG
                **************************************************

C1              CTGGATCCGACGAGGGTCACCTTGTTCGTCGGGAAGACCGGAATGAACGG
C2              CTGGATCCGACGAGGGTCACCTTGTTCGTCGGGAAGACCGGAATGAACGG
C3              CTGGATCCGACGAGGGTCACCTTGTTCGTCGGGAAGACCGGAATGAACGG
C4              CTGGATCCGACGAGGGTCACCTTGTTCGTCGGGAAGACCGGAATGAACGG
C5              CTGGATCCGACGAGGGTCACCTTGTTCGTCGGGAAGACCGGAATGAACGG
C6              CTGGATCCGACGAGGGTCACCTTGTTCGTCGGGAAGACCGGAATGAACGG
                **************************************************

C1              ATATGACTTCCGCGAGAAGATCTTGATGGAGCGATTCGGCATACAGATCA
C2              ATATGACTTCCGCGAGAAGATCTTGATGGAGCGATTCGGCATACAGATCA
C3              ATATGACTTCCGCGAGAAGATCTTGATGGAGCGATTCGGCATACAGATCA
C4              ATATGACTTCCGCGAGAAGATCTTGATGGAGCGATTCGGCATACAGATCA
C5              ATATGACTTCCGCGAGAAGATCTTGATGGAGCGATTCGGCATACAGATCA
C6              ATATGACTTCCGCGAGAAGATCTTGATGGAGCGATTCGGCATACAGATCA
                **************************************************

C1              ACAAGACATCCATCAACAGTGTGCTGTTGATCTTCACCATCGGTGTCACG
C2              ACAAGACATCCATCAACAGTGTGCTGTTGATCTTCACCATCGGTGTCACG
C3              ACAAGACATCCATCAACAGTGTGCTGTTGATCTTCACCATCGGTGTCACG
C4              ACAAGACATCCATCAACAGTGTGCTGTTGATCTTCACCATCGGTGTCACG
C5              ACAAGACATCCATCAACAGTGTGCTGTTGATCTTCACCATCGGTGTCACG
C6              ACAAGACATCCATCAACAGTGTGCTGTTGATCTTCACCATCGGTGTCACG
                **************************************************

C1              TGGTCGAGCGTGCATTATCTGCTAGATGTGTTACGCCGGGTGGCCAGTGA
C2              TGGTCGAGCGTGCATTATCTGCTAGATGTGTTACGCCGGGTGGCCAGTGA
C3              TGGTCGAGCGTGCATTATCTGCTAGATGTGTTACGCCGGGTGGCCAGTGA
C4              TGGTCGAGCGTGCATTATCTGCTAGATGTGTTACGCCGGGTGGCCAGTGA
C5              TGGTCGAGCGTGCATTATCTGCTAGATGTGTTACGCCGGGTGGCCAGTGA
C6              TGGTCGAGCGTGCATTATCTGCTAGATGTGTTACGCCGGGTGGCCAGTGA
                **************************************************

C1              CTTTGACAGGATTCAGAAGGTGGCCAGCGGGGCCGACCTCGCGCTGCATC
C2              CTTTGACAGGATTCAGAAGGTGGCCAGCGGGGCCGACCTCGCGCTGCATC
C3              CTTTGACAGGATTCAGAAGGTGGCCAGCGGGGCCGACCTCGCGCTGCATC
C4              CTTTGACAGGATTCAGAAGGTGGCCAGCGGGGCCGACCTCGCGCTGCATC
C5              CTTTGACAGGATTCAGAAGGTGGCCAGCGGGGCCGACCTCGCGCTGCATC
C6              CTTTGACAGGATTCAGAAGGTGGCCAGCGGGGCCGACCTCGCGCTGCATC
                **************************************************

C1              AGCGCCATGTTGAGGAGATCACCCAGGATTTGCCCCACTTGCCCGACTTC
C2              AGCGCCATGTTGAGGAGATCACCCAGGATTTGCCCCACTTGCCCGACTTC
C3              AGCGCCATGTTGAGGAGATCACCCAGGATTTGCCCCACTTGCCCGACTTC
C4              AGCGCCATGTTGAGGAGATCACCCAGGATTTGCCCCACTTGCCCGACTTC
C5              AGCGCCATGTTGAGGAGATCACCCAGGATTTGCCCCACTTGCCCGACTTC
C6              AGCGCCATGTTGAGGAGATCACCCAGGATTTGCCCCACTTGCCCGACTTC
                **************************************************

C1              AGCGAGTTCGATGTTGCCTTCCGTCCCGAAAATGCCAGCTCGTTCGGTGA
C2              AGCGAGTTCGATGTTGCCTTCCGTCCCGAAAATGCCAGCTCGTTCGGTGA
C3              AGCGAGTTCGATGTTGCCTTCCGTCCCGAAAATGCCAGCTCGTTCGGTGA
C4              AGCGAGTTCGATGTTGCCTTCCGTCCCGAAAATGCCAGCTCGTTCGGTGA
C5              AGCGAGTTCGATGTTGCCTTCCGTCCCGAAAATGCCAGCTCGTTCGGTGA
C6              AGCGAGTTCGATGTTGCCTTCCGTCCCGAAAATGCCAGCTCGTTCGGTGA
                **************************************************

C1              CATGCGGTCGGCCTTCTACGCCGGGTACGAAGAATCGGACCGCGAGTACG
C2              CATGCGGTCGGCCTTCTACGCCGGGTACGAAGAATCGGACCGCGAGTACG
C3              CATGCGGTCGGCCTTCTACGCCGGGTACGAAGAATCGGACCGCGAGTACG
C4              CATGCGGTCGGCCTTCTACGCCGGGTACGAAGAATCGGACCGCGAGTACG
C5              CATGCGGTCGGCCTTCTACGCCGGGTACGAAGAATCGGACCGCGAGTACG
C6              CATGCGGTCGGCCTTCTACGCCGGGTACGAAGAATCGGACCGCGAGTACG
                **************************************************

C1              TGCATATCGGCACGGCCGGGCGTCAGCTTGCTGAGGGGAGGACCCTGGTG
C2              TGCATATCGGCACGGCCGGGCGTCAGCTTGCTGAGGGGAGGACCCTGGTG
C3              TGCATATCGGCACGGCCGGGCGTCAGCTTGCTGAGGGGAGGACCCTGGTG
C4              TGCATATCGGCACGGCCGGGCGTCAGCTTGCTGAGGGGAGGACCCTGGTG
C5              TGCATATCGGCACGGCCGGGCGTCAGCTTGCTGAGGGGAGGACCCTGGTG
C6              TGCATATCGGCACGGCCGGGCGTCAGCTTGCTGAGGGGAGGATCCTGGTG
                ****************************************** *******

C1              TCCACCACGTTCGTGGTGCCCTACCCGCCCGGCTTCCCGGTACTAGTCCC
C2              TCCACCACGTTCGTGGTGCCCTACCCGCCCGGCTTCCCGGTACTAGTCCC
C3              TCCACCACGTTCGTGGTGCCCTACCCGCCCGGCTTCCCGGTACTAGTCCC
C4              TCCACCACGTTCGTGGTGCCCTACCCGCCCGGCTTCCCGGTACTAGTCCC
C5              TCCACCACGTTCGTGGTGCCCTACCCGCCCGGCTTCCCGGTACTAGTCCC
C6              TCCACCACGTTCGTGGTGCCCTACCCGCCCGGCTTCCCGGTACTAGTCCC
                **************************************************

C1              TGGTCAGGTGGTTTCTAAGGAGATAATCTACTTCTTGGCTCAGCTCGACG
C2              TGGTCAGGTGGTTTCTAAGGAGATAATCTACTTCTTGGCTCAGCTCGACG
C3              TGGTCAGGTGGTTTCTAAGGAGATAATCTACTTCTTGGCTCAGCTCGACG
C4              TGGTCAGGTGGTTTCTAAGGAGATAATCTACTTCTTGGCTCAGCTCGACG
C5              TGGTCAGGTGGTTTCTAAGGAGATAATCTACTTCTTGGCTCAGCTCGACG
C6              TGGTCAGGTGGTTTCTAAGGAGATAATCTACTTCTTGGCTCAGCTCGACG
                **************************************************

C1              TGAAGGAAATTCACGGATACAACCATGAACTGGGATTATCAGTATTCACT
C2              TGAAGGAAATTCACGGATACAACCATGAACTGGGATTATCAGTATTCACT
C3              TGAAGGAAATTCACGGATACAACCATGAACTGGGATTATCAGTATTCACT
C4              TGAAGGAAATTCACGGATACAACCATGAACTGGGATTATCAGTATTCACT
C5              TGAAGGAAATTCACGGATACAACCATGAACTGGGATTATCAGTATTCACT
C6              TGAAGGAAATTCACGGATACAACCATGAACTGGGATTATCAGTATTCACT
                **************************************************

C1              GAGAAAGCGTTGGCTCGGATGATCGCGAGGCGCAACGCGGCGTCGGCCGC
C2              GAGAAAGCGTTGGCTCGGATGATCGCGAGGCGCAACGCGGCGTCGGCCGC
C3              GAGAAAGCGTTGGCTCGGATGATCGCGAGGCGCAACGCGGCGTCGGCCGC
C4              GAGAAAGCGTTGGCTCGGATGATCGCGAGGCGCAACGCGGCGTCGGCCGC
C5              GAGAAAGCGTTGGCTCGGATGATCGCGAGGCGCAACGCGGCGTCGGCCGC
C6              GAGAAAGCGTTGGCTCGGATGATCGCGAGGCGCAACGCGGCGTCGGCCGC
                **************************************************

C1              GGTGGGTTCTGCGTTCGCGGCTTTCGAGATCCCATCGGACTCTGCTGCTA
C2              GGTGGGTTCTGCGTTCGCGGCTTTCGAGATCCCATCGGACTCTGCTGCTA
C3              GGTGGGTTCTGCGTTCGCGGCTTTCGAGATCCCATCGGACTCTGCTGCTA
C4              GGTGGGTTCTGCGTTCGCGGCTTTCGAGATCCCATCGGACTCTGCTGCTA
C5              GGTGGGTTCTGCGTTCGCGGCTTTCGAGATCCCATCGGACTCTGCTGCTA
C6              GGTGGGTTCTGCGTTCGCGGCTTTCGAGATCCCATCGGACTCTGCTGCTA
                **************************************************

C1              TGGGCGGGGACGTGAACGGCGACAGAGTCGAGGCTGTTGCAGAAGACGCG
C2              TGGGCGGGGACGTGAACGGCGACAGAGTCGAGGCTGTTGCAGAAGACGCG
C3              TGGGCGGGGACGTGAACGGCGACAGAGTCGAGGCTGTTGCAGAAGACGCG
C4              TGGGCGGGGACGTGAACGGCGACAGAGTCGAGGCTGTTGCAGAAGACGCG
C5              TGGGCGGGGACGTGAACGGCGACAGAGTCGAGGCTGTTGCAGAAGACGCG
C6              TGGGCGGGGACGTGAACGGCGACAGAGTCGAGGCTGTTGCAGAAGACGCG
                **************************************************



>C1
ATGAATCGAGACAGTGGCCATCCGCGACGACTTCGTGTTTCCGCGCTGGC
GGCAGTAGCCAACCCGTCATACACGCGCATTGACACGTGGAACGTGCTCG
ATGACGCCTGCCGTCACTTGGCTGAGGTCGACCGCGCCGGGCTGGACACC
GCCCACGATGTTGCGCGTGTTAAGCGTTTGCTCGACCGCATCGGTGCCTA
CGAACGGTACTGGCTGTACCCTGGTGCGGCAAATCTGGCGGCGTTCCGCG
GCTATCTTGCCACCATGGCGACGGTTCAGCTTACCGAAGAGGTATCGCTG
GCCGTCCGTCTGTTGTCTGAATATGGTGACCGCACAGCGCTTTTTGATAC
TTCAGCGCCGCTGGCCGACCAGGAGCTGGTGGCCCAAGCCAAGCAGCAAC
AGTTCTACACCGTGTTGCTCGCCGACGATGCCCCATCCACGGCTCCCGAC
TGTCTGGCAGAGAGCTTGCGGGAGCTGCGCAATCCATCCGACGATGTGCA
GTTCGAGCTCCTTGTTGTGTCCAGTGTTGAGGACGCCATCACCGCGGTCG
CGCTGAACGGCGAGATTCAGGCTGCGATCATCCGCCATGACCTGCCACTG
CGGTCCCGCGACCGGGTGCCGTTGATGAATACCTTGCTTGGGGCCAACGA
CTCGGAGGGCGCACTGGTCACCATTGACCGCCCACACGACTGGGTCGAAT
GCGGTGAGTGGATCAGGGAGCTGCGGCCCCATATCGACCTCTATCTGCTC
ACCGACGAGTCGATCGCGGCGGGCAATGATGACGAGCCCGATGTCTACGA
CCGGACGTTTTATCGACTCAACGACGTTACCGACCTAAACAGCACCGTAC
TTGCAGGCTTGCGAAACCGTTTCGCCACACCATTTTTCGATGCCTTGCGC
GCCTACGCAGCAGCACCGGTCGGCCAATTCCATGCTCTTCCGGTCGCGCG
TGGTGCCAGTATCTTTAACTCTAGGTCGCTGCAAGACATGGGCGAGTTCT
ACGGTCGGAACATCTTCATGGCCGAGACATCGACCACCTCTGGTGGCCTG
GATTCGTTGCTGGATCCGCACGGCAACATCAAAAAAGCGATGGACAAAGC
CGCAGTTACTTGGCGCGCCAACCACACCTACTTTGTCACCAACGGAACTT
CCACAGCCAACAAAATCGTCGTACAGTCGTTGACCCGGCCAGGTGACATT
GTACTTATAGACCGCAACTGCCACAAGTCGCACCATTATGGCCTGGTATT
GGCTGGTGCATACCCGATGTACTTGGATGCTTATCCGTTGCCGCAGTTCG
CGATCTATGGAGCGGTATCGCTGCGCACAATCAAGAAGGCGCTGCTGGAT
CTAGAGGCAGTCCGACAACTGGATCGGGTCCGCATGTTGTTGCTCACCAA
CTGCACTTTTGATGGCGTCGTCTGTAACCCGCAGCGGGTAATGGAGGAGG
TGCTGGCGATCAAGCCAGACATTTGCTTCCTATGGGACGAGGCGTGGTAT
GCGTTTGCCACTGCCGTGCCGTGGGCTCGTCAGCGGACCGCAATGGTGTC
TGCTGAGCAACTCGAACAGAAGTTGTGGTCTGTCGAATACGCCGAGGAAT
ATCGGAATTGGTGCGCATCGATGGCCGAGATCCCTCGGTCCCAGTGGGTT
GACCAGCGGCTACTGCCGGACCCCAATCGGGCGCGGATTCGCGTATATGC
GACACACTCTACTCACAAGTCGCTGTCGGCGCTTCGGCAGGCGTCGATGA
TTCATGTCCGCGATCAAGATTTCAATGCGCTAGCCCGGGATGCGTTCGGT
GAGGCATTCTTGACGCACACCTCGACATCGCCGAACCAACAACTTCTCGC
GTCGTTGGATCTGGCGCGCCGCCAGGTTGACATCGAGGGATTTCAACTGG
TCCGGCTGGTGTACGACATGGCGCTGGTCTTTCGTCACCGCGTCCGCAAA
GACCGGCTGATCAGCAAATGGTTCCGTATCCTCGATGAATCCGACCTGGT
GCCCGACGAGTACCGGGCATCGGCGGTCAGCTCGTACCGTCAGGTTCGGC
AGGGTGCTCTGGCGGAGTGGAATGAGGCATGGCGGTCCGACCAGTTCGTG
CTGGATCCGACGAGGGTCACCTTGTTCGTCGGGAAGACCGGAATGAACGG
ATATGACTTCCGCGAGAAGATCTTGATGGAGCGATTCGGCATACAGATCA
ACAAGACATCCATCAACAGTGTGCTGTTGATCTTCACCATCGGTGTCACG
TGGTCGAGCGTGCATTATCTGCTAGATGTGTTACGCCGGGTGGCCAGTGA
CTTTGACAGGATTCAGAAGGTGGCCAGCGGGGCCGACCTCGCGCTGCATC
AGCGCCATGTTGAGGAGATCACCCAGGATTTGCCCCACTTGCCCGACTTC
AGCGAGTTCGATGTTGCCTTCCGTCCCGAAAATGCCAGCTCGTTCGGTGA
CATGCGGTCGGCCTTCTACGCCGGGTACGAAGAATCGGACCGCGAGTACG
TGCATATCGGCACGGCCGGGCGTCAGCTTGCTGAGGGGAGGACCCTGGTG
TCCACCACGTTCGTGGTGCCCTACCCGCCCGGCTTCCCGGTACTAGTCCC
TGGTCAGGTGGTTTCTAAGGAGATAATCTACTTCTTGGCTCAGCTCGACG
TGAAGGAAATTCACGGATACAACCATGAACTGGGATTATCAGTATTCACT
GAGAAAGCGTTGGCTCGGATGATCGCGAGGCGCAACGCGGCGTCGGCCGC
GGTGGGTTCTGCGTTCGCGGCTTTCGAGATCCCATCGGACTCTGCTGCTA
TGGGCGGGGACGTGAACGGCGACAGAGTCGAGGCTGTTGCAGAAGACGCG
>C2
ATGAATCGAGACAGTGGCCATCCGCGACGACTTCGTGTTTCCGCGCTGGC
GGCAGTAGCCAACCCGTCATACACGCGCATTGACACGTGGAACGTGCTCG
ATGACGCCTGCCGTCACTTGGCTGAGGTCGACCGCGCCGGGCTGGACACC
GCCCACGATGTTGCGCGTGTTAAGCGTTTGCTCGACCGCATCGGTGCCTA
CGAACGGTACTGGCTGTACCCTGGTGCGGCAAATCTGGCGGCGTTCCGCG
GCTATCTTGCCACCATGGCGACGGTTCAGCTTACCGAAGAGGTATCGCTG
GCCGTCCGTCTGTTGTCTGAATATGGTGACCGCACAGCGCTTTTTGATAC
TTCAGCGCCGCTGGCCGACCAGGAGCTGGTGGCCCAAGCCAAGCAGCAAC
AGTTCTACACCGTGTTGCTCGCCGACGATGCCCCATCCACGGCTCCCGAC
TGTCTGGCAGAGAGCTTGCGGGAGCTGCGCAATCCATCCGACGATGTGCA
GTTCGAGCTCCTTGTTGTGTCCAGTGTTGAGGACGCCATCACCGCGGTCG
CGCTGAACGGCGAGATTCAGGCTGCGATCATCCGCCATGACCTGCCACTG
CGGTCCCGCGACCGGGTGCCGTTGATGAATACCTTGCTTGGGGCCAACGA
CTCGGAGGGCGCACTGGTCACCATTGACCGCCCACACGACTGGGTCGAAT
GCGGTGAGTGGATCAGGGAGCTGCGGCCCCATATCGACCTCTATCTGCTC
ACCGACGAGTCGATCGCGGCGGGCAATGATGACGAGCCCGATGTCTACGA
CCGGACGTTTTATCGACTCAACGACGTTACCGACCTAAACAGCACCGTAC
TTGCAGGCTTGCGAAACCGTTTCGCCACACCATTTTTCGATGCCTTGCGC
GCCTACGCAGCAGCACCGGTCGGCCAATTCCATGCTCTTCCGGTCGCGCG
TGGTGCCAGTATCTTTAACTCTAGGTCGCTGCAAGACATGGGCGAGTTCT
ACGGTCGGAACATCTTCATGGCCGAGACATCGACCACCTCTGGTGGCCTG
GATTCGTTGCTGGATCCGCACGGCAACATCAAAAAAGCGATGGACAAAGC
CGCAGTTACTTGGCGCGCCAACCACACCTACTTTGTCACCAACGGAACTT
CCACAGCCAACAAAATCGTCGTACAGTCGTTGACCCGGCCAGGTGACATT
GTACTTATAGACCGCAACTGCCACAAGTCGCACCATTATGGCCTGGTATT
GGCTGGTGCATACCCGATGTACTTGGATGCTTATCCGTTGCCGCAGTTCG
CGATCTATGGAGCGGTATCGCTGCGCACAATCAAGAAGGCGCTGCTGGAT
CTAGAGGCAGTCCGACAACTGGATCGGGTCCGCATGTTGTTGCTCACCAA
CTGCACTTTTGATGGCGTCGTCTGTAACCCGCAGCGGGTAATGGAGGAGG
TGCTGGCGATCAAGCCAGACATTTGCTTCCTATGGGACGAGGCGTGGTAT
GCGTTTGCCACTGCCGTGCCGTGGGCTCGTCAGCGGACCGCAATGGTGTC
TGCTGAGCAACTCGAACAGAAGTTGTGGTCTGTCGAATACGCCGAGGAAT
ATCGGAATTGGTGCGCATCGATGGCCGAGATCCCTCGGTCCCAGTGGGTT
GACCAGCGGCTACTGCCGGACCCCAATCGGGCGCGGATTCGCGTATATGC
GACACACTCTACTCACAAGTCGCTGTCGGCGCTTCGGCAGGCGTCGATGA
TTCATGTCCGCGATCAAGATTTCAATGCGCTAGCCCGGGATGCGTTCGGT
GAGGCATTCTTGACGCACACCTCGACATCGCCGAACCAACAACTTCTCGC
GTCGTTGGATCTGGCGCGCCGCCAGGTTGACATCGAGGGATTTCAACTGG
TCCGGCTGGTGTACGACATGGCGCTGGTCTTTCGTCACCGCGTCCGCAAA
GACCGGCTGATCAGCAAATGGTTCCGTATCCTCGATGAATCCGACCTGGT
GCCCGACGAGTACCGGGCATCGGCGGTCAGCTCGTACCGTCAGGTTCGGC
AGGGTGCTCTGGCGGAGTGGAATGAGGCATGGCGGTCCGACCAGTTCGTG
CTGGATCCGACGAGGGTCACCTTGTTCGTCGGGAAGACCGGAATGAACGG
ATATGACTTCCGCGAGAAGATCTTGATGGAGCGATTCGGCATACAGATCA
ACAAGACATCCATCAACAGTGTGCTGTTGATCTTCACCATCGGTGTCACG
TGGTCGAGCGTGCATTATCTGCTAGATGTGTTACGCCGGGTGGCCAGTGA
CTTTGACAGGATTCAGAAGGTGGCCAGCGGGGCCGACCTCGCGCTGCATC
AGCGCCATGTTGAGGAGATCACCCAGGATTTGCCCCACTTGCCCGACTTC
AGCGAGTTCGATGTTGCCTTCCGTCCCGAAAATGCCAGCTCGTTCGGTGA
CATGCGGTCGGCCTTCTACGCCGGGTACGAAGAATCGGACCGCGAGTACG
TGCATATCGGCACGGCCGGGCGTCAGCTTGCTGAGGGGAGGACCCTGGTG
TCCACCACGTTCGTGGTGCCCTACCCGCCCGGCTTCCCGGTACTAGTCCC
TGGTCAGGTGGTTTCTAAGGAGATAATCTACTTCTTGGCTCAGCTCGACG
TGAAGGAAATTCACGGATACAACCATGAACTGGGATTATCAGTATTCACT
GAGAAAGCGTTGGCTCGGATGATCGCGAGGCGCAACGCGGCGTCGGCCGC
GGTGGGTTCTGCGTTCGCGGCTTTCGAGATCCCATCGGACTCTGCTGCTA
TGGGCGGGGACGTGAACGGCGACAGAGTCGAGGCTGTTGCAGAAGACGCG
>C3
ATGAATCGAGACAGTGGCCATCCGCGACGACTTCGTGTTTCCGCGCTGGC
GGCAGTAGCCAACCCGTCATACACGCGCATTGACACGTGGAACGTGCTCG
ATGACGCCTGCCGTCACTTGGCTGAGGTCGACCGCGCCGGGCTGGACACC
GCCCACGATGTTGCGCGTGTTAAGCGTTTGCTCGACCGCATCGGTGCCTA
CGAACGGTACTGGCTGTACCCTGGTGCGGCAAATCTGGCGGCGTTCCGCG
GCTATCTTGCCACCATGGCGACGGTTCAGCTTACCGAAGAGGTATCGCTG
GCCGTCCGTCTGTTGTCTGAATATGGTGACCGCACAGCGCTTTTTGATAC
TTCAGCGCCGCTGGCCGACCAGGAGCTGGTGGCCCAAGCCAAGCAGCAAC
AGTTCTACACCGTGTTGCTCGCCGACGATGCCCCATCCACGGCTCCCGAC
TGTCTGGCAGAGAGCTTGCGGGAGCTGCGCAATCCATCCGACGATGTGCA
GTTCGAGCTCCTTGTTGTGTCCAGTGTTGAGGACGCCATCACCGCGGTCG
CGCTGAACGGCGAGATTCAGGCTGCGATCATCCGCCATGACCTGCCACTG
CGGTCCCGCGACCGGGTGCCGTTGATGAATACCTTGCTTGGGGCCAACGA
CTCGGAGGGCGCACTGGTCACCATTGACCGCCCACACGACTGGGTCGAAT
GCGGTGAGTGGATCAGGGAGCTGCGGCCCCATATCGACCTCTATCTGCTC
ACCGACGAGTCGATCGCGGCGGGCAATGATGACGAGCCCGATGTCTACGA
CCGGACGTTTTATCGACTCAACGACGTTACCGACCTAAACAGCACCGTAC
TTGCAGGCTTGCGAAACCGTTTCGCCACACCATTTTTCGATGCCTTGCGC
GCCTACGCAGCAGCACCGGTCGGCCAATTCCATGCTCTTCCGGTCGCGCG
TGGTGCCAGTATCTTTAACTCTAGGTCGCTGCAAGACATGGGCGAGTTCT
ACGGTCGGAACATCTTCATGGCCGAGACATCGACCACCTCTGGTGGCCTG
GATTCGTTGCTGGATCCGCACGGCAACATCAAAAAAGCGATGGACAAAGC
CGCAGTTACTTGGCGCGCCAACCACACCTACTTTGTCACCAACGGAACTT
CCACAGCCAACAAAATCGTCGTACAGTCGTTGACCCGGCCAGGTGACATT
GTACTTATAGACCGCAACTGCCACAAGTCGCACCATTATGGCCTGGTATT
GGCTGGTGCATACCCGATGTACTTGGATGCTTATCCGTTGCCGCAGTTCG
CGATCTATGGAGCGGTATCGCTGCGCACAATCAAGAAGGCGCTGCTGGAT
CTAGAGGCAGTCCGACAACTGGATCGGGTCCGCATGTTGTTGCTCACCAA
CTGCACTTTTGATGGCGTCGTCTGTAACCCGCAGCGGGTAATGGAGGAGG
TGCTGGCGATCAAGCCAGACATTTGCTTCCTATGGGACGAGGCGTGGTAT
GCGTTTGCCACTGCCGTGCCGTGGGCTCGTCAGCGGACCGCAATGGTGTC
TGCTGAGCAACTCGAACAGAAGTTGTGGTCTGTCGAATACGCCGAGGAAT
ATCGGAATTGGTGCGCATCGATGGCCGAGATCCCTCGGTCCCAGTGGGTT
GACCAGCGGCTACTGCCGGACCCCAATCGGGCGCGGATTCGCGTATATGC
GACACACTCTACTCACAAGTCGCTGTCGGCGCTTCGGCAGGCGTCGATGA
TTCATGTCCGCGATCAAGATTTCAATGCGCTAGCCCGGGATGCGTTCGGT
GAGGCATTCTTGACGCACACCTCGACATCGCCGAACCAACAACTTCTCGC
GTCGTTGGATCTGGCGCGCCGCCAGGTTGACATCGAGGGATTTCAACTGG
TCCGGCTGGTGTACGACATGGCGCTGGTCTTTCGTCACCGCGTCCGCAAA
GACCGGCTGATCAGCAAATGGTTCCGTATCCTCGATGAATCCGACCTGGT
GCCCGACGAGTACCGGGCATCGGCGGTCAGCTCGTACCGTCAGGTTCGGC
AGGGTGCTCTGGCGGAGTGGAATGAGGCATGGCGGTCCGACCAGTTCGTG
CTGGATCCGACGAGGGTCACCTTGTTCGTCGGGAAGACCGGAATGAACGG
ATATGACTTCCGCGAGAAGATCTTGATGGAGCGATTCGGCATACAGATCA
ACAAGACATCCATCAACAGTGTGCTGTTGATCTTCACCATCGGTGTCACG
TGGTCGAGCGTGCATTATCTGCTAGATGTGTTACGCCGGGTGGCCAGTGA
CTTTGACAGGATTCAGAAGGTGGCCAGCGGGGCCGACCTCGCGCTGCATC
AGCGCCATGTTGAGGAGATCACCCAGGATTTGCCCCACTTGCCCGACTTC
AGCGAGTTCGATGTTGCCTTCCGTCCCGAAAATGCCAGCTCGTTCGGTGA
CATGCGGTCGGCCTTCTACGCCGGGTACGAAGAATCGGACCGCGAGTACG
TGCATATCGGCACGGCCGGGCGTCAGCTTGCTGAGGGGAGGACCCTGGTG
TCCACCACGTTCGTGGTGCCCTACCCGCCCGGCTTCCCGGTACTAGTCCC
TGGTCAGGTGGTTTCTAAGGAGATAATCTACTTCTTGGCTCAGCTCGACG
TGAAGGAAATTCACGGATACAACCATGAACTGGGATTATCAGTATTCACT
GAGAAAGCGTTGGCTCGGATGATCGCGAGGCGCAACGCGGCGTCGGCCGC
GGTGGGTTCTGCGTTCGCGGCTTTCGAGATCCCATCGGACTCTGCTGCTA
TGGGCGGGGACGTGAACGGCGACAGAGTCGAGGCTGTTGCAGAAGACGCG
>C4
ATGAATCGAGACAGTGGCCATCCGCGACGACTTCGTGTTTCCGCGCTGGC
GGCAGTAGCCAACCCGTCATACACGCGCATTGACACGTGGAACGTGCTCG
ATGACGCCTGCCGTCACTTGGCTGAGGTCGACCGCGCCGGGCTGGACACC
GCCCACGATGTTGCGCGTGTTAAGCGTTTGCTCGACCGCATCGGTGCCTA
CGAACGGTACTGGCTGTACCCTGGTGCGGCAAATCTGGCGGCGTTCCGCG
GCTATCTTGCCACCATGGCGACGGTTCAGCTTACCGAAGAGGTATCGCTG
GCCGTCCGTCTGTTGTCTGAATATGGTGACCGCACAGCGCTTTTTGATAC
TTCAGCGCCGCTGGCCGACCAGGAGCTGGTGGCCCAAGCCAAGCAGCAAC
AGTTCTACACCGTGTTGCTCGCCGACGATGCCCCATCCACGGCTCCCGAC
TGTCTGGCAGAGAGCTTGCGGGAGCTGCGCAATCCATCCGACGATGTGCA
GTTCGAGCTCCTTGTTGTGTCCAGTGTTGAGGACGCCATCACCGCGGTCG
CGCTGAACGGCGAGATTCAGGCTGCGATCATCCGCCATGACCTGCCACTG
CGGTCCCGCGACCGGGTGCCGTTGATGAATACCTTGCTTGGGGCCAACGA
CTCGGAGGGCGCACTGGTCACCATTGACCGCCCACACGACTGGGTCGAAT
GCGGTGAGTGGATCAGGGAGCTGCGGCCCCATATCGACCTCTATCTGCTC
ACCGACGAGTCGATCGCGGCGGGCAATGATGACGAGCCCGATGTCTACGA
CCGGACGTTTTATCGACTCAACGACGTTACCGACCTAAACAGCACCGTAC
TTGCAGGCTTGCGAAACCGTTTCGCCACACCATTTTTCGATGCCTTGCGC
GCCTACGCAGCAGCACCGGTCGGCCAATTCCATGCTCTTCCGGTCGCGCG
TGGTGCCAGTATCTTTAACTCTAGGTCGCTGCAAGACATGGGCGAGTTCT
ACGGTCGGAACATCTTCATGGCCGAGACATCGACCACCTCTGGTGGCCTG
GATTCGTTGCTGGATCCGCACGGCAACATCAAAAAAGCGATGGACAAAGC
CGCAGTTACTTGGCGCGCCAACCACACCTACTTTGTCACCAACGGAACTT
CCACAGCCAACAAAATCGTCGTACAGTCGTTGACCCGGCCAGGTGACATT
GTACTTATAGACCGCAACTGCCACAAGTCGCACCATTATGGCCTGGTATT
GGCTGGTGCATACCCGATGTACTTGGATGCTTATCCGTTGCCGCAGTTCG
CGATCTATGGAGCGGTATCGCTGCGCACAATCAAGAAGGCGCTGCTGGAT
CTAGAGGCAGTCCGACAACTGGATCGGGTCCGCATGTTGTTGCTCACCAA
CTGCACTTTTGATGGCGTCGTCTGTAACCCGCAGCGGGTAATGGAGGAGG
TGCTGGCGATCAAGCCAGACATTTGCTTCCTATGGGACGAGGCGTGGTAT
GCGTTTGCCACTGCCGTGCCGTGGGCTCGTCAGCGGACCGCAATGGTGTC
TGCTGAGCAACTCGAACAGAAGTTGTGGTCTGTCGAATACGCCGAGGAAT
ATCGGAATTGGTGCGCATCGATGGCCGAGATCCCTCGGTCCCAGTGGGTT
GACCAGCGGCTACTGCCGGACCCCAATCGGGCGCGGATTCGCGTATATGC
GACACACTCTACTCACAAGTCGCTGTCGGCGCTTCGGCAGGCGTCGATGA
TTCATGTCCGCGATCAAGATTTCAATGCGCTAGCCCGGGATGCGTTCGGT
GAGGCATTCTTGACGCACACCTCGACATCGCCGAACCAACAACTTCTCGC
GTCGTTGGATCTGGCGCGCCGCCAGGTTGACATCGAGGGATTTCAACTGG
TCCGGCTGGTGTACGACATGGCGCTGGTCTTTCGTCACCGCGTCCGCAAA
GACCGGCTGATCAGCAAATGGTTCCGTATCCTCGATGAATCCGACCTGGT
GCCCGACGAGTACCGGGCATCGGCGGTCAGCTCGTACCGTCAGGTTCGGC
AGGGTGCTCTGGCGGAGTGGAATGAGGCATGGCGGTCCGACCAGTTCGTG
CTGGATCCGACGAGGGTCACCTTGTTCGTCGGGAAGACCGGAATGAACGG
ATATGACTTCCGCGAGAAGATCTTGATGGAGCGATTCGGCATACAGATCA
ACAAGACATCCATCAACAGTGTGCTGTTGATCTTCACCATCGGTGTCACG
TGGTCGAGCGTGCATTATCTGCTAGATGTGTTACGCCGGGTGGCCAGTGA
CTTTGACAGGATTCAGAAGGTGGCCAGCGGGGCCGACCTCGCGCTGCATC
AGCGCCATGTTGAGGAGATCACCCAGGATTTGCCCCACTTGCCCGACTTC
AGCGAGTTCGATGTTGCCTTCCGTCCCGAAAATGCCAGCTCGTTCGGTGA
CATGCGGTCGGCCTTCTACGCCGGGTACGAAGAATCGGACCGCGAGTACG
TGCATATCGGCACGGCCGGGCGTCAGCTTGCTGAGGGGAGGACCCTGGTG
TCCACCACGTTCGTGGTGCCCTACCCGCCCGGCTTCCCGGTACTAGTCCC
TGGTCAGGTGGTTTCTAAGGAGATAATCTACTTCTTGGCTCAGCTCGACG
TGAAGGAAATTCACGGATACAACCATGAACTGGGATTATCAGTATTCACT
GAGAAAGCGTTGGCTCGGATGATCGCGAGGCGCAACGCGGCGTCGGCCGC
GGTGGGTTCTGCGTTCGCGGCTTTCGAGATCCCATCGGACTCTGCTGCTA
TGGGCGGGGACGTGAACGGCGACAGAGTCGAGGCTGTTGCAGAAGACGCG
>C5
ATGAATCGAGACAGTGGCCATCCGCGACGACTTCGTGTTTCCGCGCTGGC
GGCAGTAGCCAACCCGTCATACACGCGCATTGACACGTGGAACGTGCTCG
ATGACGCCTGCCGTCACTTGGCTGAGGTCGACCGCGCCGGGCTGGACACC
GCCCACGATGTTGCGCGTGTTAAGCGTTTGCTCGACCGCATCGGTGCCTA
CGAACGGTACTGGCTGTACCCTGGTGCGGCAAATCTGGCGGCGTTCCGCG
GCTATCTTGCCACCATGGCGACGGTTCAGCTTACCGAAGAGGTATCGCTG
GCCGTCCGTCTGTTGTCTGAATATGGTGACCGCACAGCGCTTTTTGATAC
TTCAGCGCCGCTGGCCGACCAGGAGCTGGTGGCCCAAGCCAAGCAGCAAC
AGTTCTACACCGTGTTGCTCGCCGACGATGCCCCATCCACGGCTCCCGAC
TGTCTGGCAGAGAGCTTGCGGGAGCTGCGCAATCCATCCGACGATGTGCA
GTTCGAGCTCCTTGTTGTGTCCAGTGTTGAGGACGCCATCACCGCGGTCG
CGCTGAACGGCGAGATTCAGGCTGCGATCATCCGCCATGACCTGCCACTG
CGGTCCCGCGACCGGGTGCCGTTGATGAATACCTTGCTTGGGGCCAACGA
CTCGGAGGGCGCACTGGTCACCATTGACCGCCCACACGACTGGGTCGAAT
GCGGTGAGTGGATCAGGGAGCTGCGGCCCCATATCGACCTCTATCTGCTC
ACCGACGAGTCGATCGCGGCGGGCAATGATGACGAGCCCGATGTCTACGA
CCGGACGTTTTATCGACTCAACGACGTTACCGACCTAAACAGCACCGTAC
TTGCAGGCTTGCGAAACCGTTTCGCCACACCATTTTTCGATGCCTTGCGC
GCCTACGCAGCAGCACCGGTCGGCCAATTCCATGCTCTTCCGGTCGCGCG
TGGTGCCAGTATCTTTAACTCTAGGTCGCTGCAAGACATGGGCGAGTTCT
ACGGTCGGAACATCTTCATGGCCGAGACATCGACCACCTCTGGTGGCCTG
GATTCGTTGCTGGATCCGCACGGCAACATCAAAAAAGCGATGGACAAAGC
CGCAGTTACTTGGCGCGCCAACCACACCTACTTTGTCACCAACGGAACTT
CCACAGCCAACAAAATCGTCGTACAGTCGTTGACCCGGCCAGGTGACATT
GTACTTATAGACCGCAACTGCCACAAGTCGCACCATTATGGCCTGGTATT
GGCTGGTGCATACCCGATGTACTTGGATGCTTATCCGTTGCCGCAGTTCG
CGATCTATGGAGCGGTATCGCTGCGCACAATCAAGAAGGCGCTGCTGGAT
CTAGAGGCAGTCCGACAACTGGATCGGGTCCGCATGTTGTTGCTCACCAA
CTGCACTTTTGATGGCGTCGTCTGTAACCCGCAGCGGGTAATGGAGGAGG
TGCTGGCGATCAAGCCAGACATTTGCTTCCTATGGGACGAGGCGTGGTAT
GCGTTTGCCACTGCCGTGCCGTGGGCTCGTCAGCGGACCGCAATGGTGTC
TGCTGAGCAACTCGAACAGAAGTTGTGGTCTGTCGAATACGCCGAGGAAT
ATCGGAATTGGTGCGCATCGATGGCCGAGATCCCTCGGTCCCAGTGGGTT
GACCAGCGGCTACTGCCGGACCCCAATCGGGCGCGGATTCGCGTATATGC
GACACACTCTACTCACAAGTCGCTGTCGGCGCTTCGGCAGGCGTCGATGA
TTCATGTCCGCGATCAAGATTTCAATGCGCTAGCCCGGGATGCGTTCGGT
GAGGCATTCTTGACGCACACCTCGACATCGCCGAACCAACAACTTCTCGC
GTCGTTGGATCTGGCGCGCCGCCAGGTTGACATCGAGGGATTTCAACTGG
TCCGGCTGGTGTACGACATGGCGCTGGTCTTTCGTCACCGCGTCCGCAAA
GACCGGCTGATCAGCAAATGGTTCCGTATCCTCGATGAATCCGACCTGGT
GCCCGACGAGTACCGGGCATCGGCGGTCAGCTCGTACCGTCAGGTTCGGC
AGGGTGCTCTGGCGGAGTGGAATGAGGCATGGCGGTCCGACCAGTTCGTG
CTGGATCCGACGAGGGTCACCTTGTTCGTCGGGAAGACCGGAATGAACGG
ATATGACTTCCGCGAGAAGATCTTGATGGAGCGATTCGGCATACAGATCA
ACAAGACATCCATCAACAGTGTGCTGTTGATCTTCACCATCGGTGTCACG
TGGTCGAGCGTGCATTATCTGCTAGATGTGTTACGCCGGGTGGCCAGTGA
CTTTGACAGGATTCAGAAGGTGGCCAGCGGGGCCGACCTCGCGCTGCATC
AGCGCCATGTTGAGGAGATCACCCAGGATTTGCCCCACTTGCCCGACTTC
AGCGAGTTCGATGTTGCCTTCCGTCCCGAAAATGCCAGCTCGTTCGGTGA
CATGCGGTCGGCCTTCTACGCCGGGTACGAAGAATCGGACCGCGAGTACG
TGCATATCGGCACGGCCGGGCGTCAGCTTGCTGAGGGGAGGACCCTGGTG
TCCACCACGTTCGTGGTGCCCTACCCGCCCGGCTTCCCGGTACTAGTCCC
TGGTCAGGTGGTTTCTAAGGAGATAATCTACTTCTTGGCTCAGCTCGACG
TGAAGGAAATTCACGGATACAACCATGAACTGGGATTATCAGTATTCACT
GAGAAAGCGTTGGCTCGGATGATCGCGAGGCGCAACGCGGCGTCGGCCGC
GGTGGGTTCTGCGTTCGCGGCTTTCGAGATCCCATCGGACTCTGCTGCTA
TGGGCGGGGACGTGAACGGCGACAGAGTCGAGGCTGTTGCAGAAGACGCG
>C6
ATGAATCGAGACAGTGGCCATCCGCGACGACTTCGTGTTTCCGCGCTGGC
GGCAGTAGCCAACCCGTCATACACGCGCATTGACACGTGGAACGTGCTCG
ATGACGCCTGCCGTCACTTGGCTGAGGTCGACCGCGCCGGGCTGGACACC
GCCCACGATGTTGCGCGTGTTAAGCGTTTGCTCGACCGCATCGGTGCCTA
CGAACGGTACTGGCTGTACCCTGGTGCGGCAAATCTGGCGGCGTTCCGCG
GCTATCTTGCCACCATGGCGACGGTTCAGCTTACCGAAGAGGTATCGCTG
GCCGTCCGTCTGTTGTCTGAATATGGTGACCGCACAGCGCTTTTTGATAC
TTCAGCGCCGCTGGCCGACCAGGAGCTGGTGGCCCAAGCCAAGCAGCAAC
AGTTCTACACCGTGTTGCTCGCCGACGATGCCCCATCCACGGCTCCCGAC
TGTCTGGCAGAGAGCTTGCGGGAGCTGCGCAATCCATCCGACGATGTGCA
GTTCGAGCTCCTTGTTGTGTCCAGTGTTGAGGACGCCATCACCGCGGTCG
CGCTGAACGGCGAGATTCAGGCTGCGATCATCCGCCATGACCTGCCACTG
CGGTCCCGCGACCGGGTGCCGTTGATGAATACCTTGCTTGGGGCCAACGA
CTCGGAGGGCGCACTGGTCACCATTGACCGCCCACACGACTGGGTCGAAT
GCGGTGAGTGGATCAGGGAGCTGCGGCCCCATATCGACCTCTATCTGCTC
ACCGACGAGTCGATCGCGGCGGGCAATGATGACGAGCCCGATGTCTACGA
CCGGACGTTTTATCGACTCAACGACGTTACCGACCTAAACAGCACCGTAC
TTGCAGGCTTGCGAAACCGTTTCGCCACACCATTTTTCGATGCCTTGCGC
GCCTACGCAGCAGCACCGGTCGGCCAATTCCATGCTCTTCCGGTCGCGCG
TGGTGCCAGTATCTTTAACTCTAGGTCGCTGCAAGACATGGGCGAGTTCT
ACGGTCGGAACATCTTCATGGCCGAGACATCGACCACCTCTGGTGGCCTG
GATTCGTTGCTGGATCCGCACGGCAACATCAAAAAAGCGATGGACAAAGC
CGCAGTTACTTGGCGCGCCAACCACACCTACTTTGTCACCAACGGAACTT
CCACAGCCAACAAAATCGTCGTACAGTCGTTGACCCGGCCAGGTGACATT
GTACTTATAGACCGCAACTGCCACAAGTCGCACCATTATGGCCTGGTATT
GGCTGGTGCATACCCGATGTACTTGGATGCTTATCCGTTGCCGCAGTTCG
CGATCTATGGAGCGGTATCGCTGCGCACAATCAAGAAGGCGCTGCTGGAT
CTAGAGGCAGTCCGACAACTGGATCGGGTCCGCATGTTGTTGCTCACCAA
CTGCACTTTTGATGGCGTCGTCTGTAACCCGCAGCGGGTAATGGAGGAGG
TGCTGGCGATCAAGCCAGACATTTGCTTCCTATGGGACGAGGCGTGGTAT
GCGTTTGCCACTGCCGTGCCGTGGGCTCGTCAGCGGACCGCAATGGTGTC
TGCTGAGCAACTCGAACAGAAGTTGTGGTCTGTCGAATACGCCGAGGAAT
ATCGGAATTGGTGCGCATCGATGGCCGAGATCCCTCGGTCCCAGTGGGTT
GACCAGCGGCTACTGCCGGACCCCAATCGGGCGCGGATTCGCGTATATGC
GACACACTCTACTCACAAGTCGCTGTCGGCGCTTCGGCAGGCGTCGATGA
TTCATGTCCGCGATCAAGATTTCAATGCGCTAGCCCGGGATGCGTTCGGT
GAGGCATTCTTGACGCACACCTCGACATCGCCGAACCAACAACTTCTCGC
GTCGTTGGATCTGGCGCGCCGCCAGGTTGACATCGAGGGATTTCAACTGG
TCCGGCTGGTGTACGACATGGCGCTGGTCTTTCGTCACCGCGTCCGCAAA
GACCGGCTGATCAGCAAATGGTTCCGTATCCTCGATGAATCCGACCTGGT
GCCCGACGAGTACCGGGCATCGGCGGTCAGCTCGTACCGTCAGGTTCGGC
AGGGTGCTCTGGCGGAGTGGAATGAGGCATGGCGGTCCGACCAGTTCGTG
CTGGATCCGACGAGGGTCACCTTGTTCGTCGGGAAGACCGGAATGAACGG
ATATGACTTCCGCGAGAAGATCTTGATGGAGCGATTCGGCATACAGATCA
ACAAGACATCCATCAACAGTGTGCTGTTGATCTTCACCATCGGTGTCACG
TGGTCGAGCGTGCATTATCTGCTAGATGTGTTACGCCGGGTGGCCAGTGA
CTTTGACAGGATTCAGAAGGTGGCCAGCGGGGCCGACCTCGCGCTGCATC
AGCGCCATGTTGAGGAGATCACCCAGGATTTGCCCCACTTGCCCGACTTC
AGCGAGTTCGATGTTGCCTTCCGTCCCGAAAATGCCAGCTCGTTCGGTGA
CATGCGGTCGGCCTTCTACGCCGGGTACGAAGAATCGGACCGCGAGTACG
TGCATATCGGCACGGCCGGGCGTCAGCTTGCTGAGGGGAGGATCCTGGTG
TCCACCACGTTCGTGGTGCCCTACCCGCCCGGCTTCCCGGTACTAGTCCC
TGGTCAGGTGGTTTCTAAGGAGATAATCTACTTCTTGGCTCAGCTCGACG
TGAAGGAAATTCACGGATACAACCATGAACTGGGATTATCAGTATTCACT
GAGAAAGCGTTGGCTCGGATGATCGCGAGGCGCAACGCGGCGTCGGCCGC
GGTGGGTTCTGCGTTCGCGGCTTTCGAGATCCCATCGGACTCTGCTGCTA
TGGGCGGGGACGTGAACGGCGACAGAGTCGAGGCTGTTGCAGAAGACGCG
>C1
MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA

>C2
MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA

>C3
MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA

>C4
MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA

>C5
MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRTLV
STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA

>C6
MNRDSGHPRRLRVSALAAVANPSYTRIDTWNVLDDACRHLAEVDRAGLDT
AHDVARVKRLLDRIGAYERYWLYPGAANLAAFRGYLATMATVQLTEEVSL
AVRLLSEYGDRTALFDTSAPLADQELVAQAKQQQFYTVLLADDAPSTAPD
CLAESLRELRNPSDDVQFELLVVSSVEDAITAVALNGEIQAAIIRHDLPL
RSRDRVPLMNTLLGANDSEGALVTIDRPHDWVECGEWIRELRPHIDLYLL
TDESIAAGNDDEPDVYDRTFYRLNDVTDLNSTVLAGLRNRFATPFFDALR
AYAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGL
DSLLDPHGNIKKAMDKAAVTWRANHTYFVTNGTSTANKIVVQSLTRPGDI
VLIDRNCHKSHHYGLVLAGAYPMYLDAYPLPQFAIYGAVSLRTIKKALLD
LEAVRQLDRVRMLLLTNCTFDGVVCNPQRVMEEVLAIKPDICFLWDEAWY
AFATAVPWARQRTAMVSAEQLEQKLWSVEYAEEYRNWCASMAEIPRSQWV
DQRLLPDPNRARIRVYATHSTHKSLSALRQASMIHVRDQDFNALARDAFG
EAFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRLVYDMALVFRHRVRK
DRLISKWFRILDESDLVPDEYRASAVSSYRQVRQGALAEWNEAWRSDQFV
LDPTRVTLFVGKTGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVT
WSSVHYLLDVLRRVASDFDRIQKVASGADLALHQRHVEEITQDLPHLPDF
SEFDVAFRPENASSFGDMRSAFYAGYEESDREYVHIGTAGRQLAEGRILV
STTFVVPYPPGFPVLVPGQVVSKEIIYFLAQLDVKEIHGYNHELGLSVFT
EKALARMIARRNAASAAVGSAFAAFEIPSDSAAMGGDVNGDRVEAVAEDA



                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/1res/adi/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 2850 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579772650
      Setting output file names to "/data/1res/adi/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 2003350528
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 8113400711
      Seed = 142327343
      Swapseed = 1579772650
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -6381.839491 -- -24.965149
         Chain 2 -- -6381.839491 -- -24.965149
         Chain 3 -- -6381.839491 -- -24.965149
         Chain 4 -- -6381.839491 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -6381.837941 -- -24.965149
         Chain 2 -- -6381.839491 -- -24.965149
         Chain 3 -- -6381.839491 -- -24.965149
         Chain 4 -- -6381.839491 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-6381.839] (-6381.839) (-6381.839) (-6381.839) * [-6381.838] (-6381.839) (-6381.839) (-6381.839) 
        500 -- (-3934.736) (-3945.430) [-3922.836] (-3952.699) * (-3988.495) (-3930.259) (-3952.378) [-3930.072] -- 0:00:00
       1000 -- [-3928.580] (-3930.446) (-3929.177) (-3942.951) * (-3928.126) (-3940.562) [-3926.895] (-3925.737) -- 0:00:00
       1500 -- [-3927.064] (-3921.306) (-3946.628) (-3929.199) * (-3928.244) (-3931.732) (-3928.455) [-3927.990] -- 0:00:00
       2000 -- (-3935.992) (-3929.234) (-3925.730) [-3922.266] * (-3921.468) (-3926.248) [-3922.101] (-3923.234) -- 0:00:00
       2500 -- (-3930.148) [-3928.523] (-3922.351) (-3928.555) * (-3926.846) (-3925.312) [-3932.429] (-3932.370) -- 0:00:00
       3000 -- (-3932.468) (-3927.144) [-3920.017] (-3926.921) * (-3926.485) (-3932.468) [-3925.383] (-3929.704) -- 0:00:00
       3500 -- (-3925.246) (-3934.892) [-3925.417] (-3920.978) * (-3924.849) (-3934.838) [-3921.274] (-3926.700) -- 0:00:00
       4000 -- (-3928.532) (-3929.966) (-3929.516) [-3924.097] * (-3926.481) (-3927.673) (-3935.926) [-3921.440] -- 0:00:00
       4500 -- (-3924.567) (-3926.972) (-3923.249) [-3922.252] * (-3936.749) (-3926.834) [-3930.287] (-3921.753) -- 0:00:00
       5000 -- (-3926.423) (-3926.075) (-3921.106) [-3923.112] * (-3920.998) [-3927.925] (-3935.216) (-3924.371) -- 0:00:00

      Average standard deviation of split frequencies: 0.095647

       5500 -- (-3934.249) (-3919.767) [-3927.880] (-3926.201) * (-3934.793) (-3931.228) [-3925.504] (-3923.656) -- 0:00:00
       6000 -- (-3929.352) [-3926.220] (-3925.157) (-3935.747) * (-3933.244) (-3923.939) [-3923.059] (-3924.835) -- 0:00:00
       6500 -- (-3933.587) (-3927.587) (-3923.456) [-3928.767] * (-3924.652) (-3930.606) [-3925.068] (-3929.227) -- 0:00:00
       7000 -- [-3930.415] (-3928.442) (-3920.460) (-3935.205) * (-3927.022) [-3923.051] (-3925.890) (-3926.223) -- 0:00:00
       7500 -- (-3927.368) (-3931.711) [-3925.848] (-3927.000) * [-3924.252] (-3922.789) (-3926.737) (-3925.395) -- 0:00:00
       8000 -- (-3931.837) [-3927.452] (-3923.731) (-3927.656) * (-3928.960) [-3928.675] (-3926.619) (-3922.108) -- 0:00:00
       8500 -- (-3937.152) (-3930.108) (-3921.398) [-3924.679] * (-3920.126) (-3923.350) [-3925.923] (-3922.805) -- 0:00:00
       9000 -- (-3927.310) (-3924.135) (-3926.275) [-3921.454] * (-3923.526) (-3923.546) (-3932.129) [-3920.210] -- 0:00:00
       9500 -- (-3928.069) [-3925.938] (-3927.544) (-3921.822) * [-3923.351] (-3929.168) (-3932.210) (-3920.782) -- 0:00:00
      10000 -- (-3928.460) [-3932.126] (-3930.787) (-3920.512) * [-3924.949] (-3926.589) (-3930.105) (-3917.639) -- 0:00:00

      Average standard deviation of split frequencies: 0.074938

      10500 -- (-3931.614) [-3924.865] (-3922.318) (-3923.697) * (-3932.744) [-3931.005] (-3929.691) (-3925.277) -- 0:01:34
      11000 -- (-3923.548) [-3924.124] (-3932.495) (-3922.120) * [-3927.012] (-3919.576) (-3925.986) (-3928.537) -- 0:01:29
      11500 -- [-3919.515] (-3926.917) (-3922.513) (-3921.714) * (-3928.200) [-3920.657] (-3924.846) (-3926.126) -- 0:01:25
      12000 -- [-3923.319] (-3924.947) (-3927.112) (-3920.155) * (-3921.124) (-3927.125) (-3928.351) [-3926.935] -- 0:01:22
      12500 -- [-3925.246] (-3921.627) (-3925.859) (-3922.013) * [-3919.791] (-3930.179) (-3924.222) (-3925.559) -- 0:01:19
      13000 -- (-3919.324) (-3926.366) [-3921.209] (-3920.984) * (-3920.017) [-3925.504] (-3927.053) (-3920.764) -- 0:01:15
      13500 -- [-3921.207] (-3926.056) (-3923.494) (-3922.560) * (-3924.145) [-3927.401] (-3924.971) (-3920.249) -- 0:01:13
      14000 -- (-3925.790) [-3921.480] (-3924.244) (-3920.237) * [-3922.095] (-3923.817) (-3928.110) (-3932.032) -- 0:01:10
      14500 -- [-3922.064] (-3929.690) (-3920.667) (-3920.903) * [-3920.290] (-3929.574) (-3923.092) (-3924.952) -- 0:01:07
      15000 -- (-3924.090) (-3920.919) [-3926.679] (-3920.775) * (-3918.355) [-3933.014] (-3925.815) (-3921.221) -- 0:01:05

      Average standard deviation of split frequencies: 0.044970

      15500 -- [-3920.990] (-3924.068) (-3921.423) (-3920.636) * (-3921.401) [-3930.184] (-3928.543) (-3929.141) -- 0:01:03
      16000 -- (-3922.975) (-3928.633) [-3922.898] (-3919.088) * (-3920.093) (-3927.171) (-3926.031) [-3929.516] -- 0:01:01
      16500 -- (-3931.401) (-3923.647) (-3926.249) [-3919.689] * (-3918.801) [-3922.565] (-3926.088) (-3930.580) -- 0:00:59
      17000 -- (-3932.175) (-3927.750) [-3927.580] (-3920.825) * (-3919.111) (-3922.819) [-3924.952] (-3925.701) -- 0:00:57
      17500 -- (-3922.497) (-3928.603) (-3929.422) [-3920.389] * (-3920.660) (-3928.083) (-3919.899) [-3925.363] -- 0:00:56
      18000 -- (-3922.497) (-3928.535) [-3926.573] (-3918.093) * (-3920.660) (-3936.853) [-3922.714] (-3924.980) -- 0:00:54
      18500 -- (-3918.984) (-3927.655) [-3924.689] (-3919.778) * (-3918.260) (-3930.300) (-3921.370) [-3926.323] -- 0:00:53
      19000 -- (-3920.895) (-3918.541) (-3935.259) [-3921.170] * [-3918.105] (-3923.453) (-3928.065) (-3927.715) -- 0:00:51
      19500 -- (-3921.119) (-3918.284) (-3926.753) [-3919.578] * (-3917.494) [-3929.305] (-3925.172) (-3932.312) -- 0:00:50
      20000 -- (-3921.119) (-3931.257) [-3927.298] (-3922.112) * (-3920.396) [-3927.403] (-3925.129) (-3925.251) -- 0:00:49

      Average standard deviation of split frequencies: 0.058826

      20500 -- (-3921.119) (-3927.002) [-3925.703] (-3922.498) * (-3921.868) (-3926.574) (-3922.788) [-3927.210] -- 0:00:47
      21000 -- (-3921.123) (-3921.947) [-3919.927] (-3923.941) * (-3920.161) [-3922.914] (-3921.487) (-3930.449) -- 0:00:46
      21500 -- (-3920.595) [-3926.423] (-3932.581) (-3923.036) * (-3920.678) [-3925.140] (-3930.898) (-3924.320) -- 0:00:45
      22000 -- (-3920.555) (-3927.161) (-3930.723) [-3921.434] * (-3923.187) [-3931.317] (-3917.377) (-3925.066) -- 0:00:44
      22500 -- (-3921.803) (-3926.591) [-3930.701] (-3921.616) * (-3921.165) [-3923.568] (-3927.739) (-3923.928) -- 0:01:26
      23000 -- (-3921.858) (-3922.071) [-3921.459] (-3922.074) * (-3919.294) [-3931.262] (-3932.468) (-3927.509) -- 0:01:24
      23500 -- [-3920.478] (-3920.569) (-3927.920) (-3925.790) * (-3920.899) (-3927.449) [-3927.800] (-3921.571) -- 0:01:23
      24000 -- (-3920.479) (-3922.022) [-3926.057] (-3925.855) * (-3919.013) (-3928.660) [-3919.500] (-3925.962) -- 0:01:21
      24500 -- (-3920.570) (-3920.795) [-3920.373] (-3923.924) * (-3918.555) (-3928.297) (-3919.716) [-3926.652] -- 0:01:19
      25000 -- (-3919.952) [-3919.337] (-3923.058) (-3920.679) * (-3920.894) (-3928.731) [-3919.565] (-3920.626) -- 0:01:18

      Average standard deviation of split frequencies: 0.044503

      25500 -- (-3920.384) [-3919.572] (-3920.745) (-3920.616) * (-3923.582) (-3928.074) (-3923.561) [-3921.944] -- 0:01:16
      26000 -- [-3920.717] (-3923.356) (-3921.162) (-3923.524) * (-3921.753) (-3928.535) (-3925.352) [-3920.565] -- 0:01:14