--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 09:49:09 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/argG/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1639.58         -1642.40
2      -1639.55         -1642.97
--------------------------------------
TOTAL    -1639.57         -1642.73
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.888905    0.087478    0.348699    1.484524    0.854171   1373.45   1431.76    1.000
r(A<->C){all}   0.161517    0.020381    0.000073    0.451137    0.123064    240.00    255.50    1.005
r(A<->G){all}   0.164211    0.018920    0.000007    0.439029    0.126257    223.72    255.80    1.001
r(A<->T){all}   0.156965    0.016809    0.000007    0.413118    0.126081    307.21    315.45    1.000
r(C<->G){all}   0.168742    0.019680    0.000026    0.448962    0.132751    161.42    196.95    1.013
r(C<->T){all}   0.173489    0.020864    0.000049    0.459913    0.133581    137.90    161.74    1.003
r(G<->T){all}   0.175076    0.020616    0.000025    0.464602    0.138698     84.93    156.35    1.000
pi(A){all}      0.202726    0.000136    0.179035    0.224818    0.202233   1386.27   1443.63    1.000
pi(C){all}      0.269874    0.000164    0.244071    0.294306    0.269851   1289.74   1318.36    1.000
pi(G){all}      0.319128    0.000183    0.291277    0.344389    0.318839   1171.12   1205.96    1.000
pi(T){all}      0.208272    0.000132    0.186032    0.230638    0.208271   1429.67   1465.33    1.000
alpha{1,2}      0.419433    0.227642    0.000140    1.397790    0.251660   1113.97   1307.48    1.000
alpha{3}        0.450355    0.232497    0.000391    1.407706    0.297716   1349.42   1386.95    1.000
pinvar{all}     0.998755    0.000002    0.995945    1.000000    0.999205   1093.61   1189.54    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1575.518138
Model 2: PositiveSelection	-1575.517872
Model 0: one-ratio	-1575.518371
Model 7: beta	-1575.518269
Model 8: beta&w>1	-1575.517872


Model 0 vs 1	4.659999999603315E-4

Model 2 vs 1	5.320000000210712E-4

Model 8 vs 7	7.940000000417058E-4
>C1
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C2
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C3
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C4
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C5
MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLRo
>C6
MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLRo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=400 

C1              LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
C2              LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
C3              LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
C4              LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
C5              -MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
C6              -MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
                 *************************************************

C1              RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
C2              RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
C3              RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
C4              RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
C5              RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
C6              RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
                **************************************************

C1              KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
C2              KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
C3              KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
C4              KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
C5              KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
C6              KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
                **************************************************

C1              WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
C2              WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
C3              WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
C4              WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
C5              WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
C6              WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
                **************************************************

C1              EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
C2              EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
C3              EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
C4              EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
C5              EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
C6              EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
                **************************************************

C1              AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
C2              AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
C3              AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
C4              AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
C5              AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
C6              AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
                **************************************************

C1              KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
C2              KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
C3              KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
C4              KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
C5              KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
C6              KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
                **************************************************

C1              VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR-
C2              VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR-
C3              VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR-
C4              VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR-
C5              VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLRo
C6              VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLRo
                ************************************************* 




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  399 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  399 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12002]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [12002]--->[12002]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.533 Mb, Max= 30.980 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
C2              MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
C3              MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
C4              MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
C5              MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
C6              MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
                **************************************************

C1              ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
C2              ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
C3              ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
C4              ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
C5              ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
C6              ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
                **************************************************

C1              HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
C2              HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
C3              HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
C4              HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
C5              HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
C6              HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
                **************************************************

C1              TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
C2              TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
C3              TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
C4              TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
C5              TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
C6              TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
                **************************************************

C1              VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
C2              VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
C3              VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
C4              VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
C5              VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
C6              VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
                **************************************************

C1              QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
C2              QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
C3              QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
C4              QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
C5              QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
C6              QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
                **************************************************

C1              RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
C2              RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
C3              RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
C4              RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
C5              RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
C6              RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
                **************************************************

C1              NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
C2              NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
C3              NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
C4              NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
C5              NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
C6              NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
                ************************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
C2              TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
C3              TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
C4              TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
C5              ---ATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
C6              ---ATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
                   ***********************************************

C1              GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
C2              GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
C3              GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
C4              GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
C5              GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
C6              GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
                **************************************************

C1              TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
C2              TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
C3              TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
C4              TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
C5              TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
C6              TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
                **************************************************

C1              CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
C2              CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
C3              CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
C4              CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
C5              CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
C6              CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
                **************************************************

C1              CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
C2              CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
C3              CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
C4              CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
C5              CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
C6              CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
                **************************************************

C1              ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
C2              ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
C3              ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
C4              ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
C5              ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
C6              ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
                **************************************************

C1              AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
C2              AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
C3              AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
C4              AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
C5              AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
C6              AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
                **************************************************

C1              CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
C2              CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
C3              CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
C4              CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
C5              CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
C6              CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
                **************************************************

C1              CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
C2              CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
C3              CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
C4              CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
C5              CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
C6              CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
                **************************************************

C1              TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
C2              TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
C3              TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
C4              TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
C5              TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
C6              TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
                **************************************************

C1              CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
C2              CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
C3              CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
C4              CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
C5              CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
C6              CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
                **************************************************

C1              GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
C2              GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
C3              GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
C4              GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
C5              GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
C6              GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
                **************************************************

C1              GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
C2              GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
C3              GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
C4              GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
C5              GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
C6              GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
                **************************************************

C1              TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
C2              TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
C3              TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
C4              TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
C5              TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
C6              TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
                **************************************************

C1              GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
C2              GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
C3              GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
C4              GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
C5              GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
C6              GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
                **************************************************

C1              GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
C2              GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
C3              GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
C4              GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
C5              GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
C6              GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
                **************************************************

C1              CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
C2              CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
C3              CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
C4              CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
C5              CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
C6              CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
                **************************************************

C1              CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
C2              CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
C3              CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
C4              CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
C5              CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
C6              CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
                **************************************************

C1              AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
C2              AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
C3              AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
C4              AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
C5              AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
C6              AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
                **************************************************

C1              GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
C2              GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
C3              GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
C4              GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
C5              GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
C6              GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
                **************************************************

C1              AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
C2              AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
C3              AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
C4              AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
C5              AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
C6              AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
                **************************************************

C1              GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
C2              GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
C3              GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
C4              GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
C5              GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
C6              GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
                **************************************************

C1              CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
C2              CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
C3              CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
C4              CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
C5              CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
C6              CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
                **************************************************

C1              ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
C2              ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
C3              ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
C4              ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
C5              ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
C6              ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
                ***********************************************   



>C1
TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
>C2
TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
>C3
TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
>C4
TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
>C5
---ATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
>C6
---ATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
>C1
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C2
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C3
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C4
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C5
oMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C6
oMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1200 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579772843
      Setting output file names to "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1089045369
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 8508321725
      Seed = 731685120
      Swapseed = 1579772843
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 6 unique site patterns
      Division 2 has 6 unique site patterns
      Division 3 has 6 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2678.358790 -- -24.965149
         Chain 2 -- -2678.369029 -- -24.965149
         Chain 3 -- -2678.358635 -- -24.965149
         Chain 4 -- -2678.100905 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2678.358790 -- -24.965149
         Chain 2 -- -2678.368875 -- -24.965149
         Chain 3 -- -2678.369029 -- -24.965149
         Chain 4 -- -2678.369018 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2678.359] (-2678.369) (-2678.359) (-2678.101) * [-2678.359] (-2678.369) (-2678.369) (-2678.369) 
        500 -- (-1665.042) (-1652.303) (-1645.153) [-1643.716] * [-1653.325] (-1667.291) (-1653.291) (-1654.395) -- 0:00:00
       1000 -- (-1660.321) [-1651.499] (-1659.220) (-1645.306) * [-1644.470] (-1657.848) (-1652.306) (-1647.565) -- 0:00:00
       1500 -- (-1649.573) (-1649.283) [-1644.492] (-1650.953) * [-1649.134] (-1645.384) (-1651.220) (-1657.816) -- 0:00:00
       2000 -- (-1650.895) (-1650.589) (-1651.776) [-1645.391] * (-1650.085) [-1643.524] (-1648.338) (-1652.186) -- 0:00:00
       2500 -- (-1650.933) (-1662.338) [-1643.995] (-1653.301) * (-1642.987) (-1653.184) (-1656.097) [-1643.562] -- 0:00:00
       3000 -- (-1655.173) (-1646.246) [-1646.073] (-1648.089) * [-1646.506] (-1646.945) (-1656.648) (-1645.426) -- 0:00:00
       3500 -- (-1648.532) (-1648.128) (-1655.128) [-1649.717] * (-1650.998) (-1655.443) [-1645.221] (-1644.726) -- 0:00:00
       4000 -- (-1651.168) [-1649.006] (-1648.793) (-1650.904) * (-1648.779) [-1653.798] (-1669.397) (-1651.608) -- 0:00:00
       4500 -- (-1649.878) (-1649.385) [-1652.282] (-1653.189) * [-1651.801] (-1650.557) (-1647.073) (-1656.404) -- 0:00:00
       5000 -- (-1650.156) (-1651.615) (-1653.538) [-1650.145] * [-1649.648] (-1647.309) (-1646.523) (-1653.562) -- 0:00:00

      Average standard deviation of split frequencies: 0.082309

       5500 -- (-1655.160) (-1652.563) [-1646.867] (-1664.064) * [-1655.958] (-1655.073) (-1652.267) (-1656.820) -- 0:00:00
       6000 -- (-1645.765) [-1644.357] (-1649.630) (-1652.789) * (-1648.836) (-1651.069) (-1651.135) [-1646.552] -- 0:00:00
       6500 -- (-1650.308) (-1652.015) (-1647.290) [-1658.101] * (-1644.132) [-1650.960] (-1645.342) (-1659.143) -- 0:00:00
       7000 -- (-1652.661) [-1658.683] (-1652.645) (-1644.990) * (-1647.537) (-1657.436) [-1645.440] (-1649.754) -- 0:00:00
       7500 -- (-1646.608) (-1654.860) [-1656.754] (-1654.601) * (-1647.503) [-1649.843] (-1649.346) (-1646.035) -- 0:00:00
       8000 -- (-1656.363) [-1652.980] (-1653.462) (-1652.315) * (-1646.399) (-1651.350) (-1654.304) [-1643.272] -- 0:00:00
       8500 -- [-1648.103] (-1651.147) (-1648.959) (-1663.184) * (-1648.298) (-1654.851) [-1641.885] (-1646.086) -- 0:00:00
       9000 -- (-1655.794) (-1649.032) [-1646.672] (-1646.965) * (-1652.173) (-1652.138) [-1649.856] (-1652.396) -- 0:00:00
       9500 -- [-1656.619] (-1651.828) (-1651.383) (-1652.046) * (-1651.283) [-1653.201] (-1657.482) (-1651.184) -- 0:00:00
      10000 -- (-1653.453) (-1650.751) [-1645.423] (-1655.346) * [-1646.546] (-1653.256) (-1656.851) (-1647.777) -- 0:01:39

      Average standard deviation of split frequencies: 0.072106

      10500 -- (-1651.683) [-1649.012] (-1649.499) (-1659.985) * [-1646.711] (-1655.715) (-1651.323) (-1654.851) -- 0:01:34
      11000 -- (-1648.885) (-1645.169) (-1643.669) [-1645.485] * (-1654.849) [-1644.865] (-1653.739) (-1645.774) -- 0:01:29
      11500 -- (-1663.385) (-1645.354) [-1650.963] (-1653.592) * (-1644.811) [-1643.396] (-1657.173) (-1653.317) -- 0:01:25
      12000 -- (-1647.294) (-1650.798) (-1655.914) [-1646.291] * (-1652.420) (-1648.151) [-1647.717] (-1651.821) -- 0:01:22
      12500 -- (-1646.600) [-1647.300] (-1650.113) (-1650.913) * (-1651.992) (-1647.603) (-1644.705) [-1645.187] -- 0:01:19
      13000 -- (-1648.906) (-1648.070) (-1648.697) [-1645.554] * (-1647.367) (-1654.125) (-1658.752) [-1647.998] -- 0:01:15
      13500 -- (-1649.970) (-1646.576) (-1653.431) [-1647.927] * (-1662.694) (-1645.359) [-1652.704] (-1652.472) -- 0:01:13
      14000 -- (-1649.567) (-1651.197) [-1647.689] (-1655.322) * [-1650.985] (-1651.599) (-1646.296) (-1653.132) -- 0:01:10
      14500 -- (-1654.559) [-1645.624] (-1650.269) (-1649.487) * [-1645.622] (-1651.433) (-1645.551) (-1652.467) -- 0:01:07
      15000 -- (-1652.052) (-1646.180) (-1651.301) [-1646.963] * (-1657.381) (-1647.331) [-1644.846] (-1654.245) -- 0:01:05

      Average standard deviation of split frequencies: 0.060329

      15500 -- (-1644.847) (-1649.170) (-1644.523) [-1645.858] * (-1650.373) (-1655.185) [-1647.388] (-1653.125) -- 0:01:03
      16000 -- [-1648.216] (-1651.339) (-1643.249) (-1648.980) * (-1642.933) [-1646.996] (-1656.707) (-1654.834) -- 0:01:01
      16500 -- [-1646.346] (-1647.062) (-1656.042) (-1651.293) * (-1660.586) (-1660.231) [-1644.717] (-1658.358) -- 0:00:59
      17000 -- (-1648.844) (-1647.225) (-1648.765) [-1653.783] * (-1653.331) [-1649.651] (-1647.456) (-1653.286) -- 0:00:57
      17500 -- (-1648.347) (-1648.674) (-1647.160) [-1655.295] * (-1650.970) (-1646.827) (-1647.778) [-1649.303] -- 0:00:56
      18000 -- [-1649.057] (-1646.748) (-1648.001) (-1649.794) * (-1646.198) [-1651.346] (-1653.675) (-1650.753) -- 0:00:54
      18500 -- [-1644.777] (-1652.685) (-1649.529) (-1651.277) * (-1653.693) (-1649.327) [-1646.375] (-1646.166) -- 0:00:53
      19000 -- (-1650.658) (-1647.826) (-1648.593) [-1647.619] * [-1653.018] (-1648.061) (-1646.563) (-1646.056) -- 0:00:51
      19500 -- (-1653.231) (-1645.788) (-1652.744) [-1649.396] * (-1645.939) (-1652.808) (-1645.708) [-1652.082] -- 0:00:50
      20000 -- [-1644.333] (-1649.097) (-1647.137) (-1657.752) * [-1645.047] (-1646.331) (-1651.304) (-1647.682) -- 0:00:49

      Average standard deviation of split frequencies: 0.059559

      20500 -- (-1644.313) [-1646.797] (-1654.689) (-1657.694) * (-1646.984) (-1649.083) (-1650.787) [-1644.918] -- 0:00:47
      21000 -- (-1657.443) [-1645.825] (-1648.650) (-1648.023) * (-1647.681) (-1650.000) [-1644.581] (-1649.215) -- 0:00:46
      21500 -- (-1655.935) (-1652.126) (-1647.378) [-1650.223] * [-1645.022] (-1647.843) (-1650.059) (-1652.429) -- 0:00:45
      22000 -- [-1644.592] (-1654.200) (-1646.834) (-1657.154) * [-1643.575] (-1648.105) (-1652.404) (-1655.729) -- 0:00:44
      22500 -- [-1649.718] (-1657.580) (-1644.890) (-1653.658) * (-1651.859) [-1649.225] (-1645.762) (-1648.450) -- 0:00:43
      23000 -- [-1648.235] (-1651.460) (-1643.056) (-1648.960) * (-1650.264) (-1646.303) [-1653.207] (-1652.644) -- 0:01:24
      23500 -- [-1644.817] (-1648.986) (-1640.087) (-1645.491) * [-1647.435] (-1650.683) (-1647.951) (-1650.054) -- 0:01:23
      24000 -- (-1656.319) (-1651.377) [-1640.934] (-1644.902) * [-1647.010] (-1648.149) (-1649.589) (-1646.148) -- 0:01:21
      24500 -- (-1648.326) (-1646.988) (-1640.171) [-1646.778] * [-1651.243] (-1656.993) (-1655.028) (-1644.036) -- 0:01:19
      25000 -- (-1648.151) (-1653.951) [-1639.865] (-1649.737) * (-1645.971) (-1648.012) (-1652.708) [-1647.243] -- 0:01:18

      Average standard deviation of split frequencies: 0.046622

      25500 -- [-1649.346] (-1647.112) (-1639.955) (-1650.531) * (-1659.607) [-1646.118] (-1644.311) (-1649.213) -- 0:01:16
      26000 -- (-1656.833) [-1653.269] (-1642.424) (-1648.973) * (-1651.062) (-1646.294) (-1652.523) [-1648.841] -- 0:01:14
      26500 -- (-1647.055) (-1654.474) (-1640.352) [-1649.588] * (-1655.799) (-1647.898) (-1654.145) [-1649.844] -- 0:01:13
      27000 -- (-1651.863) [-1649.513] (-1642.105) (-1655.052) * [-1648.265] (-1652.362) (-1650.854) (-1653.191) -- 0:01:12
      27500 -- (-1654.799) [-1648.144] (-1643.531) (-1646.233) * (-1647.379) (-1652.476) (-1654.453) [-1646.152] -- 0:01:10
      28000 -- (-1648.336) (-1649.921) (-1639.368) [-1650.667] * [-1649.262] (-1654.393) (-1649.282) (-1653.637) -- 0:01:09
      28500 -- (-1645.134) (-1655.095) (-1639.162) [-1646.307] * (-1643.226) (-1651.760) (-1650.569) [-1651.640] -- 0:01:08
      29000 -- (-1650.930) (-1645.003) [-1643.338] (-1656.406) * (-1654.479) [-1647.653] (-1647.976) (-1660.676) -- 0:01:06
      29500 -- (-1659.644) [-1646.372] (-1640.444) (-1651.852) * (-1646.234) (-1660.273) (-1651.675) [-1644.551] -- 0:01:05
      30000 -- (-1664.315) (-1646.823) [-1642.055] (-1649.125) * (-1646.351) [-1650.904] (-1658.578) (-1649.863) -- 0:01:04

      Average standard deviation of split frequencies: 0.046116

      30500 -- (-1650.907) (-1647.570) (-1641.504) [-1645.560] * (-1657.635) (-1644.133) [-1646.151] (-1656.317) -- 0:01:03
      31000 -- (-1647.898) (-1653.820) [-1643.685] (-1650.967) * (-1655.918) (-1649.821) (-1654.483) [-1645.792] -- 0:01:02
      31500 -- (-1655.960) [-1652.113] (-1642.640) (-1650.997) * (-1651.941) (-1658.623) (-1647.528) [-1644.527] -- 0:01:01
      32000 -- (-1647.430) (-1655.349) (-1639.729) [-1643.002] * (-1652.262) (-1646.407) (-1645.681) [-1648.747] -- 0:01:00
      32500 -- (-1653.803) (-1650.573) [-1644.552] (-1646.931) * (-1651.247) (-1646.396) (-1643.960) [-1643.741] -- 0:00:59
      33000 -- (-1647.905) [-1643.726] (-1638.491) (-1652.361) * (-1648.463) (-1651.411) (-1649.292) [-1651.765] -- 0:00:58
      33500 -- (-1656.627) (-1651.358) [-1639.839] (-1645.929) * [-1642.785] (-1651.212) (-1653.759) (-1649.359) -- 0:00:57
      34000 -- (-1648.862) (-1651.038) [-1639.860] (-1645.390) * (-1653.068) (-1648.026) (-1650.568) [-1651.085] -- 0:00:56
      34500 -- (-1645.715) [-1646.738] (-1639.034) (-1650.110) * (-1648.254) [-1646.183] (-1654.922) (-1654.625) -- 0:00:55
      35000 -- (-1654.011) (-1650.054) [-1638.940] (-1645.951) * (-1646.135) (-1649.575) (-1649.246) [-1641.917] -- 0:00:55

      Average standard deviation of split frequencies: 0.041069

      35500 -- [-1651.352] (-1652.094) (-1639.512) (-1650.488) * (-1649.087) (-1650.965) (-1652.535) [-1649.082] -- 0:00:54
      36000 -- (-1650.366) (-1653.632) [-1642.123] (-1649.509) * (-1655.762) (-1645.222) (-1648.480) [-1644.557] -- 0:01:20
      36500 -- [-1646.157] (-1651.417) (-1639.577) (-1643.407) * (-1646.008) (-1648.075) (-1645.442) [-1648.283] -- 0:01:19
      37000 -- (-1646.130) [-1649.928] (-1640.166) (-1644.087) * (-1651.084) (-1645.735) (-1646.154) [-1649.903] -- 0:01:18
      37500 -- (-1651.700) (-1654.556) [-1638.996] (-1642.106) * (-1649.945) [-1645.883] (-1653.106) (-1652.841) -- 0:01:17
      38000 -- (-1649.144) [-1651.631] (-1638.594) (-1644.249) * [-1645.572] (-1651.999) (-1643.556) (-1660.360) -- 0:01:15
      38500 -- [-1645.340] (-1653.060) (-1638.925) (-1641.902) * [-1648.470] (-1648.720) (-1644.434) (-1650.428) -- 0:01:14
      39000 -- (-1646.784) (-1655.214) [-1640.363] (-1642.046) * (-1649.187) (-1644.247) [-1646.654] (-1644.496) -- 0:01:13
      39500 -- (-1646.325) (-1650.386) [-1638.534] (-1644.641) * (-1653.647) (-1649.135) [-1646.977] (-1644.940) -- 0:01:12
      40000 -- (-1654.531) (-1645.450) [-1638.974] (-1639.860) * (-1653.747) (-1658.382) [-1644.701] (-1651.118) -- 0:01:12

      Average standard deviation of split frequencies: 0.035830

      40500 -- [-1649.359] (-1644.958) (-1641.422) (-1640.812) * (-1645.436) [-1654.741] (-1645.319) (-1653.102) -- 0:01:11
      41000 -- (-1648.929) [-1641.527] (-1639.039) (-1639.712) * (-1649.937) (-1652.013) [-1651.145] (-1646.046) -- 0:01:10
      41500 -- (-1646.605) [-1640.232] (-1639.479) (-1639.127) * (-1645.029) (-1645.170) (-1651.066) [-1645.031] -- 0:01:09
      42000 -- (-1655.518) [-1638.534] (-1639.135) (-1638.163) * [-1650.199] (-1644.624) (-1647.822) (-1648.445) -- 0:01:08
      42500 -- (-1659.674) [-1638.944] (-1638.897) (-1638.609) * (-1645.364) [-1646.627] (-1655.038) (-1651.790) -- 0:01:07
      43000 -- (-1655.315) [-1643.137] (-1640.083) (-1640.590) * (-1651.191) (-1650.474) [-1647.303] (-1645.419) -- 0:01:06
      43500 -- (-1646.408) [-1640.201] (-1639.333) (-1640.126) * [-1648.354] (-1655.093) (-1656.286) (-1657.018) -- 0:01:05
      44000 -- (-1644.377) (-1639.006) (-1641.012) [-1639.966] * [-1650.458] (-1652.153) (-1656.308) (-1649.392) -- 0:01:05
      44500 -- (-1646.088) (-1641.006) (-1649.911) [-1638.493] * (-1644.647) [-1648.424] (-1646.108) (-1645.367) -- 0:01:04
      45000 -- (-1648.396) (-1641.121) [-1645.248] (-1640.359) * [-1639.305] (-1651.980) (-1651.684) (-1645.649) -- 0:01:03

      Average standard deviation of split frequencies: 0.037731

      45500 -- (-1649.869) [-1639.256] (-1642.169) (-1639.815) * (-1641.337) [-1652.052] (-1652.948) (-1648.183) -- 0:01:02
      46000 -- (-1643.654) [-1639.148] (-1642.688) (-1640.253) * (-1639.721) (-1653.334) (-1651.064) [-1642.958] -- 0:01:02
      46500 -- (-1646.357) (-1646.232) (-1647.005) [-1639.009] * (-1641.870) (-1651.840) (-1651.791) [-1649.207] -- 0:01:01
      47000 -- (-1649.008) (-1639.959) (-1644.646) [-1639.818] * [-1639.358] (-1652.131) (-1658.388) (-1649.594) -- 0:01:00
      47500 -- (-1665.872) (-1640.577) (-1641.041) [-1639.569] * (-1639.886) (-1663.339) [-1650.906] (-1651.398) -- 0:01:00
      48000 -- (-1640.187) (-1640.156) [-1642.240] (-1640.879) * (-1639.943) (-1654.063) [-1651.694] (-1648.992) -- 0:00:59
      48500 -- [-1642.423] (-1638.922) (-1644.196) (-1639.480) * (-1639.560) (-1662.212) (-1655.763) [-1652.470] -- 0:00:58
      49000 -- (-1642.395) (-1638.038) (-1643.439) [-1639.868] * (-1643.018) (-1639.373) [-1653.016] (-1646.326) -- 0:00:58
      49500 -- (-1644.501) (-1638.033) [-1641.593] (-1640.173) * (-1641.003) (-1639.608) (-1644.011) [-1650.785] -- 0:01:16
      50000 -- (-1641.278) (-1638.460) (-1639.965) [-1639.410] * [-1640.303] (-1643.130) (-1654.515) (-1649.326) -- 0:01:16

      Average standard deviation of split frequencies: 0.031148

      50500 -- (-1639.745) [-1638.470] (-1641.865) (-1641.494) * (-1642.465) [-1640.095] (-1648.966) (-1651.850) -- 0:01:15
      51000 -- (-1641.208) [-1638.589] (-1646.123) (-1639.216) * (-1640.757) [-1639.843] (-1654.925) (-1642.311) -- 0:01:14
      51500 -- (-1643.639) (-1638.800) (-1648.868) [-1639.214] * (-1643.164) (-1640.685) [-1651.997] (-1647.320) -- 0:01:13
      52000 -- (-1642.866) (-1640.958) (-1644.087) [-1639.040] * [-1639.068] (-1644.752) (-1648.523) (-1650.350) -- 0:01:12
      52500 -- (-1641.150) [-1639.902] (-1647.334) (-1641.018) * (-1638.233) (-1642.180) (-1661.509) [-1651.700] -- 0:01:12
      53000 -- [-1641.594] (-1639.619) (-1642.564) (-1638.928) * [-1638.229] (-1639.943) (-1649.183) (-1650.015) -- 0:01:11
      53500 -- (-1642.133) (-1638.466) (-1642.042) [-1638.663] * [-1638.235] (-1639.920) (-1653.868) (-1646.206) -- 0:01:10
      54000 -- (-1642.515) (-1638.429) (-1643.032) [-1638.664] * [-1641.199] (-1639.421) (-1648.575) (-1649.570) -- 0:01:10
      54500 -- [-1640.286] (-1638.352) (-1641.217) (-1641.314) * (-1639.347) [-1640.518] (-1649.078) (-1656.043) -- 0:01:09
      55000 -- (-1642.417) [-1638.348] (-1642.060) (-1638.266) * [-1639.687] (-1640.707) (-1656.099) (-1652.089) -- 0:01:08

      Average standard deviation of split frequencies: 0.030064

      55500 -- (-1639.921) [-1639.946] (-1640.541) (-1640.574) * (-1641.647) (-1639.718) [-1654.067] (-1649.902) -- 0:01:08
      56000 -- (-1641.246) [-1641.622] (-1640.415) (-1641.668) * (-1645.379) (-1639.526) [-1650.392] (-1648.569) -- 0:01:07
      56500 -- (-1641.874) [-1639.807] (-1643.239) (-1639.298) * (-1641.908) (-1643.110) [-1648.157] (-1650.425) -- 0:01:06
      57000 -- (-1644.195) (-1639.497) [-1647.600] (-1638.297) * (-1641.118) (-1641.079) (-1640.515) [-1645.077] -- 0:01:06
      57500 -- [-1643.370] (-1640.243) (-1646.251) (-1638.985) * (-1642.187) (-1640.246) [-1640.593] (-1647.927) -- 0:01:05
      58000 -- (-1641.150) [-1640.189] (-1639.865) (-1641.156) * (-1641.622) (-1640.839) [-1639.709] (-1647.646) -- 0:01:04
      58500 -- (-1642.521) [-1640.822] (-1639.521) (-1642.216) * (-1641.554) [-1640.735] (-1641.524) (-1646.283) -- 0:01:04
      59000 -- (-1641.609) [-1639.910] (-1640.478) (-1640.888) * (-1640.923) (-1646.165) (-1640.089) [-1645.321] -- 0:01:03
      59500 -- (-1640.024) (-1639.827) [-1638.910] (-1641.589) * (-1640.268) (-1642.338) (-1640.033) [-1652.285] -- 0:01:03
      60000 -- (-1639.808) (-1639.827) [-1639.281] (-1640.697) * (-1644.656) [-1639.516] (-1640.441) (-1645.077) -- 0:01:02

      Average standard deviation of split frequencies: 0.032247

      60500 -- (-1639.966) (-1639.498) [-1639.466] (-1639.102) * (-1639.757) [-1639.014] (-1641.866) (-1648.514) -- 0:01:02
      61000 -- (-1640.967) (-1640.709) (-1640.552) [-1639.752] * (-1639.003) (-1640.003) (-1639.786) [-1646.649] -- 0:01:01
      61500 -- (-1640.441) (-1641.517) (-1646.358) [-1639.981] * (-1643.115) (-1638.433) (-1639.046) [-1651.971] -- 0:01:01
      62000 -- [-1638.940] (-1641.219) (-1640.376) (-1639.914) * [-1641.120] (-1640.404) (-1641.144) (-1648.752) -- 0:01:00
      62500 -- (-1638.640) (-1639.458) (-1640.087) [-1640.200] * [-1640.029] (-1640.551) (-1638.762) (-1644.030) -- 0:01:15
      63000 -- [-1638.153] (-1639.441) (-1640.192) (-1640.382) * [-1640.292] (-1639.515) (-1639.605) (-1647.402) -- 0:01:14
      63500 -- (-1640.165) (-1640.582) (-1644.164) [-1639.931] * (-1638.930) (-1639.610) [-1639.605] (-1654.645) -- 0:01:13
      64000 -- (-1638.896) [-1641.746] (-1639.345) (-1640.530) * (-1639.214) [-1639.658] (-1640.178) (-1644.345) -- 0:01:13
      64500 -- [-1638.875] (-1642.178) (-1640.876) (-1638.940) * [-1639.232] (-1640.712) (-1640.492) (-1656.151) -- 0:01:12
      65000 -- (-1638.106) (-1642.596) [-1640.282] (-1639.315) * [-1639.838] (-1640.085) (-1640.426) (-1655.912) -- 0:01:11

      Average standard deviation of split frequencies: 0.032651

      65500 -- (-1639.626) (-1639.989) (-1644.119) [-1640.518] * (-1638.916) [-1640.309] (-1639.283) (-1652.994) -- 0:01:11
      66000 -- (-1640.844) [-1639.722] (-1643.354) (-1642.223) * (-1638.217) [-1639.229] (-1640.526) (-1656.029) -- 0:01:10
      66500 -- [-1640.548] (-1642.331) (-1639.795) (-1640.523) * (-1639.012) (-1638.730) (-1638.455) [-1650.078] -- 0:01:10
      67000 -- (-1641.758) (-1643.039) (-1638.553) [-1639.964] * (-1639.414) (-1638.096) (-1640.095) [-1648.566] -- 0:01:09
      67500 -- [-1640.882] (-1638.379) (-1641.192) (-1639.608) * (-1638.587) (-1641.171) [-1640.874] (-1650.344) -- 0:01:09
      68000 -- [-1640.946] (-1639.652) (-1638.416) (-1642.527) * (-1639.780) (-1639.587) (-1641.633) [-1643.975] -- 0:01:08
      68500 -- (-1641.568) (-1643.568) [-1638.504] (-1643.110) * (-1638.609) (-1641.637) (-1639.679) [-1653.954] -- 0:01:07
      69000 -- (-1639.897) [-1639.179] (-1641.539) (-1640.566) * [-1640.523] (-1638.915) (-1639.490) (-1649.874) -- 0:01:07
      69500 -- [-1639.196] (-1638.614) (-1640.385) (-1640.412) * [-1639.771] (-1640.329) (-1643.106) (-1653.153) -- 0:01:06
      70000 -- (-1639.637) (-1642.259) [-1638.552] (-1640.412) * [-1641.014] (-1640.421) (-1644.541) (-1651.941) -- 0:01:06

      Average standard deviation of split frequencies: 0.029018

      70500 -- (-1638.818) (-1642.045) [-1638.876] (-1641.118) * [-1640.117] (-1640.034) (-1639.437) (-1657.296) -- 0:01:05
      71000 -- [-1638.605] (-1640.737) (-1638.875) (-1643.404) * (-1639.902) [-1639.567] (-1639.625) (-1650.800) -- 0:01:05
      71500 -- (-1638.724) [-1639.373] (-1639.212) (-1646.044) * (-1639.431) (-1641.671) (-1640.125) [-1648.077] -- 0:01:04
      72000 -- [-1639.819] (-1639.825) (-1638.952) (-1640.292) * [-1639.428] (-1640.769) (-1640.912) (-1646.545) -- 0:01:04
      72500 -- (-1639.131) (-1643.764) [-1641.115] (-1640.424) * [-1642.016] (-1640.257) (-1639.546) (-1649.973) -- 0:01:03
      73000 -- (-1639.580) [-1645.367] (-1643.132) (-1640.202) * (-1640.472) [-1643.255] (-1639.978) (-1652.670) -- 0:01:03
      73500 -- (-1641.426) (-1644.117) (-1641.522) [-1638.588] * (-1640.660) (-1641.409) [-1639.985] (-1652.223) -- 0:01:03
      74000 -- (-1640.624) (-1641.873) [-1639.708] (-1640.681) * (-1640.194) [-1643.302] (-1640.565) (-1656.754) -- 0:01:02
      74500 -- (-1639.641) (-1639.066) (-1642.234) [-1640.530] * (-1639.844) (-1644.711) [-1640.199] (-1650.889) -- 0:01:02
      75000 -- (-1643.968) (-1638.811) (-1640.372) [-1640.560] * [-1640.211] (-1649.958) (-1640.180) (-1651.812) -- 0:01:01

      Average standard deviation of split frequencies: 0.030687

      75500 -- (-1645.395) (-1641.437) (-1642.382) [-1640.507] * (-1641.408) (-1650.454) (-1641.071) [-1646.429] -- 0:01:01
      76000 -- [-1637.999] (-1639.736) (-1642.267) (-1641.415) * (-1646.276) [-1644.661] (-1639.936) (-1648.204) -- 0:01:12
      76500 -- [-1639.379] (-1639.191) (-1641.074) (-1640.277) * (-1644.219) (-1643.773) [-1639.818] (-1651.551) -- 0:01:12
      77000 -- [-1638.432] (-1638.893) (-1641.824) (-1639.617) * (-1639.511) [-1642.498] (-1639.281) (-1660.861) -- 0:01:11
      77500 -- (-1638.615) (-1638.488) (-1640.918) [-1640.607] * (-1643.744) (-1641.004) (-1639.800) [-1646.262] -- 0:01:11
      78000 -- (-1640.367) (-1640.710) (-1640.118) [-1645.496] * (-1641.619) (-1641.473) [-1640.626] (-1648.229) -- 0:01:10
      78500 -- (-1640.824) [-1642.303] (-1638.924) (-1638.985) * [-1638.738] (-1641.343) (-1638.691) (-1640.569) -- 0:01:10
      79000 -- (-1640.164) [-1641.474] (-1640.338) (-1639.885) * (-1640.569) [-1641.118] (-1640.954) (-1639.748) -- 0:01:09
      79500 -- (-1640.095) [-1639.471] (-1639.026) (-1640.656) * (-1639.099) (-1644.061) (-1638.749) [-1641.572] -- 0:01:09
      80000 -- (-1641.359) (-1639.779) [-1638.496] (-1639.349) * (-1639.109) (-1647.133) (-1638.597) [-1640.261] -- 0:01:09

      Average standard deviation of split frequencies: 0.028895

      80500 -- [-1641.606] (-1640.089) (-1639.791) (-1638.933) * (-1639.772) (-1646.013) [-1638.300] (-1640.262) -- 0:01:08
      81000 -- [-1639.927] (-1640.237) (-1643.367) (-1639.583) * (-1639.041) (-1643.036) [-1640.220] (-1638.901) -- 0:01:08
      81500 -- (-1642.455) (-1642.921) (-1639.803) [-1639.766] * (-1639.606) (-1641.622) (-1639.001) [-1640.144] -- 0:01:07
      82000 -- (-1642.179) (-1642.150) [-1638.466] (-1640.658) * (-1639.066) (-1641.648) [-1639.536] (-1639.734) -- 0:01:07
      82500 -- (-1644.462) [-1642.180] (-1642.797) (-1643.492) * (-1639.020) (-1642.159) [-1638.628] (-1638.600) -- 0:01:06
      83000 -- [-1642.701] (-1639.494) (-1639.640) (-1642.119) * (-1638.850) (-1641.020) [-1638.690] (-1638.421) -- 0:01:06
      83500 -- (-1639.947) (-1638.504) [-1639.363] (-1640.177) * (-1640.763) [-1640.241] (-1638.255) (-1638.817) -- 0:01:05
      84000 -- (-1643.346) (-1639.364) [-1638.470] (-1639.230) * (-1645.946) (-1640.445) (-1638.679) [-1638.575] -- 0:01:05
      84500 -- (-1642.425) (-1639.943) [-1638.376] (-1643.077) * [-1639.586] (-1640.910) (-1639.813) (-1645.199) -- 0:01:05
      85000 -- (-1640.682) (-1639.803) (-1639.968) [-1643.997] * [-1641.642] (-1644.800) (-1638.255) (-1640.545) -- 0:01:04

      Average standard deviation of split frequencies: 0.028273

      85500 -- (-1638.957) [-1639.077] (-1642.696) (-1640.309) * (-1645.123) (-1643.912) (-1639.360) [-1640.504] -- 0:01:04
      86000 -- (-1639.035) (-1638.590) [-1641.762] (-1643.729) * [-1641.066] (-1641.179) (-1642.202) (-1639.282) -- 0:01:03
      86500 -- [-1639.679] (-1638.558) (-1642.172) (-1642.085) * (-1640.309) (-1640.853) [-1638.503] (-1640.735) -- 0:01:03
      87000 -- (-1640.605) (-1638.556) [-1639.111] (-1640.383) * (-1642.980) [-1640.075] (-1640.038) (-1639.623) -- 0:01:02
      87500 -- (-1643.538) [-1638.506] (-1640.021) (-1639.990) * (-1642.099) (-1640.903) [-1638.519] (-1638.902) -- 0:01:02
      88000 -- (-1640.140) (-1638.783) [-1639.427] (-1639.681) * [-1643.594] (-1639.827) (-1638.311) (-1638.915) -- 0:01:02
      88500 -- [-1638.607] (-1642.179) (-1638.543) (-1641.204) * (-1639.451) (-1640.116) [-1640.166] (-1638.487) -- 0:01:01
      89000 -- (-1638.129) [-1644.615] (-1639.606) (-1639.146) * [-1643.209] (-1641.313) (-1640.941) (-1643.040) -- 0:01:01
      89500 -- (-1641.105) (-1642.996) [-1639.314] (-1639.138) * (-1639.118) [-1640.521] (-1639.652) (-1643.751) -- 0:01:01
      90000 -- (-1638.557) (-1639.592) (-1639.709) [-1640.894] * (-1638.315) (-1639.817) [-1641.601] (-1644.797) -- 0:01:10

      Average standard deviation of split frequencies: 0.022713

      90500 -- [-1638.703] (-1639.572) (-1640.104) (-1640.381) * [-1638.348] (-1640.295) (-1643.291) (-1641.617) -- 0:01:10
      91000 -- [-1638.710] (-1640.240) (-1638.418) (-1640.861) * (-1638.630) (-1639.706) [-1641.351] (-1642.275) -- 0:01:09
      91500 -- (-1643.532) (-1643.993) (-1638.895) [-1640.792] * (-1639.257) (-1641.410) [-1640.182] (-1641.662) -- 0:01:09
      92000 -- (-1645.152) (-1639.380) (-1638.895) [-1640.229] * (-1639.732) [-1641.410] (-1639.702) (-1640.780) -- 0:01:09
      92500 -- (-1641.098) (-1642.705) (-1639.403) [-1640.402] * (-1640.996) (-1641.185) (-1641.771) [-1643.349] -- 0:01:08
      93000 -- (-1641.488) (-1640.093) (-1640.072) [-1640.832] * (-1639.453) [-1641.021] (-1642.137) (-1647.151) -- 0:01:08
      93500 -- [-1639.051] (-1639.194) (-1640.737) (-1639.556) * (-1642.116) [-1639.804] (-1640.583) (-1641.114) -- 0:01:07
      94000 -- [-1641.263] (-1639.219) (-1641.194) (-1644.586) * (-1638.963) (-1640.301) [-1640.785] (-1642.133) -- 0:01:07
      94500 -- [-1640.059] (-1639.231) (-1640.101) (-1639.709) * [-1639.403] (-1640.494) (-1639.715) (-1643.154) -- 0:01:07
      95000 -- (-1639.925) (-1640.756) [-1640.212] (-1640.986) * (-1639.113) [-1638.955] (-1639.235) (-1643.771) -- 0:01:06

      Average standard deviation of split frequencies: 0.022097

      95500 -- (-1639.586) (-1639.282) [-1640.239] (-1639.355) * (-1639.179) (-1638.191) [-1639.560] (-1641.866) -- 0:01:06
      96000 -- [-1638.531] (-1640.653) (-1640.423) (-1639.577) * (-1638.195) (-1639.017) [-1639.045] (-1644.868) -- 0:01:05
      96500 -- [-1639.203] (-1643.841) (-1639.665) (-1641.144) * (-1639.859) (-1641.170) [-1639.226] (-1639.777) -- 0:01:05
      97000 -- [-1639.124] (-1640.828) (-1639.548) (-1640.521) * [-1641.060] (-1642.719) (-1639.355) (-1639.264) -- 0:01:05
      97500 -- (-1641.061) (-1646.516) [-1638.968] (-1639.974) * (-1641.219) (-1641.807) [-1640.532] (-1639.992) -- 0:01:04
      98000 -- [-1639.302] (-1642.321) (-1641.691) (-1642.395) * (-1641.029) [-1641.820] (-1640.674) (-1640.051) -- 0:01:04
      98500 -- (-1639.376) (-1642.545) (-1639.371) [-1640.517] * (-1640.517) (-1640.611) (-1640.439) [-1640.726] -- 0:01:04
      99000 -- (-1639.843) (-1639.578) [-1639.993] (-1641.644) * (-1639.073) (-1645.718) [-1641.774] (-1640.727) -- 0:01:03
      99500 -- [-1641.258] (-1639.870) (-1640.223) (-1641.323) * [-1639.314] (-1643.627) (-1639.670) (-1640.060) -- 0:01:03
      100000 -- (-1638.675) (-1643.132) [-1639.826] (-1643.310) * [-1639.822] (-1644.705) (-1639.004) (-1639.401) -- 0:01:02

      Average standard deviation of split frequencies: 0.020032

      100500 -- [-1640.001] (-1641.338) (-1639.861) (-1643.649) * (-1641.811) (-1639.226) (-1639.193) [-1639.973] -- 0:01:02
      101000 -- (-1641.870) (-1644.771) [-1638.996] (-1640.344) * (-1641.626) (-1639.316) (-1640.135) [-1640.448] -- 0:01:02
      101500 -- (-1640.185) [-1643.990] (-1639.555) (-1639.100) * (-1640.448) (-1639.168) [-1642.375] (-1639.562) -- 0:01:01
      102000 -- (-1647.181) (-1641.860) [-1640.579] (-1641.649) * (-1639.392) [-1641.334] (-1643.451) (-1639.538) -- 0:01:01
      102500 -- (-1646.708) (-1642.101) (-1639.434) [-1639.772] * (-1640.120) (-1641.436) (-1641.657) [-1639.063] -- 0:01:01
      103000 -- (-1642.362) (-1640.664) [-1639.353] (-1639.177) * (-1640.104) (-1641.854) (-1641.765) [-1639.309] -- 0:01:09
      103500 -- (-1645.154) (-1642.756) (-1640.825) [-1640.267] * (-1640.419) (-1641.029) (-1642.637) [-1640.172] -- 0:01:09
      104000 -- [-1640.541] (-1641.454) (-1642.019) (-1639.224) * (-1640.525) [-1638.975] (-1642.239) (-1639.634) -- 0:01:08
      104500 -- [-1639.907] (-1641.133) (-1641.095) (-1639.261) * (-1639.903) [-1639.631] (-1643.010) (-1641.435) -- 0:01:08
      105000 -- (-1640.187) [-1640.336] (-1642.828) (-1638.671) * (-1641.891) [-1639.191] (-1642.044) (-1642.695) -- 0:01:08

      Average standard deviation of split frequencies: 0.020235

      105500 -- (-1642.574) (-1641.115) (-1639.994) [-1639.158] * (-1643.243) [-1639.693] (-1640.918) (-1640.612) -- 0:01:07
      106000 -- [-1639.417] (-1642.109) (-1640.545) (-1640.533) * (-1641.966) (-1641.238) [-1642.719] (-1640.424) -- 0:01:07
      106500 -- [-1638.344] (-1640.710) (-1644.504) (-1641.408) * (-1643.418) (-1641.247) [-1641.864] (-1640.630) -- 0:01:07
      107000 -- [-1638.703] (-1639.363) (-1639.241) (-1639.868) * (-1641.320) (-1643.661) (-1641.071) [-1640.672] -- 0:01:06
      107500 -- (-1639.291) [-1640.032] (-1640.433) (-1638.615) * [-1639.177] (-1643.051) (-1639.494) (-1639.755) -- 0:01:06
      108000 -- (-1639.385) [-1639.203] (-1640.541) (-1641.599) * (-1642.535) (-1644.151) [-1642.278] (-1638.856) -- 0:01:06
      108500 -- [-1639.547] (-1639.775) (-1642.091) (-1641.239) * (-1642.183) (-1639.280) (-1641.794) [-1640.202] -- 0:01:05
      109000 -- (-1641.839) (-1643.046) (-1644.349) [-1640.158] * (-1639.462) (-1639.745) (-1639.810) [-1640.445] -- 0:01:05
      109500 -- (-1641.728) (-1642.586) (-1644.695) [-1642.246] * (-1647.071) (-1639.671) (-1640.019) [-1642.026] -- 0:01:05
      110000 -- (-1642.206) (-1641.070) (-1645.558) [-1638.049] * (-1647.906) (-1640.533) (-1642.854) [-1638.274] -- 0:01:04

      Average standard deviation of split frequencies: 0.019729

      110500 -- (-1641.383) [-1639.801] (-1642.723) (-1639.121) * [-1642.938] (-1644.030) (-1639.666) (-1640.970) -- 0:01:04
      111000 -- (-1642.536) [-1639.451] (-1644.675) (-1639.862) * (-1639.909) (-1643.521) (-1641.892) [-1638.184] -- 0:01:04
      111500 -- (-1641.653) (-1639.652) (-1642.708) [-1639.247] * (-1643.765) (-1641.306) (-1640.265) [-1638.162] -- 0:01:03
      112000 -- (-1641.654) (-1641.362) (-1639.378) [-1639.483] * (-1642.995) (-1642.766) [-1640.048] (-1638.475) -- 0:01:03
      112500 -- (-1639.479) (-1642.345) [-1640.781] (-1639.583) * (-1641.190) [-1646.654] (-1640.311) (-1639.858) -- 0:01:03
      113000 -- [-1641.149] (-1640.946) (-1639.231) (-1642.086) * [-1642.247] (-1647.097) (-1640.060) (-1639.961) -- 0:01:02
      113500 -- (-1643.397) (-1638.799) [-1639.395] (-1639.383) * [-1640.652] (-1642.351) (-1639.720) (-1645.910) -- 0:01:02
      114000 -- (-1642.985) (-1641.601) [-1638.337] (-1639.622) * (-1639.502) (-1641.167) (-1641.926) [-1644.199] -- 0:01:02
      114500 -- [-1641.459] (-1640.527) (-1638.457) (-1639.931) * (-1642.462) [-1640.427] (-1639.602) (-1646.116) -- 0:01:01
      115000 -- (-1640.551) (-1640.382) [-1639.232] (-1639.580) * [-1639.145] (-1645.217) (-1641.502) (-1642.154) -- 0:01:01

      Average standard deviation of split frequencies: 0.017111

      115500 -- (-1638.376) [-1638.386] (-1638.576) (-1639.671) * (-1639.904) (-1639.891) [-1639.778] (-1643.571) -- 0:01:01
      116000 -- (-1638.642) [-1639.135] (-1642.564) (-1642.088) * [-1640.018] (-1640.400) (-1640.802) (-1642.499) -- 0:01:00
      116500 -- [-1639.480] (-1642.164) (-1641.854) (-1640.911) * [-1641.713] (-1640.254) (-1639.754) (-1640.080) -- 0:01:08
      117000 -- [-1639.347] (-1642.605) (-1641.135) (-1639.509) * (-1640.529) [-1639.759] (-1639.603) (-1639.862) -- 0:01:07
      117500 -- [-1640.127] (-1639.414) (-1642.290) (-1640.790) * (-1642.056) [-1638.113] (-1639.466) (-1638.678) -- 0:01:07
      118000 -- [-1639.283] (-1639.005) (-1640.018) (-1641.638) * (-1641.575) [-1640.773] (-1641.410) (-1639.129) -- 0:01:07
      118500 -- (-1641.268) (-1641.963) (-1639.136) [-1642.896] * [-1640.028] (-1641.777) (-1641.733) (-1640.255) -- 0:01:06
      119000 -- (-1640.805) (-1642.659) [-1638.895] (-1641.639) * [-1640.057] (-1640.577) (-1641.270) (-1639.346) -- 0:01:06
      119500 -- (-1642.663) [-1639.924] (-1641.762) (-1638.087) * (-1641.888) (-1640.028) [-1641.543] (-1639.249) -- 0:01:06
      120000 -- (-1644.524) (-1639.989) (-1642.834) [-1638.148] * (-1644.267) [-1638.271] (-1639.988) (-1640.197) -- 0:01:06

      Average standard deviation of split frequencies: 0.019074

      120500 -- (-1643.112) (-1641.543) (-1640.977) [-1638.610] * (-1642.006) [-1638.440] (-1640.018) (-1640.510) -- 0:01:05
      121000 -- (-1640.658) [-1639.171] (-1640.990) (-1639.261) * (-1642.551) (-1639.022) [-1640.605] (-1641.119) -- 0:01:05
      121500 -- (-1641.838) (-1640.413) (-1639.196) [-1639.525] * (-1643.540) (-1640.438) (-1639.518) [-1642.747] -- 0:01:05
      122000 -- (-1642.099) [-1641.111] (-1639.924) (-1641.494) * (-1639.189) (-1638.529) (-1639.537) [-1639.676] -- 0:01:04
      122500 -- [-1643.309] (-1639.968) (-1641.997) (-1639.839) * [-1638.955] (-1638.559) (-1641.204) (-1640.928) -- 0:01:04
      123000 -- (-1641.663) [-1639.000] (-1638.866) (-1644.073) * (-1641.049) (-1640.657) (-1641.805) [-1639.275] -- 0:01:04
      123500 -- (-1642.182) [-1641.233] (-1642.545) (-1641.473) * (-1639.015) (-1640.092) (-1638.293) [-1639.311] -- 0:01:03
      124000 -- [-1641.463] (-1638.390) (-1644.267) (-1639.959) * (-1638.994) (-1643.525) [-1638.862] (-1639.487) -- 0:01:03
      124500 -- (-1643.912) (-1644.726) [-1641.580] (-1639.962) * (-1642.764) (-1642.194) [-1640.240] (-1639.442) -- 0:01:03
      125000 -- (-1645.401) (-1647.585) (-1642.701) [-1639.473] * (-1643.891) [-1640.994] (-1639.204) (-1638.974) -- 0:01:03

      Average standard deviation of split frequencies: 0.017131

      125500 -- (-1645.532) [-1640.512] (-1640.478) (-1643.511) * (-1644.918) [-1641.695] (-1640.606) (-1638.372) -- 0:01:02
      126000 -- (-1641.508) (-1638.735) (-1639.527) [-1641.960] * (-1642.733) (-1642.656) (-1642.434) [-1641.016] -- 0:01:02
      126500 -- (-1643.093) [-1641.235] (-1641.925) (-1639.886) * [-1641.599] (-1639.854) (-1643.299) (-1640.198) -- 0:01:02
      127000 -- (-1643.338) [-1643.571] (-1643.497) (-1641.284) * [-1645.103] (-1640.637) (-1641.652) (-1641.742) -- 0:01:01
      127500 -- [-1640.811] (-1640.556) (-1640.206) (-1644.585) * (-1644.715) (-1640.447) (-1641.198) [-1640.882] -- 0:01:01
      128000 -- (-1642.756) (-1645.040) [-1641.500] (-1638.739) * (-1641.848) (-1639.212) (-1640.573) [-1638.157] -- 0:01:01
      128500 -- (-1641.634) (-1643.928) (-1639.866) [-1639.454] * (-1642.645) [-1639.212] (-1643.425) (-1644.357) -- 0:01:01
      129000 -- (-1638.087) (-1639.656) [-1640.037] (-1639.905) * [-1641.796] (-1639.734) (-1641.853) (-1643.395) -- 0:01:00
      129500 -- (-1642.038) (-1640.125) (-1640.437) [-1638.628] * (-1641.999) (-1638.518) (-1643.228) [-1639.576] -- 0:01:00
      130000 -- [-1638.282] (-1640.161) (-1640.482) (-1643.617) * (-1642.199) (-1638.392) (-1643.123) [-1640.403] -- 0:01:06

      Average standard deviation of split frequencies: 0.015380

      130500 -- [-1639.217] (-1640.294) (-1642.842) (-1638.984) * (-1640.238) (-1639.343) [-1641.282] (-1639.656) -- 0:01:06
      131000 -- [-1638.236] (-1642.572) (-1642.445) (-1640.885) * (-1641.036) [-1638.626] (-1639.183) (-1647.528) -- 0:01:06
      131500 -- [-1638.928] (-1640.758) (-1640.311) (-1638.387) * (-1644.036) (-1638.228) (-1640.070) [-1639.411] -- 0:01:06
      132000 -- (-1638.702) (-1643.225) (-1640.347) [-1639.076] * (-1640.308) [-1638.661] (-1640.211) (-1639.388) -- 0:01:05
      132500 -- (-1638.719) [-1638.869] (-1641.613) (-1639.233) * [-1640.970] (-1638.322) (-1638.291) (-1639.406) -- 0:01:05
      133000 -- (-1638.158) [-1639.287] (-1641.387) (-1638.166) * [-1638.573] (-1638.318) (-1638.749) (-1641.277) -- 0:01:05
      133500 -- (-1638.175) [-1639.364] (-1643.723) (-1638.058) * (-1640.667) [-1643.874] (-1642.006) (-1640.360) -- 0:01:04
      134000 -- [-1639.335] (-1640.253) (-1641.584) (-1638.333) * (-1639.138) (-1643.341) (-1640.101) [-1638.243] -- 0:01:04
      134500 -- (-1638.411) [-1640.612] (-1641.762) (-1638.170) * (-1639.695) [-1639.855] (-1640.614) (-1638.243) -- 0:01:04
      135000 -- (-1639.113) (-1639.648) (-1641.700) [-1640.225] * [-1638.675] (-1647.189) (-1639.939) (-1638.654) -- 0:01:04

      Average standard deviation of split frequencies: 0.013865

      135500 -- (-1639.063) [-1644.036] (-1640.024) (-1640.246) * [-1638.673] (-1640.907) (-1639.394) (-1638.611) -- 0:01:03
      136000 -- (-1638.671) (-1641.013) [-1638.878] (-1641.520) * [-1638.616] (-1642.341) (-1642.785) (-1643.630) -- 0:01:03
      136500 -- (-1639.031) (-1641.856) [-1639.689] (-1641.648) * [-1638.847] (-1639.766) (-1640.669) (-1644.694) -- 0:01:03
      137000 -- (-1639.045) (-1641.995) [-1639.968] (-1643.326) * (-1639.633) (-1639.381) (-1639.929) [-1641.418] -- 0:01:02
      137500 -- (-1642.606) [-1643.763] (-1640.818) (-1642.247) * (-1639.863) (-1640.357) [-1640.541] (-1639.256) -- 0:01:02
      138000 -- (-1639.122) (-1643.354) [-1639.824] (-1643.559) * [-1641.923] (-1639.326) (-1639.307) (-1639.256) -- 0:01:02
      138500 -- (-1642.920) (-1643.620) (-1638.914) [-1640.016] * (-1638.588) [-1638.995] (-1638.815) (-1638.304) -- 0:01:02
      139000 -- (-1643.034) (-1640.644) [-1639.119] (-1640.616) * [-1638.588] (-1638.994) (-1639.361) (-1638.700) -- 0:01:01
      139500 -- (-1646.369) (-1640.679) [-1639.108] (-1643.847) * (-1639.347) (-1639.692) (-1638.493) [-1640.754] -- 0:01:01
      140000 -- (-1642.301) (-1640.307) [-1640.570] (-1644.722) * [-1639.777] (-1638.955) (-1642.276) (-1639.192) -- 0:01:01

      Average standard deviation of split frequencies: 0.013219

      140500 -- (-1640.684) (-1641.378) [-1638.864] (-1646.336) * (-1640.680) (-1638.807) [-1641.674] (-1639.849) -- 0:01:01
      141000 -- [-1640.632] (-1638.757) (-1638.711) (-1642.947) * (-1639.085) [-1638.483] (-1642.839) (-1643.903) -- 0:01:00
      141500 -- (-1641.599) (-1639.550) [-1638.860] (-1641.799) * (-1639.090) (-1639.997) (-1639.808) [-1639.179] -- 0:01:00
      142000 -- (-1642.096) (-1638.879) [-1638.891] (-1640.023) * (-1639.137) (-1638.894) (-1640.885) [-1638.946] -- 0:01:00
      142500 -- (-1641.571) (-1638.562) [-1641.767] (-1639.908) * [-1640.998] (-1640.386) (-1643.762) (-1639.213) -- 0:01:00
      143000 -- (-1639.883) (-1639.644) [-1638.398] (-1639.847) * (-1639.681) (-1639.210) (-1641.901) [-1639.237] -- 0:00:59
      143500 -- (-1640.033) (-1639.445) [-1638.863] (-1639.847) * (-1638.563) (-1641.196) (-1640.077) [-1639.430] -- 0:00:59
      144000 -- [-1641.818] (-1639.821) (-1639.634) (-1639.594) * (-1638.869) [-1639.565] (-1639.357) (-1641.662) -- 0:01:05
      144500 -- [-1641.099] (-1638.196) (-1639.522) (-1639.464) * (-1639.929) [-1638.225] (-1639.357) (-1639.302) -- 0:01:05
      145000 -- (-1639.926) (-1640.605) [-1639.734] (-1641.165) * (-1640.436) (-1643.319) [-1640.705] (-1640.101) -- 0:01:04

      Average standard deviation of split frequencies: 0.013765

      145500 -- [-1641.019] (-1639.668) (-1639.589) (-1641.030) * [-1640.013] (-1643.183) (-1643.016) (-1639.328) -- 0:01:04
      146000 -- (-1642.872) (-1639.539) (-1640.633) [-1640.048] * (-1639.417) (-1639.679) (-1641.530) [-1638.835] -- 0:01:04
      146500 -- [-1644.371] (-1640.317) (-1641.590) (-1638.354) * [-1639.571] (-1638.449) (-1641.503) (-1639.407) -- 0:01:04
      147000 -- (-1639.130) (-1642.176) (-1640.989) [-1638.681] * (-1640.911) [-1638.541] (-1642.320) (-1639.407) -- 0:01:03
      147500 -- (-1640.705) (-1639.969) (-1640.504) [-1639.278] * (-1640.408) (-1638.351) [-1640.982] (-1639.496) -- 0:01:03
      148000 -- (-1648.261) (-1642.178) [-1640.068] (-1639.573) * (-1641.033) [-1639.025] (-1639.959) (-1640.436) -- 0:01:03
      148500 -- [-1640.794] (-1641.611) (-1640.312) (-1639.242) * [-1641.979] (-1641.343) (-1642.618) (-1639.276) -- 0:01:03
      149000 -- [-1640.212] (-1641.468) (-1640.808) (-1640.699) * (-1640.746) (-1641.615) [-1640.086] (-1641.296) -- 0:01:02
      149500 -- [-1639.783] (-1640.975) (-1640.380) (-1640.755) * (-1639.632) (-1643.888) [-1641.617] (-1642.788) -- 0:01:02
      150000 -- (-1640.930) (-1641.052) (-1641.223) [-1638.853] * (-1640.145) [-1641.299] (-1640.756) (-1641.753) -- 0:01:02

      Average standard deviation of split frequencies: 0.011646

      150500 -- (-1640.605) (-1640.938) (-1643.693) [-1638.609] * (-1643.883) [-1638.954] (-1642.979) (-1641.753) -- 0:01:02
      151000 -- [-1640.835] (-1639.601) (-1644.671) (-1639.015) * (-1644.586) [-1638.654] (-1641.801) (-1640.446) -- 0:01:01
      151500 -- (-1640.470) (-1639.256) (-1641.056) [-1638.565] * [-1639.073] (-1639.265) (-1644.393) (-1638.509) -- 0:01:01
      152000 -- (-1647.302) [-1639.433] (-1639.368) (-1638.613) * (-1640.735) (-1639.349) (-1643.895) [-1639.088] -- 0:01:01
      152500 -- (-1641.074) (-1639.678) [-1639.427] (-1639.698) * [-1640.641] (-1639.161) (-1641.511) (-1639.630) -- 0:01:01
      153000 -- (-1640.647) [-1639.013] (-1639.250) (-1640.034) * (-1644.342) (-1638.533) (-1640.527) [-1638.695] -- 0:01:00
      153500 -- (-1639.833) [-1638.917] (-1639.250) (-1638.582) * (-1640.957) (-1638.575) [-1643.655] (-1639.528) -- 0:01:00
      154000 -- (-1640.675) (-1642.133) (-1646.249) [-1638.450] * (-1639.552) [-1638.501] (-1642.006) (-1643.171) -- 0:01:00
      154500 -- (-1640.297) (-1640.447) [-1642.937] (-1639.782) * (-1643.156) (-1638.451) [-1639.887] (-1643.424) -- 0:01:00
      155000 -- (-1639.312) (-1643.831) (-1638.949) [-1638.773] * (-1648.604) [-1639.067] (-1641.651) (-1638.859) -- 0:00:59

      Average standard deviation of split frequencies: 0.012246

      155500 -- (-1640.594) (-1645.371) (-1639.905) [-1639.292] * (-1644.530) (-1640.846) [-1642.481] (-1640.462) -- 0:00:59
      156000 -- (-1640.268) (-1643.750) [-1639.312] (-1639.291) * [-1641.034] (-1638.963) (-1639.843) (-1638.490) -- 0:00:59
      156500 -- (-1643.556) [-1641.698] (-1638.630) (-1641.813) * (-1642.622) [-1642.278] (-1638.973) (-1638.346) -- 0:00:59
      157000 -- (-1640.056) (-1639.083) (-1638.774) [-1638.747] * (-1640.537) (-1640.166) (-1641.433) [-1641.958] -- 0:01:04
      157500 -- (-1640.267) (-1638.703) [-1639.855] (-1640.790) * (-1644.102) (-1641.929) (-1640.288) [-1641.386] -- 0:01:04
      158000 -- (-1647.968) (-1643.687) (-1639.799) [-1639.254] * (-1641.606) (-1641.530) (-1639.186) [-1639.390] -- 0:01:03
      158500 -- (-1644.263) (-1640.276) [-1640.746] (-1640.085) * (-1640.361) (-1642.203) (-1643.771) [-1639.479] -- 0:01:03
      159000 -- (-1639.981) (-1639.648) [-1639.294] (-1638.824) * [-1640.075] (-1641.479) (-1641.799) (-1640.094) -- 0:01:03
      159500 -- (-1640.044) (-1642.140) (-1639.829) [-1639.023] * (-1640.162) (-1641.043) [-1639.014] (-1641.418) -- 0:01:03
      160000 -- [-1640.446] (-1639.451) (-1641.349) (-1639.021) * (-1640.256) (-1641.286) [-1638.639] (-1639.700) -- 0:01:02

      Average standard deviation of split frequencies: 0.012817

      160500 -- [-1639.030] (-1639.124) (-1638.862) (-1638.921) * (-1639.605) (-1641.485) (-1638.870) [-1639.951] -- 0:01:02
      161000 -- (-1638.263) (-1646.582) (-1644.427) [-1639.693] * (-1642.631) (-1641.475) [-1638.868] (-1640.896) -- 0:01:02
      161500 -- (-1638.280) [-1641.350] (-1643.193) (-1638.546) * [-1640.698] (-1640.703) (-1638.577) (-1639.737) -- 0:01:02
      162000 -- (-1638.359) [-1642.551] (-1641.943) (-1638.841) * (-1640.523) [-1639.562] (-1641.594) (-1639.170) -- 0:01:02
      162500 -- (-1638.998) [-1640.329] (-1643.062) (-1639.291) * (-1640.861) (-1639.468) (-1640.743) [-1640.573] -- 0:01:01
      163000 -- (-1640.028) (-1640.574) [-1642.523] (-1639.031) * [-1641.376] (-1639.368) (-1639.428) (-1640.837) -- 0:01:01
      163500 -- (-1639.003) (-1640.680) (-1641.174) [-1639.322] * [-1639.401] (-1638.938) (-1640.660) (-1639.149) -- 0:01:01
      164000 -- (-1640.782) (-1642.587) [-1640.785] (-1639.222) * (-1639.321) (-1639.164) [-1639.895] (-1640.345) -- 0:01:01
      164500 -- [-1639.940] (-1641.783) (-1641.130) (-1640.818) * (-1639.837) (-1639.409) (-1639.731) [-1638.579] -- 0:01:00
      165000 -- (-1638.780) [-1641.603] (-1641.977) (-1640.572) * (-1639.977) [-1638.368] (-1638.849) (-1639.614) -- 0:01:00

      Average standard deviation of split frequencies: 0.012555

      165500 -- (-1638.757) [-1640.446] (-1641.276) (-1641.947) * (-1639.823) (-1641.185) [-1638.433] (-1640.358) -- 0:01:00
      166000 -- [-1638.700] (-1641.700) (-1646.452) (-1643.258) * (-1640.063) (-1639.181) [-1638.578] (-1639.692) -- 0:01:00
      166500 -- (-1640.035) (-1638.896) [-1642.312] (-1643.692) * (-1639.187) (-1639.117) (-1639.517) [-1640.055] -- 0:01:00
      167000 -- (-1640.765) (-1638.896) [-1639.126] (-1639.410) * (-1643.198) (-1638.928) [-1640.395] (-1638.801) -- 0:00:59
      167500 -- (-1642.854) [-1638.957] (-1639.140) (-1640.211) * (-1641.007) (-1640.016) (-1640.329) [-1638.933] -- 0:00:59
      168000 -- [-1639.055] (-1640.643) (-1639.073) (-1639.718) * (-1639.589) [-1638.862] (-1640.228) (-1640.982) -- 0:00:59
      168500 -- [-1639.015] (-1640.581) (-1640.164) (-1639.481) * (-1641.228) [-1640.896] (-1638.934) (-1640.351) -- 0:00:59
      169000 -- (-1639.490) [-1638.899] (-1639.794) (-1641.765) * (-1644.936) (-1640.655) [-1640.725] (-1640.666) -- 0:00:59
      169500 -- (-1639.961) (-1640.110) [-1638.721] (-1643.032) * (-1645.026) (-1640.187) (-1639.767) [-1640.031] -- 0:00:58
      170000 -- (-1639.944) (-1639.343) (-1638.659) [-1641.011] * (-1641.142) (-1640.609) [-1640.117] (-1642.116) -- 0:00:58

      Average standard deviation of split frequencies: 0.014501

      170500 -- (-1640.374) (-1639.234) (-1638.575) [-1640.661] * (-1640.403) [-1639.720] (-1640.257) (-1643.286) -- 0:01:03
      171000 -- [-1638.826] (-1638.778) (-1639.021) (-1641.445) * (-1638.820) (-1642.497) [-1639.903] (-1642.699) -- 0:01:03
      171500 -- (-1641.989) [-1638.507] (-1642.421) (-1640.790) * (-1638.732) (-1639.048) (-1642.198) [-1638.943] -- 0:01:02
      172000 -- (-1639.590) (-1638.571) (-1640.466) [-1640.638] * (-1638.516) (-1639.766) [-1641.735] (-1641.553) -- 0:01:02
      172500 -- [-1639.561] (-1639.893) (-1640.739) (-1638.471) * (-1638.610) (-1640.142) [-1642.902] (-1642.410) -- 0:01:02
      173000 -- (-1640.583) (-1638.652) (-1640.648) [-1640.789] * (-1638.685) (-1639.890) [-1640.733] (-1646.693) -- 0:01:02
      173500 -- [-1640.975] (-1638.546) (-1640.707) (-1640.845) * [-1638.880] (-1639.261) (-1640.318) (-1639.604) -- 0:01:01
      174000 -- [-1640.916] (-1639.075) (-1640.643) (-1640.393) * (-1640.337) (-1638.376) (-1641.827) [-1639.494] -- 0:01:01
      174500 -- (-1638.085) [-1639.890] (-1640.846) (-1638.835) * [-1639.446] (-1640.780) (-1638.722) (-1642.703) -- 0:01:01
      175000 -- (-1639.539) (-1642.685) (-1640.327) [-1638.558] * (-1639.747) (-1640.133) [-1640.142] (-1642.633) -- 0:01:01

      Average standard deviation of split frequencies: 0.014999

      175500 -- (-1640.723) (-1639.530) [-1638.477] (-1640.993) * (-1642.594) (-1640.249) (-1641.450) [-1640.897] -- 0:01:01
      176000 -- [-1638.699] (-1641.261) (-1638.424) (-1638.067) * (-1642.104) (-1641.296) (-1639.489) [-1643.052] -- 0:01:00
      176500 -- (-1638.792) (-1640.707) (-1639.916) [-1638.664] * (-1640.232) [-1639.577] (-1643.608) (-1643.479) -- 0:01:00
      177000 -- (-1642.023) (-1641.789) (-1641.213) [-1640.794] * (-1641.118) (-1638.890) (-1639.566) [-1639.410] -- 0:01:00
      177500 -- [-1641.451] (-1640.133) (-1639.954) (-1639.341) * (-1640.999) (-1640.774) (-1643.904) [-1640.986] -- 0:01:00
      178000 -- (-1639.158) (-1639.496) [-1640.610] (-1640.077) * (-1640.292) [-1638.306] (-1645.165) (-1641.362) -- 0:01:00
      178500 -- [-1638.720] (-1641.324) (-1639.184) (-1640.989) * (-1639.685) [-1640.259] (-1642.242) (-1640.133) -- 0:00:59
      179000 -- [-1638.346] (-1641.323) (-1639.740) (-1640.062) * (-1638.686) (-1638.519) [-1642.529] (-1640.410) -- 0:00:59
      179500 -- [-1639.512] (-1639.286) (-1638.717) (-1642.677) * (-1638.850) [-1639.050] (-1643.055) (-1641.960) -- 0:00:59
      180000 -- (-1641.680) (-1640.665) (-1639.336) [-1642.036] * (-1638.656) [-1638.328] (-1646.604) (-1639.565) -- 0:00:59

      Average standard deviation of split frequencies: 0.015003

      180500 -- [-1639.973] (-1641.483) (-1640.713) (-1641.358) * (-1640.277) (-1640.890) (-1642.741) [-1640.917] -- 0:00:59
      181000 -- (-1644.807) (-1639.651) (-1640.653) [-1641.226] * [-1638.356] (-1638.458) (-1644.405) (-1643.876) -- 0:00:58
      181500 -- (-1646.254) [-1639.577] (-1639.512) (-1640.014) * (-1638.382) [-1641.406] (-1647.902) (-1644.762) -- 0:00:58
      182000 -- (-1644.715) (-1640.729) [-1639.508] (-1641.626) * [-1639.109] (-1639.521) (-1642.737) (-1645.267) -- 0:00:58
      182500 -- (-1640.553) (-1640.748) (-1638.604) [-1640.776] * [-1639.918] (-1638.174) (-1643.404) (-1643.850) -- 0:00:58
      183000 -- (-1645.769) (-1640.615) [-1639.204] (-1639.785) * (-1641.588) (-1638.147) [-1641.738] (-1640.760) -- 0:00:58
      183500 -- (-1644.779) [-1639.788] (-1639.329) (-1639.561) * (-1640.076) [-1639.879] (-1640.343) (-1640.846) -- 0:00:57
      184000 -- (-1641.362) [-1640.098] (-1641.599) (-1639.849) * [-1641.826] (-1640.620) (-1643.337) (-1639.649) -- 0:01:02
      184500 -- (-1642.134) [-1639.813] (-1640.575) (-1639.336) * (-1638.425) [-1639.125] (-1643.674) (-1642.747) -- 0:01:01
      185000 -- (-1640.841) (-1642.685) (-1640.314) [-1640.455] * (-1638.774) (-1638.229) [-1641.408] (-1640.180) -- 0:01:01

      Average standard deviation of split frequencies: 0.014446

      185500 -- [-1642.137] (-1640.456) (-1639.901) (-1641.063) * (-1639.086) (-1639.945) (-1640.126) [-1641.791] -- 0:01:01
      186000 -- (-1641.627) (-1641.628) [-1640.168] (-1640.603) * (-1638.876) (-1639.460) [-1639.679] (-1642.060) -- 0:01:01
      186500 -- (-1641.215) [-1640.974] (-1639.573) (-1640.262) * [-1639.496] (-1639.655) (-1638.466) (-1640.436) -- 0:01:01
      187000 -- (-1641.870) (-1640.079) [-1641.024] (-1642.075) * (-1640.820) (-1639.725) [-1638.603] (-1640.296) -- 0:01:00
      187500 -- (-1643.149) (-1639.639) (-1640.913) [-1640.305] * (-1641.659) [-1639.832] (-1638.596) (-1640.864) -- 0:01:00
      188000 -- (-1639.550) [-1639.599] (-1639.044) (-1639.146) * (-1642.496) [-1639.708] (-1638.590) (-1642.382) -- 0:01:00
      188500 -- [-1639.579] (-1640.190) (-1638.894) (-1638.314) * (-1642.022) [-1641.704] (-1638.879) (-1647.348) -- 0:01:00
      189000 -- [-1639.642] (-1641.733) (-1638.949) (-1640.106) * (-1639.787) (-1641.728) (-1638.526) [-1641.448] -- 0:01:00
      189500 -- (-1639.533) (-1640.745) [-1638.949] (-1640.651) * (-1645.102) (-1643.428) (-1642.289) [-1641.896] -- 0:00:59
      190000 -- (-1640.678) (-1639.624) (-1640.581) [-1642.656] * (-1642.015) [-1641.256] (-1641.883) (-1638.862) -- 0:00:59

      Average standard deviation of split frequencies: 0.017060

      190500 -- (-1640.856) (-1640.644) [-1639.678] (-1640.800) * (-1643.639) (-1643.903) (-1642.551) [-1638.828] -- 0:00:59
      191000 -- (-1643.433) [-1640.659] (-1640.186) (-1641.617) * (-1640.758) [-1638.073] (-1640.418) (-1638.610) -- 0:00:59
      191500 -- (-1647.151) (-1640.572) (-1641.239) [-1640.741] * (-1640.531) (-1638.132) (-1642.968) [-1639.725] -- 0:00:59
      192000 -- (-1643.735) [-1640.287] (-1641.149) (-1639.827) * (-1640.580) (-1638.770) (-1642.216) [-1639.106] -- 0:00:58
      192500 -- (-1641.934) (-1639.687) (-1642.921) [-1647.345] * (-1642.794) [-1638.521] (-1641.417) (-1639.605) -- 0:00:58
      193000 -- (-1638.823) (-1639.893) (-1642.848) [-1639.547] * [-1641.192] (-1638.961) (-1640.175) (-1638.867) -- 0:00:58
      193500 -- [-1639.511] (-1639.390) (-1639.994) (-1642.783) * [-1641.665] (-1640.278) (-1641.439) (-1638.311) -- 0:00:58
      194000 -- [-1640.907] (-1640.359) (-1639.836) (-1640.009) * [-1641.506] (-1643.992) (-1641.364) (-1639.519) -- 0:00:58
      194500 -- (-1642.308) (-1640.706) [-1639.833] (-1641.860) * (-1640.645) (-1639.663) (-1641.234) [-1639.459] -- 0:00:57
      195000 -- (-1641.799) (-1642.173) [-1646.118] (-1641.381) * (-1640.530) [-1641.365] (-1642.251) (-1641.270) -- 0:00:57

      Average standard deviation of split frequencies: 0.018355

      195500 -- [-1640.241] (-1640.874) (-1645.570) (-1642.832) * (-1640.659) (-1640.204) [-1640.697] (-1642.620) -- 0:00:57
      196000 -- (-1639.824) (-1640.593) [-1643.035] (-1641.195) * (-1639.365) [-1639.359] (-1640.547) (-1639.704) -- 0:00:57
      196500 -- (-1638.882) (-1641.822) [-1642.393] (-1639.776) * [-1639.183] (-1639.884) (-1641.450) (-1638.985) -- 0:00:57
      197000 -- [-1641.332] (-1641.486) (-1640.079) (-1641.089) * [-1639.033] (-1640.995) (-1638.915) (-1639.925) -- 0:01:01
      197500 -- (-1640.038) (-1648.933) [-1640.079] (-1639.075) * (-1639.096) [-1640.163] (-1639.516) (-1640.197) -- 0:01:00
      198000 -- (-1642.490) (-1639.746) [-1639.414] (-1639.062) * (-1640.283) (-1642.218) [-1639.726] (-1639.786) -- 0:01:00
      198500 -- (-1639.640) (-1642.564) [-1639.782] (-1643.341) * (-1641.956) (-1647.592) (-1639.493) [-1639.158] -- 0:01:00
      199000 -- (-1640.104) (-1641.883) [-1640.576] (-1638.825) * [-1638.888] (-1638.943) (-1639.412) (-1640.708) -- 0:01:00
      199500 -- [-1640.359] (-1639.235) (-1646.893) (-1638.622) * [-1638.622] (-1638.633) (-1641.317) (-1639.211) -- 0:01:00
      200000 -- (-1640.101) (-1641.904) [-1642.273] (-1639.984) * (-1640.690) [-1639.940] (-1646.163) (-1640.805) -- 0:00:59

      Average standard deviation of split frequencies: 0.017804

      200500 -- (-1639.977) (-1640.636) (-1641.744) [-1640.883] * [-1643.281] (-1640.484) (-1642.325) (-1640.623) -- 0:00:59
      201000 -- [-1643.463] (-1637.950) (-1640.325) (-1641.176) * (-1642.046) (-1640.949) (-1645.280) [-1639.863] -- 0:00:59
      201500 -- (-1644.048) (-1640.202) (-1639.995) [-1641.845] * (-1639.437) (-1642.041) [-1640.108] (-1640.157) -- 0:00:59
      202000 -- (-1639.925) [-1638.721] (-1641.617) (-1639.066) * (-1642.287) [-1639.532] (-1640.537) (-1639.291) -- 0:00:59
      202500 -- [-1642.316] (-1639.155) (-1641.749) (-1639.569) * (-1638.744) (-1639.364) (-1640.066) [-1641.166] -- 0:00:59
      203000 -- (-1642.675) (-1641.404) (-1640.737) [-1640.519] * (-1639.182) [-1639.944] (-1639.563) (-1640.403) -- 0:00:58
      203500 -- [-1642.248] (-1640.374) (-1639.753) (-1641.074) * [-1638.973] (-1642.583) (-1639.878) (-1640.846) -- 0:00:58
      204000 -- (-1642.599) (-1641.441) (-1639.541) [-1642.472] * (-1639.690) [-1641.448] (-1640.079) (-1639.334) -- 0:00:58
      204500 -- (-1640.401) (-1638.474) (-1638.283) [-1642.662] * (-1640.953) (-1640.880) [-1640.165] (-1640.904) -- 0:00:58
      205000 -- (-1639.972) (-1640.121) [-1639.267] (-1641.584) * (-1639.480) (-1640.183) [-1639.317] (-1640.233) -- 0:00:58

      Average standard deviation of split frequencies: 0.016621

      205500 -- (-1640.847) [-1639.442] (-1638.716) (-1640.013) * [-1641.511] (-1641.080) (-1638.992) (-1641.114) -- 0:00:57
      206000 -- (-1640.296) (-1638.401) (-1644.910) [-1640.156] * (-1638.858) (-1639.622) [-1640.003] (-1640.860) -- 0:00:57
      206500 -- (-1640.982) [-1638.418] (-1644.099) (-1639.988) * (-1638.619) (-1639.745) (-1639.984) [-1639.313] -- 0:00:57
      207000 -- (-1640.994) [-1638.393] (-1643.027) (-1639.942) * (-1638.626) (-1639.040) (-1640.405) [-1639.209] -- 0:00:57
      207500 -- (-1643.705) (-1638.428) [-1643.373] (-1639.109) * (-1640.129) (-1642.509) (-1639.248) [-1638.911] -- 0:00:57
      208000 -- (-1640.845) (-1638.800) [-1638.629] (-1642.823) * (-1638.802) (-1640.794) (-1641.356) [-1639.030] -- 0:00:57
      208500 -- [-1641.657] (-1639.896) (-1638.497) (-1639.569) * (-1640.603) (-1638.070) (-1643.186) [-1642.693] -- 0:00:56
      209000 -- (-1642.536) [-1638.832] (-1639.836) (-1640.167) * (-1643.017) [-1640.922] (-1641.177) (-1642.612) -- 0:00:56
      209500 -- (-1642.030) (-1640.187) [-1638.321] (-1643.071) * (-1640.291) (-1640.421) (-1642.729) [-1639.669] -- 0:00:56
      210000 -- [-1638.563] (-1639.202) (-1638.718) (-1641.217) * (-1640.759) (-1641.706) (-1640.245) [-1639.643] -- 0:00:56

      Average standard deviation of split frequencies: 0.015310

      210500 -- (-1638.546) (-1641.119) (-1639.027) [-1638.482] * [-1640.133] (-1644.203) (-1640.538) (-1640.799) -- 0:01:00
      211000 -- (-1638.394) (-1644.390) (-1640.666) [-1641.258] * [-1638.738] (-1640.615) (-1641.867) (-1644.994) -- 0:00:59
      211500 -- (-1638.239) (-1645.460) [-1639.685] (-1642.503) * [-1640.006] (-1640.985) (-1639.090) (-1642.226) -- 0:00:59
      212000 -- [-1642.478] (-1641.162) (-1640.147) (-1638.374) * (-1638.188) (-1640.467) [-1639.481] (-1639.887) -- 0:00:59
      212500 -- (-1639.970) [-1641.283] (-1639.645) (-1638.376) * (-1640.202) [-1640.136] (-1640.983) (-1639.647) -- 0:00:59
      213000 -- [-1640.151] (-1642.796) (-1639.437) (-1639.533) * [-1639.125] (-1641.339) (-1639.081) (-1639.062) -- 0:00:59
      213500 -- (-1642.515) (-1641.599) (-1639.655) [-1639.596] * (-1640.397) (-1639.407) [-1639.808] (-1639.869) -- 0:00:58
      214000 -- (-1639.190) [-1638.912] (-1638.835) (-1640.310) * [-1641.388] (-1639.010) (-1641.596) (-1641.056) -- 0:00:58
      214500 -- (-1640.370) [-1639.019] (-1639.049) (-1640.508) * (-1641.979) (-1638.686) [-1640.684] (-1638.202) -- 0:00:58
      215000 -- (-1641.736) (-1638.920) [-1642.004] (-1640.099) * [-1642.381] (-1638.491) (-1642.181) (-1644.868) -- 0:00:58

      Average standard deviation of split frequencies: 0.014473

      215500 -- (-1640.192) [-1638.711] (-1640.807) (-1640.621) * (-1642.220) (-1639.050) [-1639.676] (-1639.688) -- 0:00:58
      216000 -- (-1640.524) (-1639.939) [-1641.091] (-1640.497) * (-1639.395) (-1641.009) [-1639.651] (-1638.054) -- 0:00:58
      216500 -- (-1640.007) [-1641.006] (-1641.034) (-1642.104) * (-1639.296) (-1638.538) [-1639.219] (-1643.625) -- 0:00:57
      217000 -- [-1640.190] (-1639.422) (-1639.514) (-1642.661) * (-1643.619) [-1639.026] (-1639.255) (-1640.118) -- 0:00:57
      217500 -- (-1638.634) (-1641.074) (-1641.576) [-1639.835] * (-1644.364) (-1640.259) [-1642.498] (-1640.128) -- 0:00:57
      218000 -- (-1638.222) [-1639.328] (-1643.256) (-1640.200) * (-1640.200) (-1639.812) [-1639.342] (-1640.832) -- 0:00:57
      218500 -- [-1638.518] (-1639.317) (-1643.395) (-1638.824) * (-1640.293) (-1640.708) (-1642.540) [-1639.073] -- 0:00:57
      219000 -- [-1639.287] (-1640.594) (-1643.853) (-1638.888) * (-1641.142) [-1639.725] (-1640.636) (-1640.640) -- 0:00:57
      219500 -- (-1642.950) (-1642.152) (-1640.658) [-1639.031] * (-1640.342) [-1640.003] (-1640.637) (-1638.771) -- 0:00:56
      220000 -- [-1640.145] (-1645.333) (-1640.541) (-1639.732) * [-1639.341] (-1639.308) (-1638.925) (-1641.360) -- 0:00:56

      Average standard deviation of split frequencies: 0.012480

      220500 -- (-1645.847) (-1640.234) [-1640.583] (-1641.011) * [-1646.331] (-1639.847) (-1638.765) (-1638.253) -- 0:00:56
      221000 -- (-1642.406) (-1638.451) [-1641.789] (-1639.195) * (-1640.916) (-1640.084) (-1638.726) [-1639.063] -- 0:00:56
      221500 -- (-1646.858) [-1640.374] (-1638.358) (-1639.577) * [-1639.626] (-1642.425) (-1640.534) (-1646.648) -- 0:00:56
      222000 -- (-1641.516) (-1642.397) (-1640.863) [-1640.514] * (-1641.157) (-1638.242) [-1639.586] (-1640.931) -- 0:00:56
      222500 -- (-1640.697) [-1638.752] (-1638.744) (-1641.900) * [-1638.495] (-1638.452) (-1640.348) (-1645.837) -- 0:00:55
      223000 -- [-1639.041] (-1638.577) (-1639.197) (-1639.922) * [-1639.227] (-1642.957) (-1641.114) (-1643.788) -- 0:00:55
      223500 -- (-1641.476) (-1639.682) (-1639.107) [-1638.751] * (-1639.344) [-1638.750] (-1642.800) (-1642.716) -- 0:00:55
      224000 -- (-1638.592) [-1642.683] (-1640.478) (-1639.787) * [-1641.945] (-1639.288) (-1639.884) (-1644.504) -- 0:00:58
      224500 -- [-1638.592] (-1640.662) (-1639.340) (-1641.503) * (-1643.383) (-1641.130) [-1640.413] (-1641.788) -- 0:00:58
      225000 -- (-1644.985) [-1641.584] (-1643.228) (-1639.918) * (-1642.904) [-1639.414] (-1639.933) (-1642.524) -- 0:00:58

      Average standard deviation of split frequencies: 0.013503

      225500 -- [-1644.087] (-1642.825) (-1640.640) (-1641.351) * (-1643.666) [-1641.654] (-1640.277) (-1642.773) -- 0:00:58
      226000 -- (-1640.774) [-1639.626] (-1641.770) (-1640.259) * (-1643.787) (-1639.303) [-1640.358] (-1638.921) -- 0:00:58
      226500 -- (-1638.611) [-1640.454] (-1641.421) (-1642.923) * (-1643.854) (-1641.589) (-1641.509) [-1638.184] -- 0:00:58
      227000 -- (-1639.093) (-1639.958) (-1640.667) [-1640.057] * [-1638.803] (-1639.165) (-1643.401) (-1639.428) -- 0:00:57
      227500 -- (-1639.042) (-1643.782) [-1642.844] (-1640.763) * [-1639.891] (-1639.699) (-1641.781) (-1639.379) -- 0:00:57
      228000 -- (-1639.008) [-1639.956] (-1644.643) (-1639.979) * (-1639.179) [-1641.737] (-1639.247) (-1639.427) -- 0:00:57
      228500 -- (-1642.442) (-1643.751) (-1641.574) [-1644.287] * [-1640.567] (-1639.075) (-1639.420) (-1639.551) -- 0:00:57
      229000 -- (-1644.991) (-1644.338) [-1639.161] (-1640.919) * (-1641.770) (-1641.177) [-1640.830] (-1640.947) -- 0:00:57
      229500 -- (-1646.162) [-1645.945] (-1638.662) (-1640.783) * (-1639.926) (-1639.488) [-1641.544] (-1644.987) -- 0:00:57
      230000 -- (-1641.632) (-1642.305) (-1639.852) [-1638.223] * (-1639.543) [-1639.248] (-1638.556) (-1645.230) -- 0:00:56

      Average standard deviation of split frequencies: 0.012671

      230500 -- (-1640.217) (-1640.084) (-1640.994) [-1639.364] * (-1639.939) (-1639.765) (-1638.345) [-1641.565] -- 0:00:56
      231000 -- (-1640.271) (-1639.646) [-1641.157] (-1639.633) * (-1642.165) (-1639.688) (-1638.600) [-1639.267] -- 0:00:56
      231500 -- (-1639.172) [-1639.112] (-1643.295) (-1639.530) * (-1644.068) (-1638.439) (-1639.716) [-1642.887] -- 0:00:56
      232000 -- (-1639.783) [-1639.696] (-1642.979) (-1639.030) * (-1641.271) [-1640.865] (-1638.976) (-1647.493) -- 0:00:56
      232500 -- (-1640.978) (-1639.274) [-1643.894] (-1643.202) * (-1640.685) [-1642.502] (-1639.094) (-1642.912) -- 0:00:56
      233000 -- [-1639.166] (-1642.011) (-1640.848) (-1640.097) * (-1639.358) (-1640.554) [-1638.081] (-1642.136) -- 0:00:55
      233500 -- (-1641.545) (-1639.859) (-1642.319) [-1639.565] * (-1639.527) (-1640.918) [-1638.561] (-1642.175) -- 0:00:55
      234000 -- (-1641.013) [-1641.741] (-1641.297) (-1639.448) * (-1639.291) (-1640.100) [-1638.746] (-1640.071) -- 0:00:55
      234500 -- (-1642.943) (-1642.445) [-1640.170] (-1638.818) * (-1640.132) (-1643.074) (-1639.433) [-1639.719] -- 0:00:55
      235000 -- (-1642.650) [-1638.789] (-1639.482) (-1638.696) * (-1642.955) (-1640.334) [-1641.500] (-1638.929) -- 0:00:55

      Average standard deviation of split frequencies: 0.012185

      235500 -- (-1642.404) (-1639.838) [-1642.470] (-1639.939) * [-1639.379] (-1641.470) (-1641.404) (-1640.862) -- 0:00:55
      236000 -- (-1643.809) [-1641.022] (-1640.560) (-1639.550) * [-1638.615] (-1644.515) (-1639.194) (-1642.003) -- 0:00:55
      236500 -- (-1638.985) [-1638.639] (-1644.093) (-1639.265) * (-1638.926) (-1640.747) [-1641.040] (-1644.435) -- 0:00:54
      237000 -- (-1640.562) (-1641.002) (-1644.416) [-1639.201] * (-1646.944) (-1642.561) [-1640.398] (-1640.502) -- 0:00:54
      237500 -- (-1640.248) (-1639.679) [-1640.516] (-1642.000) * (-1645.039) (-1638.949) (-1640.591) [-1641.545] -- 0:00:57
      238000 -- (-1641.553) (-1640.247) [-1643.687] (-1638.523) * (-1640.741) [-1638.822] (-1641.790) (-1641.416) -- 0:00:57
      238500 -- (-1639.381) (-1642.248) (-1641.374) [-1639.126] * [-1644.059] (-1641.588) (-1640.277) (-1640.537) -- 0:00:57
      239000 -- [-1639.537] (-1639.776) (-1640.702) (-1642.071) * (-1640.789) (-1641.334) [-1640.428] (-1641.391) -- 0:00:57
      239500 -- [-1638.289] (-1638.135) (-1638.947) (-1642.480) * [-1639.386] (-1642.313) (-1641.104) (-1642.559) -- 0:00:57
      240000 -- (-1638.046) [-1639.211] (-1638.540) (-1644.490) * [-1638.018] (-1641.193) (-1638.583) (-1644.613) -- 0:00:56

      Average standard deviation of split frequencies: 0.011752

      240500 -- (-1639.579) [-1640.491] (-1640.154) (-1644.152) * (-1641.695) (-1638.483) [-1642.603] (-1639.598) -- 0:00:56
      241000 -- (-1638.681) (-1642.123) (-1640.962) [-1640.481] * (-1639.596) (-1638.336) (-1647.970) [-1639.099] -- 0:00:56
      241500 -- [-1640.041] (-1641.967) (-1639.206) (-1640.234) * (-1640.559) (-1642.126) [-1641.149] (-1639.853) -- 0:00:56
      242000 -- [-1640.156] (-1642.926) (-1640.818) (-1641.174) * (-1639.161) [-1640.100] (-1641.933) (-1640.214) -- 0:00:56
      242500 -- (-1644.056) (-1640.229) [-1639.320] (-1644.173) * (-1641.399) (-1638.998) [-1645.436] (-1639.594) -- 0:00:56
      243000 -- [-1642.178] (-1639.937) (-1643.149) (-1640.816) * (-1641.399) [-1639.819] (-1643.858) (-1639.499) -- 0:00:56
      243500 -- (-1641.034) (-1640.187) [-1640.205] (-1642.184) * (-1641.001) [-1641.420] (-1640.987) (-1639.866) -- 0:00:55
      244000 -- (-1639.275) [-1644.349] (-1638.727) (-1640.155) * [-1640.445] (-1641.339) (-1642.113) (-1640.790) -- 0:00:55
      244500 -- (-1639.176) (-1644.356) [-1640.883] (-1641.073) * (-1639.555) [-1639.266] (-1639.517) (-1640.706) -- 0:00:55
      245000 -- (-1638.939) [-1640.016] (-1639.624) (-1639.139) * (-1642.308) (-1640.511) [-1640.485] (-1640.975) -- 0:00:55

      Average standard deviation of split frequencies: 0.012456

      245500 -- [-1638.725] (-1641.833) (-1639.789) (-1639.685) * (-1642.476) (-1640.112) (-1640.409) [-1641.326] -- 0:00:55
      246000 -- (-1639.253) [-1642.520] (-1639.911) (-1640.679) * (-1641.883) [-1639.510] (-1639.666) (-1640.385) -- 0:00:55
      246500 -- (-1638.611) (-1644.968) (-1639.557) [-1640.309] * (-1639.199) [-1639.185] (-1641.132) (-1642.136) -- 0:00:55
      247000 -- (-1638.692) (-1646.948) [-1640.869] (-1642.924) * [-1638.285] (-1639.959) (-1645.017) (-1640.309) -- 0:00:54
      247500 -- (-1639.462) (-1639.789) [-1640.630] (-1641.446) * (-1639.601) [-1639.766] (-1640.955) (-1638.735) -- 0:00:54
      248000 -- (-1638.395) (-1639.744) (-1640.864) [-1641.264] * [-1643.095] (-1643.292) (-1639.998) (-1638.532) -- 0:00:54
      248500 -- (-1639.598) (-1640.359) [-1638.059] (-1639.039) * (-1642.534) (-1643.588) [-1640.372] (-1638.576) -- 0:00:54
      249000 -- (-1639.918) (-1641.208) (-1639.369) [-1638.653] * (-1642.792) [-1639.756] (-1639.577) (-1638.565) -- 0:00:54
      249500 -- [-1638.515] (-1639.845) (-1638.009) (-1638.581) * (-1641.234) (-1640.748) [-1638.864] (-1639.001) -- 0:00:54
      250000 -- (-1639.923) [-1638.974] (-1640.102) (-1638.503) * (-1638.805) (-1638.976) (-1639.933) [-1639.334] -- 0:00:54

      Average standard deviation of split frequencies: 0.013560

      250500 -- (-1640.085) [-1639.459] (-1642.335) (-1638.832) * [-1638.533] (-1639.611) (-1640.716) (-1639.197) -- 0:00:53
      251000 -- (-1641.022) [-1639.423] (-1640.508) (-1641.322) * (-1644.673) (-1639.563) (-1639.012) [-1638.510] -- 0:00:56
      251500 -- (-1641.019) (-1643.549) [-1640.565] (-1639.249) * (-1640.952) [-1639.281] (-1639.121) (-1638.599) -- 0:00:56
      252000 -- [-1643.035] (-1638.441) (-1641.029) (-1638.349) * (-1642.748) (-1640.693) (-1638.787) [-1638.300] -- 0:00:56
      252500 -- (-1643.228) (-1638.710) (-1639.037) [-1642.263] * (-1640.243) (-1638.513) [-1640.803] (-1639.418) -- 0:00:56
      253000 -- (-1638.834) (-1640.307) [-1638.548] (-1641.693) * (-1639.682) (-1638.748) [-1639.833] (-1640.001) -- 0:00:56
      253500 -- (-1638.799) (-1644.293) [-1638.286] (-1640.920) * (-1639.279) (-1638.927) (-1639.901) [-1639.977] -- 0:00:55
      254000 -- (-1638.750) (-1642.263) (-1639.510) [-1641.012] * (-1640.045) (-1638.835) (-1641.452) [-1640.335] -- 0:00:55
      254500 -- (-1639.433) (-1644.618) (-1641.067) [-1640.223] * (-1640.039) [-1638.536] (-1638.250) (-1643.703) -- 0:00:55
      255000 -- [-1640.414] (-1639.600) (-1639.669) (-1638.877) * (-1638.564) (-1639.121) (-1638.292) [-1641.931] -- 0:00:55

      Average standard deviation of split frequencies: 0.014538

      255500 -- (-1639.531) (-1641.228) (-1642.791) [-1640.168] * [-1638.313] (-1639.942) (-1638.381) (-1641.612) -- 0:00:55
      256000 -- (-1640.095) [-1639.681] (-1643.310) (-1642.133) * (-1639.780) (-1640.033) [-1641.381] (-1639.305) -- 0:00:55
      256500 -- [-1638.757] (-1639.585) (-1639.592) (-1640.952) * (-1643.039) (-1639.075) [-1638.376] (-1639.766) -- 0:00:55
      257000 -- [-1638.844] (-1642.501) (-1638.764) (-1639.865) * [-1640.168] (-1642.605) (-1638.828) (-1639.726) -- 0:00:54
      257500 -- [-1640.260] (-1640.013) (-1639.817) (-1639.169) * (-1639.986) (-1639.217) (-1639.573) [-1638.731] -- 0:00:54
      258000 -- (-1644.099) (-1640.013) (-1640.100) [-1637.917] * [-1638.740] (-1638.421) (-1639.062) (-1638.459) -- 0:00:54
      258500 -- [-1639.234] (-1643.288) (-1640.147) (-1637.935) * (-1637.982) (-1638.764) (-1640.010) [-1638.348] -- 0:00:54
      259000 -- (-1644.774) (-1641.161) (-1640.032) [-1638.130] * (-1637.982) (-1641.260) (-1643.362) [-1638.864] -- 0:00:54
      259500 -- (-1639.510) (-1639.032) [-1640.430] (-1638.132) * [-1638.038] (-1640.405) (-1640.700) (-1639.587) -- 0:00:54
      260000 -- (-1641.167) (-1640.218) [-1641.227] (-1640.414) * (-1641.516) [-1641.261] (-1641.463) (-1639.476) -- 0:00:54

      Average standard deviation of split frequencies: 0.013706

      260500 -- (-1641.561) (-1640.099) (-1638.657) [-1639.379] * (-1641.248) (-1638.515) (-1640.777) [-1642.022] -- 0:00:53
      261000 -- (-1643.421) [-1641.319] (-1640.864) (-1641.034) * (-1640.166) [-1640.803] (-1639.332) (-1642.373) -- 0:00:53
      261500 -- (-1640.372) (-1641.995) [-1638.567] (-1642.527) * (-1641.076) (-1640.305) (-1639.706) [-1640.100] -- 0:00:53
      262000 -- (-1640.070) [-1640.989] (-1638.510) (-1642.527) * (-1638.535) (-1641.869) (-1638.322) [-1639.852] -- 0:00:53
      262500 -- (-1643.417) (-1641.690) (-1639.634) [-1638.774] * (-1640.533) [-1641.576] (-1638.656) (-1639.559) -- 0:00:53
      263000 -- (-1639.095) [-1641.403] (-1651.571) (-1639.929) * [-1639.160] (-1640.599) (-1639.886) (-1639.131) -- 0:00:53
      263500 -- (-1638.182) (-1639.734) (-1647.239) [-1640.655] * (-1641.295) (-1640.842) (-1639.232) [-1639.109] -- 0:00:53
      264000 -- (-1638.166) (-1644.426) (-1641.793) [-1640.925] * [-1639.640] (-1638.206) (-1639.550) (-1639.403) -- 0:00:52
      264500 -- (-1642.633) (-1643.441) [-1640.624] (-1640.216) * (-1639.727) [-1638.213] (-1638.642) (-1639.399) -- 0:00:55
      265000 -- (-1639.107) (-1640.625) (-1640.628) [-1639.846] * [-1638.890] (-1641.912) (-1643.372) (-1641.524) -- 0:00:55

      Average standard deviation of split frequencies: 0.012583

      265500 -- (-1638.243) (-1640.947) [-1645.373] (-1642.092) * (-1640.239) (-1639.231) (-1641.496) [-1643.563] -- 0:00:55
      266000 -- [-1640.650] (-1644.595) (-1640.819) (-1638.856) * (-1640.665) [-1638.756] (-1642.899) (-1643.164) -- 0:00:55
      266500 -- (-1642.821) (-1639.872) (-1639.544) [-1639.695] * (-1639.531) (-1638.613) (-1638.612) [-1644.246] -- 0:00:55
      267000 -- (-1642.559) (-1640.911) (-1639.508) [-1638.887] * [-1643.133] (-1638.631) (-1640.546) (-1642.565) -- 0:00:54
      267500 -- (-1639.996) [-1640.466] (-1640.857) (-1640.473) * (-1643.662) (-1639.263) [-1640.779] (-1638.900) -- 0:00:54
      268000 -- (-1639.535) (-1640.965) [-1639.300] (-1647.862) * (-1640.465) [-1639.279] (-1638.786) (-1643.857) -- 0:00:54
      268500 -- (-1638.500) (-1643.495) (-1640.118) [-1642.258] * [-1639.151] (-1641.916) (-1638.786) (-1641.513) -- 0:00:54
      269000 -- [-1640.911] (-1644.004) (-1640.065) (-1645.210) * (-1645.771) (-1640.673) [-1640.669] (-1641.064) -- 0:00:54
      269500 -- (-1640.996) [-1641.367] (-1640.156) (-1643.649) * (-1641.107) (-1640.798) [-1641.274] (-1640.276) -- 0:00:54
      270000 -- (-1638.298) (-1639.626) (-1639.455) [-1639.603] * (-1642.379) (-1639.727) [-1642.369] (-1639.767) -- 0:00:54

      Average standard deviation of split frequencies: 0.013383

      270500 -- [-1639.246] (-1639.618) (-1640.212) (-1639.356) * (-1641.403) [-1640.644] (-1644.277) (-1640.342) -- 0:00:53
      271000 -- (-1639.337) (-1641.876) [-1641.474] (-1639.454) * (-1641.553) (-1639.608) (-1641.906) [-1640.443] -- 0:00:53
      271500 -- (-1643.669) (-1642.316) [-1642.524] (-1638.586) * (-1643.231) (-1641.214) [-1642.198] (-1643.885) -- 0:00:53
      272000 -- [-1643.567] (-1641.186) (-1641.991) (-1638.854) * [-1641.820] (-1646.581) (-1640.741) (-1639.106) -- 0:00:53
      272500 -- (-1640.770) [-1638.933] (-1640.867) (-1641.830) * (-1641.041) (-1640.851) (-1642.407) [-1638.884] -- 0:00:53
      273000 -- [-1640.958] (-1638.886) (-1639.729) (-1643.023) * (-1639.315) [-1638.618] (-1641.185) (-1638.884) -- 0:00:53
      273500 -- [-1638.735] (-1639.321) (-1644.364) (-1640.351) * (-1640.399) [-1641.775] (-1641.962) (-1640.032) -- 0:00:53
      274000 -- (-1641.519) (-1639.347) [-1638.615] (-1640.533) * [-1640.407] (-1640.869) (-1637.998) (-1638.904) -- 0:00:52
      274500 -- (-1643.902) (-1640.255) (-1640.519) [-1639.367] * (-1639.002) (-1639.588) [-1638.040] (-1640.603) -- 0:00:52
      275000 -- (-1642.957) (-1639.594) (-1640.967) [-1640.182] * (-1642.286) (-1639.501) (-1638.069) [-1639.629] -- 0:00:52

      Average standard deviation of split frequencies: 0.013844

      275500 -- (-1641.056) (-1639.481) (-1640.589) [-1639.786] * (-1643.738) (-1641.683) (-1638.601) [-1641.607] -- 0:00:52
      276000 -- (-1640.714) (-1639.371) (-1640.394) [-1642.277] * [-1640.257] (-1641.497) (-1639.611) (-1639.642) -- 0:00:52
      276500 -- (-1639.233) [-1642.390] (-1640.560) (-1640.608) * (-1640.906) (-1641.961) [-1640.014] (-1640.298) -- 0:00:52
      277000 -- (-1640.372) (-1640.783) [-1639.577] (-1643.285) * [-1640.059] (-1641.624) (-1638.718) (-1640.084) -- 0:00:52
      277500 -- (-1642.032) (-1641.994) [-1638.714] (-1642.803) * (-1640.187) (-1644.312) (-1640.490) [-1639.606] -- 0:00:52
      278000 -- [-1639.285] (-1638.516) (-1640.003) (-1640.573) * (-1640.723) (-1638.323) (-1641.556) [-1638.903] -- 0:00:54
      278500 -- (-1642.483) [-1639.480] (-1639.398) (-1639.305) * [-1639.394] (-1638.486) (-1640.557) (-1640.290) -- 0:00:54
      279000 -- (-1641.052) [-1639.995] (-1638.492) (-1640.373) * (-1639.184) [-1638.667] (-1639.659) (-1640.331) -- 0:00:54
      279500 -- (-1641.458) [-1640.003] (-1639.036) (-1641.996) * (-1640.942) (-1640.411) [-1639.701] (-1640.972) -- 0:00:54
      280000 -- [-1641.003] (-1640.828) (-1639.915) (-1640.556) * (-1642.063) [-1638.799] (-1640.058) (-1638.687) -- 0:00:53

      Average standard deviation of split frequencies: 0.013605

      280500 -- (-1644.140) (-1639.131) [-1639.015] (-1641.343) * (-1642.438) (-1640.314) [-1639.377] (-1638.320) -- 0:00:53
      281000 -- [-1638.821] (-1640.085) (-1640.275) (-1638.861) * (-1640.521) (-1639.550) (-1645.542) [-1639.829] -- 0:00:53
      281500 -- [-1640.506] (-1639.931) (-1642.214) (-1638.587) * (-1641.160) (-1640.853) (-1644.239) [-1639.676] -- 0:00:53
      282000 -- [-1639.257] (-1640.072) (-1642.084) (-1638.567) * (-1640.719) (-1642.906) [-1641.188] (-1641.647) -- 0:00:53
      282500 -- [-1640.108] (-1639.145) (-1641.137) (-1642.723) * (-1641.294) [-1639.944] (-1641.682) (-1640.609) -- 0:00:53
      283000 -- [-1638.861] (-1642.710) (-1641.139) (-1642.366) * (-1640.351) [-1639.789] (-1639.970) (-1639.062) -- 0:00:53
      283500 -- (-1641.095) (-1641.577) [-1642.071] (-1638.720) * (-1639.114) (-1640.698) (-1641.323) [-1639.167] -- 0:00:53
      284000 -- [-1640.869] (-1639.069) (-1641.947) (-1639.642) * (-1641.392) (-1644.473) (-1642.269) [-1640.967] -- 0:00:52
      284500 -- [-1642.657] (-1640.840) (-1639.167) (-1641.671) * (-1639.446) (-1644.485) (-1640.537) [-1639.866] -- 0:00:52
      285000 -- (-1641.194) [-1638.998] (-1640.941) (-1640.562) * [-1640.708] (-1640.785) (-1640.223) (-1642.369) -- 0:00:52

      Average standard deviation of split frequencies: 0.013021

      285500 -- (-1640.264) [-1639.564] (-1642.847) (-1639.046) * (-1640.160) (-1640.068) (-1640.989) [-1641.530] -- 0:00:52
      286000 -- (-1639.968) (-1640.475) (-1638.308) [-1639.512] * (-1639.657) (-1640.346) [-1640.053] (-1642.547) -- 0:00:52
      286500 -- (-1641.630) (-1638.543) [-1638.179] (-1638.932) * (-1640.157) (-1640.623) (-1640.089) [-1643.303] -- 0:00:52
      287000 -- (-1644.967) [-1638.223] (-1638.586) (-1641.162) * (-1641.664) (-1639.731) [-1638.787] (-1640.299) -- 0:00:52
      287500 -- [-1642.133] (-1638.098) (-1639.191) (-1639.883) * (-1640.079) [-1642.894] (-1638.255) (-1640.517) -- 0:00:52
      288000 -- [-1640.419] (-1639.229) (-1638.970) (-1638.481) * (-1641.332) (-1639.458) (-1639.878) [-1639.539] -- 0:00:51
      288500 -- (-1643.628) (-1640.032) [-1638.126] (-1639.157) * (-1639.739) [-1639.328] (-1640.276) (-1640.710) -- 0:00:51
      289000 -- [-1641.405] (-1640.000) (-1638.124) (-1639.318) * (-1641.628) (-1642.419) [-1640.226] (-1640.606) -- 0:00:51
      289500 -- (-1638.606) [-1639.396] (-1640.037) (-1639.211) * (-1641.214) (-1639.622) (-1640.289) [-1638.669] -- 0:00:51
      290000 -- (-1638.063) (-1642.147) (-1640.185) [-1639.985] * (-1640.676) (-1638.506) (-1640.424) [-1638.260] -- 0:00:51

      Average standard deviation of split frequencies: 0.012569

      290500 -- (-1639.149) [-1640.843] (-1641.174) (-1641.341) * (-1640.853) [-1639.380] (-1644.040) (-1638.891) -- 0:00:51
      291000 -- (-1638.985) (-1643.223) (-1646.852) [-1643.272] * (-1639.381) (-1639.843) [-1642.248] (-1639.376) -- 0:00:51
      291500 -- (-1638.782) (-1642.155) [-1642.148] (-1639.023) * (-1640.070) (-1639.901) (-1639.316) [-1639.278] -- 0:00:53
      292000 -- [-1638.504] (-1642.111) (-1638.164) (-1640.638) * (-1640.633) (-1639.434) (-1644.565) [-1639.117] -- 0:00:53
      292500 -- (-1645.357) [-1639.561] (-1638.725) (-1640.592) * (-1639.365) (-1638.057) (-1643.183) [-1642.327] -- 0:00:53
      293000 -- (-1651.432) (-1639.436) (-1639.640) [-1642.027] * (-1639.814) (-1638.498) (-1642.053) [-1640.989] -- 0:00:53
      293500 -- [-1642.599] (-1640.841) (-1642.981) (-1640.922) * (-1639.601) [-1640.246] (-1641.720) (-1641.111) -- 0:00:52
      294000 -- (-1643.768) [-1640.072] (-1640.542) (-1643.964) * [-1638.135] (-1641.381) (-1639.744) (-1639.653) -- 0:00:52
      294500 -- (-1641.528) (-1639.863) [-1640.369] (-1638.591) * (-1638.390) (-1641.652) (-1639.934) [-1638.340] -- 0:00:52
      295000 -- (-1639.841) (-1643.582) (-1640.203) [-1639.894] * (-1638.394) [-1643.013] (-1644.689) (-1640.114) -- 0:00:52

      Average standard deviation of split frequencies: 0.013298

      295500 -- [-1638.660] (-1642.120) (-1640.030) (-1645.020) * [-1639.254] (-1644.431) (-1645.173) (-1638.928) -- 0:00:52
      296000 -- (-1642.380) (-1641.098) (-1638.648) [-1640.242] * (-1639.305) (-1642.154) (-1642.413) [-1640.841] -- 0:00:52
      296500 -- [-1638.839] (-1639.927) (-1640.377) (-1640.814) * (-1638.500) (-1642.878) [-1640.821] (-1639.978) -- 0:00:52
      297000 -- (-1639.034) [-1639.927] (-1640.306) (-1640.837) * (-1638.456) (-1642.232) [-1640.932] (-1638.456) -- 0:00:52
      297500 -- (-1639.364) (-1638.849) [-1640.690] (-1638.952) * (-1638.555) (-1638.723) [-1641.688] (-1638.190) -- 0:00:51
      298000 -- (-1641.902) (-1639.372) (-1640.088) [-1639.111] * (-1639.549) [-1640.438] (-1641.826) (-1643.444) -- 0:00:51
      298500 -- (-1642.992) (-1639.031) (-1639.782) [-1640.076] * (-1642.282) [-1643.496] (-1642.914) (-1645.160) -- 0:00:51
      299000 -- (-1639.559) [-1639.945] (-1639.656) (-1641.405) * [-1642.359] (-1641.449) (-1641.049) (-1646.292) -- 0:00:51
      299500 -- [-1638.796] (-1641.073) (-1639.873) (-1639.177) * [-1640.774] (-1640.265) (-1641.725) (-1645.504) -- 0:00:51
      300000 -- [-1641.874] (-1640.128) (-1639.319) (-1640.657) * [-1640.221] (-1639.231) (-1640.891) (-1640.819) -- 0:00:51

      Average standard deviation of split frequencies: 0.014024

      300500 -- (-1639.721) (-1640.003) (-1639.607) [-1641.066] * [-1639.188] (-1640.078) (-1641.108) (-1640.420) -- 0:00:51
      301000 -- [-1639.657] (-1640.507) (-1641.373) (-1640.692) * [-1639.840] (-1640.022) (-1639.214) (-1640.598) -- 0:00:51
      301500 -- (-1639.113) (-1640.515) (-1639.510) [-1641.233] * (-1639.540) [-1640.591] (-1640.296) (-1639.200) -- 0:00:50
      302000 -- [-1639.250] (-1640.328) (-1640.306) (-1639.927) * [-1638.775] (-1644.733) (-1641.172) (-1639.723) -- 0:00:50
      302500 -- (-1642.805) [-1638.325] (-1641.898) (-1641.707) * (-1639.565) [-1639.390] (-1641.436) (-1642.829) -- 0:00:50
      303000 -- (-1640.727) [-1638.744] (-1640.455) (-1641.707) * (-1640.225) [-1640.016] (-1639.328) (-1643.073) -- 0:00:50
      303500 -- (-1638.480) (-1638.607) (-1640.715) [-1639.512] * [-1639.741] (-1639.137) (-1639.629) (-1643.828) -- 0:00:50
      304000 -- [-1638.312] (-1644.785) (-1641.764) (-1639.305) * [-1639.650] (-1645.748) (-1639.997) (-1641.007) -- 0:00:50
      304500 -- (-1639.008) (-1641.195) [-1644.670] (-1638.882) * [-1639.890] (-1641.113) (-1640.034) (-1639.147) -- 0:00:52
      305000 -- (-1641.311) (-1642.915) [-1645.272] (-1638.983) * (-1640.873) [-1642.643] (-1640.048) (-1639.665) -- 0:00:52

      Average standard deviation of split frequencies: 0.013480

      305500 -- (-1642.283) (-1646.484) (-1641.432) [-1639.122] * [-1639.987] (-1640.049) (-1644.629) (-1641.962) -- 0:00:52
      306000 -- (-1640.272) (-1640.817) [-1641.007] (-1640.243) * (-1639.038) [-1639.217] (-1641.175) (-1641.406) -- 0:00:52
      306500 -- [-1641.627] (-1639.059) (-1647.465) (-1642.265) * [-1641.036] (-1638.995) (-1641.632) (-1644.958) -- 0:00:52
      307000 -- (-1639.407) [-1639.015] (-1640.221) (-1641.040) * (-1642.177) [-1638.695] (-1643.457) (-1643.756) -- 0:00:51
      307500 -- [-1641.557] (-1639.034) (-1642.086) (-1640.648) * (-1642.682) (-1642.890) [-1641.035] (-1643.749) -- 0:00:51
      308000 -- (-1642.942) (-1638.117) [-1639.546] (-1640.827) * [-1644.942] (-1642.933) (-1640.360) (-1640.630) -- 0:00:51
      308500 -- (-1644.370) (-1638.196) [-1641.084] (-1644.643) * (-1643.387) [-1641.977] (-1644.210) (-1640.820) -- 0:00:51
      309000 -- [-1644.608] (-1638.430) (-1638.322) (-1647.902) * [-1638.383] (-1643.256) (-1641.112) (-1641.837) -- 0:00:51
      309500 -- (-1638.198) (-1639.015) [-1638.741] (-1644.466) * (-1638.429) (-1639.294) (-1639.312) [-1640.567] -- 0:00:51
      310000 -- (-1639.084) [-1639.640] (-1638.257) (-1640.720) * (-1640.939) (-1640.563) [-1638.445] (-1639.853) -- 0:00:51

      Average standard deviation of split frequencies: 0.013210

      310500 -- (-1638.247) (-1640.331) [-1638.398] (-1641.356) * (-1639.297) (-1643.516) [-1638.018] (-1640.344) -- 0:00:51
      311000 -- (-1638.499) [-1638.367] (-1638.572) (-1641.622) * [-1638.595] (-1641.339) (-1638.918) (-1638.191) -- 0:00:50
      311500 -- [-1641.626] (-1638.500) (-1639.053) (-1642.855) * (-1638.898) (-1639.107) [-1640.049] (-1638.191) -- 0:00:50
      312000 -- [-1638.922] (-1642.084) (-1640.441) (-1642.101) * [-1639.019] (-1643.951) (-1639.502) (-1639.143) -- 0:00:50
      312500 -- [-1641.080] (-1643.019) (-1640.045) (-1640.643) * [-1638.924] (-1645.633) (-1638.507) (-1639.408) -- 0:00:50
      313000 -- [-1638.427] (-1642.551) (-1642.738) (-1639.429) * (-1640.096) (-1644.023) (-1638.475) [-1643.109] -- 0:00:50
      313500 -- (-1640.824) (-1642.020) (-1641.703) [-1641.637] * [-1640.305] (-1640.121) (-1639.387) (-1641.534) -- 0:00:50
      314000 -- (-1641.563) (-1639.107) [-1642.139] (-1642.336) * [-1639.853] (-1640.565) (-1639.276) (-1642.568) -- 0:00:50
      314500 -- (-1640.643) [-1638.872] (-1646.319) (-1639.493) * [-1643.455] (-1641.228) (-1639.939) (-1640.001) -- 0:00:50
      315000 -- (-1644.706) (-1639.338) [-1642.022] (-1638.722) * [-1640.563] (-1640.458) (-1639.915) (-1640.213) -- 0:00:50

      Average standard deviation of split frequencies: 0.013758

      315500 -- (-1640.988) (-1640.319) (-1641.711) [-1640.953] * (-1641.887) (-1641.318) (-1639.186) [-1648.368] -- 0:00:49
      316000 -- (-1639.380) (-1646.248) [-1641.159] (-1643.169) * [-1639.481] (-1640.298) (-1638.736) (-1647.872) -- 0:00:49
      316500 -- (-1642.171) [-1640.524] (-1641.944) (-1641.244) * (-1643.084) (-1640.492) (-1639.122) [-1643.220] -- 0:00:49
      317000 -- (-1651.604) [-1640.671] (-1641.963) (-1638.869) * (-1642.556) (-1639.281) (-1639.727) [-1640.838] -- 0:00:49
      317500 -- (-1640.949) (-1641.045) (-1640.031) [-1640.453] * (-1643.161) (-1639.192) [-1641.155] (-1642.178) -- 0:00:49
      318000 -- (-1639.631) (-1640.390) [-1639.735] (-1639.449) * (-1642.498) (-1639.193) [-1638.174] (-1640.268) -- 0:00:51
      318500 -- (-1638.969) (-1640.564) (-1639.961) [-1638.205] * (-1642.371) (-1639.005) (-1640.473) [-1639.433] -- 0:00:51
      319000 -- [-1640.138] (-1641.670) (-1639.886) (-1638.858) * (-1642.564) (-1640.368) (-1641.704) [-1639.132] -- 0:00:51
      319500 -- (-1642.176) (-1642.044) [-1639.351] (-1639.207) * [-1640.538] (-1638.426) (-1642.035) (-1639.141) -- 0:00:51
      320000 -- [-1639.118] (-1642.597) (-1638.986) (-1638.228) * (-1640.675) (-1638.964) [-1640.153] (-1640.198) -- 0:00:50

      Average standard deviation of split frequencies: 0.014292

      320500 -- (-1640.763) (-1642.051) (-1639.379) [-1639.286] * [-1641.566] (-1639.237) (-1640.878) (-1638.095) -- 0:00:50
      321000 -- [-1638.577] (-1640.694) (-1641.640) (-1639.009) * (-1639.616) (-1640.523) (-1638.898) [-1640.040] -- 0:00:50
      321500 -- [-1639.610] (-1640.180) (-1643.611) (-1642.448) * (-1641.763) (-1639.355) (-1638.433) [-1641.328] -- 0:00:50
      322000 -- (-1646.838) [-1640.539] (-1644.532) (-1642.627) * (-1640.470) (-1638.388) (-1639.524) [-1641.612] -- 0:00:50
      322500 -- (-1641.558) [-1642.418] (-1644.186) (-1638.339) * (-1639.295) [-1639.517] (-1639.456) (-1639.854) -- 0:00:50
      323000 -- (-1642.781) (-1642.929) (-1641.586) [-1641.928] * (-1640.545) (-1639.561) (-1640.588) [-1639.636] -- 0:00:50
      323500 -- (-1639.835) (-1642.893) (-1642.485) [-1638.690] * (-1638.257) [-1639.070] (-1639.121) (-1638.201) -- 0:00:50
      324000 -- [-1639.669] (-1640.179) (-1642.812) (-1640.789) * [-1638.625] (-1638.334) (-1641.803) (-1638.545) -- 0:00:50
      324500 -- (-1640.855) (-1641.808) (-1642.655) [-1639.839] * (-1639.699) (-1639.610) (-1640.474) [-1638.219] -- 0:00:49
      325000 -- (-1642.090) (-1641.531) (-1640.499) [-1640.133] * (-1640.238) (-1639.514) [-1639.359] (-1639.944) -- 0:00:49

      Average standard deviation of split frequencies: 0.014621

      325500 -- (-1646.813) [-1638.214] (-1639.748) (-1639.444) * (-1641.498) [-1642.116] (-1641.149) (-1639.775) -- 0:00:49
      326000 -- [-1640.994] (-1642.025) (-1641.443) (-1638.279) * (-1641.467) [-1641.117] (-1640.566) (-1638.425) -- 0:00:49
      326500 -- [-1639.411] (-1640.562) (-1643.288) (-1638.308) * (-1642.104) (-1641.160) (-1639.579) [-1639.513] -- 0:00:49
      327000 -- (-1640.510) [-1639.955] (-1640.660) (-1640.219) * (-1640.361) (-1643.828) [-1640.346] (-1640.993) -- 0:00:49
      327500 -- (-1641.465) (-1639.095) [-1640.588] (-1642.657) * (-1641.918) (-1642.367) (-1640.228) [-1642.176] -- 0:00:49
      328000 -- (-1642.133) (-1640.537) (-1639.424) [-1638.970] * (-1641.882) [-1639.682] (-1639.050) (-1641.779) -- 0:00:49
      328500 -- (-1639.861) [-1638.805] (-1640.426) (-1640.191) * [-1639.021] (-1639.340) (-1638.847) (-1642.106) -- 0:00:49
      329000 -- (-1639.511) (-1642.025) [-1643.346] (-1646.169) * (-1639.176) (-1639.022) (-1638.619) [-1640.417] -- 0:00:48
      329500 -- [-1639.423] (-1638.728) (-1643.382) (-1639.888) * (-1640.323) [-1638.519] (-1638.354) (-1640.194) -- 0:00:48
      330000 -- (-1639.765) (-1638.519) (-1641.869) [-1641.100] * (-1646.066) (-1638.239) [-1638.513] (-1648.114) -- 0:00:48

      Average standard deviation of split frequencies: 0.014811

      330500 -- (-1642.304) [-1638.805] (-1643.513) (-1639.611) * (-1640.101) (-1639.838) (-1640.767) [-1642.636] -- 0:00:48
      331000 -- [-1645.515] (-1642.257) (-1642.958) (-1646.745) * (-1640.578) (-1640.307) (-1639.624) [-1639.255] -- 0:00:48
      331500 -- [-1640.221] (-1641.255) (-1639.692) (-1639.312) * (-1639.360) [-1639.642] (-1642.066) (-1640.132) -- 0:00:50
      332000 -- (-1639.096) (-1640.332) (-1639.083) [-1640.362] * [-1638.886] (-1639.355) (-1639.844) (-1641.413) -- 0:00:50
      332500 -- (-1640.689) (-1639.706) (-1640.140) [-1641.482] * (-1640.178) [-1642.848] (-1641.925) (-1643.777) -- 0:00:50
      333000 -- [-1640.872] (-1640.210) (-1641.221) (-1640.547) * (-1641.167) (-1640.381) [-1641.316] (-1639.706) -- 0:00:50
      333500 -- (-1638.898) [-1639.583] (-1642.993) (-1639.088) * (-1639.606) (-1641.734) (-1639.852) [-1639.826] -- 0:00:49
      334000 -- [-1639.908] (-1640.805) (-1639.684) (-1642.088) * (-1639.169) (-1642.097) (-1640.903) [-1638.140] -- 0:00:49
      334500 -- [-1642.572] (-1642.117) (-1640.448) (-1639.882) * (-1638.985) (-1641.348) [-1640.686] (-1638.182) -- 0:00:49
      335000 -- [-1640.064] (-1639.971) (-1639.347) (-1642.584) * [-1638.305] (-1642.189) (-1640.244) (-1638.480) -- 0:00:49

      Average standard deviation of split frequencies: 0.015199

      335500 -- [-1639.111] (-1640.682) (-1641.022) (-1639.190) * (-1638.776) (-1641.146) (-1640.733) [-1640.295] -- 0:00:49
      336000 -- (-1638.438) [-1640.706] (-1641.462) (-1638.818) * (-1641.882) [-1640.079] (-1639.186) (-1643.288) -- 0:00:49
      336500 -- (-1638.573) (-1640.954) [-1639.635] (-1639.834) * (-1638.477) [-1640.789] (-1639.925) (-1642.024) -- 0:00:49
      337000 -- [-1638.123] (-1638.861) (-1639.484) (-1638.652) * (-1639.896) (-1640.156) [-1645.302] (-1642.296) -- 0:00:49
      337500 -- (-1637.951) (-1639.108) [-1638.590] (-1641.641) * (-1640.669) [-1638.934] (-1644.072) (-1640.926) -- 0:00:49
      338000 -- (-1640.856) (-1640.292) (-1641.026) [-1640.772] * (-1639.752) (-1637.913) (-1640.905) [-1641.706] -- 0:00:48
      338500 -- [-1639.976] (-1642.042) (-1639.196) (-1641.247) * (-1638.703) [-1642.959] (-1640.812) (-1638.395) -- 0:00:48
      339000 -- (-1639.398) [-1642.530] (-1639.260) (-1641.473) * [-1641.227] (-1642.351) (-1640.655) (-1640.979) -- 0:00:48
      339500 -- (-1638.979) (-1641.205) [-1639.469] (-1643.053) * [-1640.667] (-1642.485) (-1638.694) (-1641.988) -- 0:00:48
      340000 -- (-1638.728) [-1640.851] (-1639.205) (-1639.550) * (-1641.725) (-1641.101) [-1638.645] (-1641.173) -- 0:00:48

      Average standard deviation of split frequencies: 0.014652

      340500 -- (-1641.916) (-1639.683) (-1639.362) [-1639.766] * (-1639.736) (-1639.358) (-1640.157) [-1639.855] -- 0:00:48
      341000 -- [-1638.684] (-1642.360) (-1639.511) (-1639.448) * [-1639.725] (-1643.244) (-1641.421) (-1638.867) -- 0:00:48
      341500 -- [-1639.000] (-1640.753) (-1641.428) (-1638.868) * (-1639.310) (-1640.755) (-1643.285) [-1638.798] -- 0:00:48
      342000 -- (-1641.668) (-1644.791) (-1639.833) [-1639.108] * (-1640.045) (-1641.277) [-1642.907] (-1639.202) -- 0:00:48
      342500 -- (-1639.698) (-1639.617) [-1639.404] (-1639.968) * (-1643.317) (-1639.160) (-1638.673) [-1639.321] -- 0:00:47
      343000 -- (-1643.780) [-1639.268] (-1639.506) (-1640.813) * (-1640.852) [-1643.015] (-1641.276) (-1641.795) -- 0:00:47
      343500 -- (-1643.896) [-1639.567] (-1641.598) (-1645.002) * (-1641.998) (-1640.878) (-1638.999) [-1638.474] -- 0:00:47
      344000 -- (-1640.940) [-1638.693] (-1643.799) (-1646.798) * (-1641.270) (-1639.287) (-1638.904) [-1638.372] -- 0:00:47
      344500 -- [-1638.817] (-1640.022) (-1641.771) (-1640.277) * [-1638.616] (-1639.087) (-1639.046) (-1638.388) -- 0:00:47
      345000 -- (-1638.423) (-1641.322) (-1640.594) [-1641.678] * (-1638.974) [-1639.309] (-1639.368) (-1638.853) -- 0:00:49

      Average standard deviation of split frequencies: 0.014907

      345500 -- [-1640.381] (-1643.249) (-1640.583) (-1639.135) * (-1640.502) (-1641.169) (-1640.145) [-1639.316] -- 0:00:49
      346000 -- (-1638.969) (-1643.551) [-1639.313] (-1640.905) * (-1648.198) [-1638.995] (-1639.996) (-1642.781) -- 0:00:49
      346500 -- (-1638.906) [-1642.720] (-1641.768) (-1641.769) * (-1646.444) [-1638.848] (-1640.252) (-1638.301) -- 0:00:49
      347000 -- (-1640.299) (-1642.036) [-1638.602] (-1639.956) * (-1638.400) [-1639.265] (-1641.047) (-1638.260) -- 0:00:48
      347500 -- (-1640.126) (-1640.373) [-1639.451] (-1640.139) * [-1639.649] (-1640.059) (-1639.608) (-1639.356) -- 0:00:48
      348000 -- (-1639.891) [-1640.971] (-1639.451) (-1640.639) * (-1639.072) [-1641.152] (-1639.630) (-1641.530) -- 0:00:48
      348500 -- (-1639.764) [-1638.924] (-1639.472) (-1641.214) * [-1639.354] (-1642.507) (-1638.292) (-1642.410) -- 0:00:48
      349000 -- (-1641.172) (-1643.798) (-1638.604) [-1640.090] * (-1639.966) [-1639.718] (-1638.207) (-1641.124) -- 0:00:48
      349500 -- (-1648.586) (-1641.370) [-1638.707] (-1641.199) * (-1640.814) (-1639.901) [-1643.693] (-1646.873) -- 0:00:48
      350000 -- [-1640.589] (-1642.403) (-1640.531) (-1639.740) * (-1644.315) (-1644.589) [-1640.561] (-1642.518) -- 0:00:48

      Average standard deviation of split frequencies: 0.014471

      350500 -- (-1642.123) [-1640.056] (-1639.230) (-1641.966) * (-1641.679) (-1647.432) [-1640.241] (-1640.558) -- 0:00:48
      351000 -- [-1641.587] (-1641.050) (-1641.095) (-1641.131) * (-1644.107) (-1641.684) [-1639.508] (-1641.734) -- 0:00:48
      351500 -- (-1640.878) (-1640.731) [-1638.928] (-1640.188) * (-1648.083) (-1642.194) (-1638.861) [-1640.775] -- 0:00:47
      352000 -- (-1644.106) [-1640.750] (-1642.742) (-1640.398) * (-1638.284) (-1639.502) [-1639.598] (-1639.878) -- 0:00:47
      352500 -- (-1643.612) (-1639.990) [-1638.768] (-1643.753) * [-1638.284] (-1641.802) (-1640.538) (-1642.435) -- 0:00:47
      353000 -- [-1641.581] (-1641.207) (-1638.821) (-1638.722) * (-1638.274) (-1640.280) (-1640.950) [-1648.469] -- 0:00:47
      353500 -- [-1640.075] (-1639.598) (-1639.776) (-1638.338) * (-1638.682) (-1641.948) [-1639.577] (-1644.079) -- 0:00:47
      354000 -- (-1641.335) [-1639.846] (-1638.238) (-1639.193) * (-1639.634) [-1640.020] (-1642.239) (-1638.826) -- 0:00:47
      354500 -- (-1641.520) (-1639.573) [-1638.188] (-1638.544) * (-1639.989) (-1641.591) (-1641.726) [-1639.161] -- 0:00:47
      355000 -- (-1638.600) (-1640.176) (-1639.826) [-1638.293] * (-1639.860) [-1641.045] (-1641.685) (-1640.830) -- 0:00:47

      Average standard deviation of split frequencies: 0.014254

      355500 -- (-1639.790) (-1640.693) (-1641.886) [-1639.483] * (-1640.129) [-1639.279] (-1643.438) (-1640.932) -- 0:00:47
      356000 -- (-1638.003) (-1639.849) [-1642.008] (-1640.315) * (-1641.106) (-1639.156) [-1642.831] (-1639.002) -- 0:00:47
      356500 -- [-1638.701] (-1639.641) (-1643.548) (-1644.008) * (-1639.188) (-1643.527) (-1643.396) [-1640.764] -- 0:00:46
      357000 -- [-1639.168] (-1640.826) (-1641.189) (-1642.478) * (-1641.051) [-1641.438] (-1643.159) (-1642.503) -- 0:00:46
      357500 -- (-1640.018) (-1639.827) (-1643.181) [-1639.858] * (-1641.678) (-1641.232) [-1639.415] (-1644.559) -- 0:00:46
      358000 -- (-1643.269) [-1640.401] (-1641.010) (-1638.896) * (-1640.335) (-1641.524) (-1641.722) [-1640.073] -- 0:00:46
      358500 -- (-1638.334) [-1642.501] (-1640.695) (-1639.881) * (-1640.688) (-1639.189) [-1639.454] (-1644.967) -- 0:00:48
      359000 -- (-1639.985) [-1640.202] (-1641.173) (-1640.036) * (-1641.079) [-1642.123] (-1639.485) (-1640.655) -- 0:00:48
      359500 -- (-1640.493) [-1642.694] (-1640.192) (-1638.255) * [-1639.595] (-1644.154) (-1638.449) (-1640.955) -- 0:00:48
      360000 -- (-1643.014) (-1638.982) [-1638.879] (-1638.980) * [-1638.692] (-1642.931) (-1638.793) (-1638.882) -- 0:00:47

      Average standard deviation of split frequencies: 0.014377

      360500 -- (-1639.656) [-1639.440] (-1639.466) (-1638.879) * (-1641.610) (-1647.048) (-1642.471) [-1639.659] -- 0:00:47
      361000 -- (-1640.209) (-1640.767) [-1640.071] (-1639.969) * [-1638.530] (-1641.972) (-1641.582) (-1639.765) -- 0:00:47
      361500 -- (-1642.762) (-1638.836) [-1641.117] (-1639.029) * [-1638.530] (-1644.599) (-1643.970) (-1641.274) -- 0:00:47
      362000 -- [-1641.033] (-1638.315) (-1639.233) (-1639.169) * [-1641.665] (-1641.554) (-1648.437) (-1645.071) -- 0:00:47
      362500 -- (-1640.433) [-1638.733] (-1643.364) (-1639.762) * [-1641.643] (-1641.809) (-1646.068) (-1639.222) -- 0:00:47
      363000 -- (-1639.239) (-1640.709) [-1640.985] (-1641.364) * (-1639.989) [-1641.522] (-1649.945) (-1638.318) -- 0:00:47
      363500 -- (-1643.204) (-1645.334) [-1640.170] (-1640.765) * (-1638.611) (-1641.208) (-1646.670) [-1638.318] -- 0:00:47
      364000 -- (-1639.485) (-1645.834) (-1639.642) [-1639.889] * [-1643.246] (-1639.503) (-1648.261) (-1641.026) -- 0:00:47
      364500 -- [-1640.925] (-1642.218) (-1638.922) (-1640.468) * (-1642.450) (-1640.876) (-1643.769) [-1639.893] -- 0:00:47
      365000 -- (-1640.033) (-1638.186) [-1639.192] (-1641.236) * (-1644.449) (-1643.247) [-1642.687] (-1639.769) -- 0:00:46

      Average standard deviation of split frequencies: 0.013638

      365500 -- (-1640.274) (-1638.321) [-1640.235] (-1643.404) * (-1644.840) (-1639.680) (-1639.159) [-1640.607] -- 0:00:46
      366000 -- (-1639.372) (-1640.949) (-1641.455) [-1640.110] * (-1639.993) (-1642.566) [-1638.716] (-1643.340) -- 0:00:46
      366500 -- (-1640.784) (-1639.103) (-1642.929) [-1640.465] * [-1641.733] (-1641.324) (-1638.499) (-1642.733) -- 0:00:46
      367000 -- [-1640.510] (-1639.237) (-1641.679) (-1640.872) * (-1641.182) [-1641.487] (-1639.591) (-1640.778) -- 0:00:46
      367500 -- (-1641.245) (-1638.550) (-1645.774) [-1640.433] * [-1640.161] (-1640.813) (-1642.143) (-1639.155) -- 0:00:46
      368000 -- (-1640.204) (-1639.081) [-1642.491] (-1640.680) * [-1638.942] (-1640.829) (-1639.498) (-1638.911) -- 0:00:46
      368500 -- (-1639.909) (-1638.350) (-1640.070) [-1638.962] * (-1639.787) [-1639.167] (-1643.449) (-1641.167) -- 0:00:46
      369000 -- (-1643.128) (-1638.385) [-1638.556] (-1641.037) * (-1639.002) [-1639.627] (-1640.296) (-1642.371) -- 0:00:46
      369500 -- (-1638.319) (-1641.145) (-1640.569) [-1638.910] * (-1638.487) [-1642.046] (-1640.352) (-1642.285) -- 0:00:46
      370000 -- [-1641.094] (-1646.658) (-1640.712) (-1641.551) * [-1639.903] (-1641.728) (-1639.890) (-1639.331) -- 0:00:45

      Average standard deviation of split frequencies: 0.012793

      370500 -- (-1639.916) (-1651.576) [-1640.161] (-1638.540) * (-1639.611) [-1639.712] (-1639.304) (-1641.414) -- 0:00:45
      371000 -- (-1641.621) (-1643.181) [-1640.206] (-1638.994) * (-1638.584) (-1639.089) (-1638.950) [-1640.123] -- 0:00:45
      371500 -- (-1643.729) (-1640.193) [-1641.258] (-1639.861) * [-1641.878] (-1639.645) (-1638.426) (-1638.876) -- 0:00:45
      372000 -- (-1640.411) [-1639.121] (-1639.081) (-1639.816) * (-1639.095) (-1639.482) (-1639.873) [-1638.588] -- 0:00:47
      372500 -- (-1638.692) (-1640.093) [-1640.292] (-1639.028) * (-1638.425) [-1639.448] (-1639.707) (-1638.901) -- 0:00:47
      373000 -- (-1640.368) [-1639.362] (-1639.508) (-1643.133) * (-1638.374) [-1640.498] (-1640.752) (-1642.369) -- 0:00:47
      373500 -- (-1640.000) (-1640.637) (-1639.015) [-1642.056] * [-1638.373] (-1639.548) (-1641.080) (-1641.334) -- 0:00:46
      374000 -- (-1639.615) [-1639.601] (-1638.813) (-1642.979) * (-1640.214) (-1641.249) (-1639.739) [-1640.829] -- 0:00:46
      374500 -- (-1640.713) [-1639.068] (-1640.325) (-1640.980) * (-1640.690) [-1640.066] (-1638.494) (-1640.628) -- 0:00:46
      375000 -- (-1639.729) (-1638.227) (-1638.854) [-1638.970] * [-1642.661] (-1640.692) (-1639.801) (-1640.172) -- 0:00:46

      Average standard deviation of split frequencies: 0.013717

      375500 -- (-1640.513) (-1639.472) (-1638.847) [-1639.997] * (-1640.001) [-1639.340] (-1639.179) (-1639.193) -- 0:00:46
      376000 -- (-1638.926) [-1639.714] (-1640.219) (-1640.825) * (-1639.369) (-1639.909) (-1641.416) [-1639.124] -- 0:00:46
      376500 -- (-1640.870) (-1639.714) (-1640.788) [-1644.238] * (-1637.925) [-1639.278] (-1640.792) (-1639.015) -- 0:00:46
      377000 -- (-1641.194) (-1639.655) [-1639.290] (-1642.451) * [-1639.377] (-1639.308) (-1640.329) (-1639.105) -- 0:00:46
      377500 -- [-1639.902] (-1638.603) (-1641.005) (-1641.768) * (-1640.174) (-1640.128) [-1639.932] (-1638.669) -- 0:00:46
      378000 -- (-1640.876) [-1639.008] (-1639.426) (-1639.094) * (-1642.538) (-1639.122) (-1640.736) [-1638.775] -- 0:00:46
      378500 -- (-1640.028) [-1642.525] (-1638.593) (-1642.818) * (-1642.121) (-1639.101) [-1640.712] (-1640.518) -- 0:00:45
      379000 -- (-1642.489) (-1639.638) (-1639.618) [-1638.838] * (-1641.205) (-1641.801) (-1639.457) [-1639.103] -- 0:00:45
      379500 -- (-1643.074) (-1638.619) [-1639.343] (-1639.478) * (-1638.936) (-1638.612) (-1639.889) [-1639.106] -- 0:00:45
      380000 -- (-1641.531) (-1638.569) (-1640.645) [-1643.962] * [-1639.929] (-1642.882) (-1641.723) (-1639.164) -- 0:00:45

      Average standard deviation of split frequencies: 0.013913

      380500 -- [-1639.311] (-1640.096) (-1639.908) (-1640.465) * (-1640.664) (-1638.164) [-1638.934] (-1643.488) -- 0:00:45
      381000 -- (-1639.032) (-1640.996) [-1639.892] (-1639.629) * (-1638.119) [-1640.830] (-1641.404) (-1640.684) -- 0:00:45
      381500 -- [-1638.755] (-1641.662) (-1639.868) (-1640.872) * (-1639.721) (-1642.133) [-1640.032] (-1639.023) -- 0:00:45
      382000 -- (-1642.624) (-1644.358) (-1641.485) [-1641.720] * (-1641.346) (-1639.986) (-1638.569) [-1641.732] -- 0:00:45
      382500 -- (-1642.086) [-1641.002] (-1641.302) (-1642.149) * (-1639.269) (-1640.742) (-1640.629) [-1640.548] -- 0:00:45
      383000 -- (-1643.825) [-1639.260] (-1640.440) (-1638.795) * (-1641.082) (-1639.519) (-1640.845) [-1640.733] -- 0:00:45
      383500 -- (-1640.286) [-1638.732] (-1639.136) (-1638.827) * (-1640.965) [-1641.216] (-1641.644) (-1641.197) -- 0:00:45
      384000 -- (-1641.328) (-1638.682) [-1643.428] (-1640.013) * (-1640.863) (-1639.345) (-1641.186) [-1638.666] -- 0:00:44
      384500 -- (-1643.419) (-1639.977) (-1642.186) [-1640.201] * (-1641.354) (-1639.979) (-1639.986) [-1642.521] -- 0:00:44
      38