>C1
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C2
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C3
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C4
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C5
MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLRo
>C6
MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLRo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=400
C1 LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
C2 LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
C3 LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
C4 LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
C5 -MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
C6 -MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
*************************************************
C1 RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
C2 RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
C3 RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
C4 RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
C5 RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
C6 RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
**************************************************
C1 KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
C2 KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
C3 KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
C4 KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
C5 KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
C6 KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
**************************************************
C1 WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
C2 WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
C3 WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
C4 WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
C5 WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
C6 WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
**************************************************
C1 EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
C2 EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
C3 EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
C4 EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
C5 EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
C6 EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
**************************************************
C1 AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
C2 AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
C3 AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
C4 AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
C5 AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
C6 AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
**************************************************
C1 KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
C2 KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
C3 KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
C4 KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
C5 KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
C6 KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
**************************************************
C1 VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR-
C2 VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR-
C3 VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR-
C4 VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR-
C5 VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLRo
C6 VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLRo
*************************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 399 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 399 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12002]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [12002]--->[12002]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.533 Mb, Max= 30.980 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
C2 MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
C3 MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
C4 MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
C5 MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
C6 MPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQR
**************************************************
C1 ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
C2 ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
C3 ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
C4 ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
C5 ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
C6 ALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVK
**************************************************
C1 HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
C2 HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
C3 HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
C4 HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
C5 HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
C6 HLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYAW
**************************************************
C1 TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
C2 TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
C3 TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
C4 TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
C5 TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
C6 TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTKE
**************************************************
C1 VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
C2 VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
C3 VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
C4 VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
C5 VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
C6 VYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAGA
**************************************************
C1 QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
C2 QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
C3 QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
C4 QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
C5 QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
C6 QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRFK
**************************************************
C1 RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
C2 RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
C3 RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
C4 RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
C5 RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
C6 RQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIAV
**************************************************
C1 NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
C2 NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
C3 NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
C4 NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
C5 NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
C6 NGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
************************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
C2 TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
C3 TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
C4 TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
C5 ---ATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
C6 ---ATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
***********************************************
C1 GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
C2 GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
C3 GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
C4 GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
C5 GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
C6 GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
**************************************************
C1 TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
C2 TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
C3 TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
C4 TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
C5 TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
C6 TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
**************************************************
C1 CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
C2 CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
C3 CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
C4 CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
C5 CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
C6 CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
**************************************************
C1 CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
C2 CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
C3 CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
C4 CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
C5 CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
C6 CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
**************************************************
C1 ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
C2 ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
C3 ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
C4 ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
C5 ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
C6 ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
**************************************************
C1 AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
C2 AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
C3 AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
C4 AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
C5 AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
C6 AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
**************************************************
C1 CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
C2 CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
C3 CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
C4 CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
C5 CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
C6 CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
**************************************************
C1 CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
C2 CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
C3 CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
C4 CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
C5 CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
C6 CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
**************************************************
C1 TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
C2 TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
C3 TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
C4 TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
C5 TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
C6 TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
**************************************************
C1 CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
C2 CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
C3 CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
C4 CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
C5 CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
C6 CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
**************************************************
C1 GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
C2 GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
C3 GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
C4 GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
C5 GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
C6 GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
**************************************************
C1 GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
C2 GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
C3 GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
C4 GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
C5 GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
C6 GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
**************************************************
C1 TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
C2 TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
C3 TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
C4 TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
C5 TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
C6 TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
**************************************************
C1 GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
C2 GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
C3 GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
C4 GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
C5 GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
C6 GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
**************************************************
C1 GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
C2 GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
C3 GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
C4 GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
C5 GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
C6 GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
**************************************************
C1 CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
C2 CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
C3 CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
C4 CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
C5 CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
C6 CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
**************************************************
C1 CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
C2 CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
C3 CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
C4 CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
C5 CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
C6 CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
**************************************************
C1 AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
C2 AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
C3 AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
C4 AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
C5 AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
C6 AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
**************************************************
C1 GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
C2 GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
C3 GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
C4 GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
C5 GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
C6 GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
**************************************************
C1 AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
C2 AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
C3 AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
C4 AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
C5 AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
C6 AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
**************************************************
C1 GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
C2 GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
C3 GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
C4 GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
C5 GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
C6 GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
**************************************************
C1 CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
C2 CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
C3 CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
C4 CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
C5 CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
C6 CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
**************************************************
C1 ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
C2 ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
C3 ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
C4 ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
C5 ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
C6 ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
***********************************************
>C1
TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
>C2
TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
>C3
TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
>C4
TTGATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
>C5
---ATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
>C6
---ATGCCGGAACGTATTATCCTGGCGTATTCGGGGGGGCTGGATACCTC
GGTGGCGATCAACTGGATCGGCAAGGAAACTAGCCATGAGGTCGTGGCAG
TGGTGATTGATCTCGGCCAGGGCGGCGAGGACATGGAGGTCGTACGTCAA
CGGGCGTTGGACTGCGGAGCTGTTGAGGCTATCGTTGTCGATGCCCGTGA
CGAGTTCGCTGAAGGCTATTGCTTGCCCACCGTTTTGAACAACGCGCTGT
ATATGGATCGGTACCCGTTGGTGTCCGCGATCAGCAGGCCGCTGATCGTC
AAGCACCTGGTCGCGGCCGCACGTGCGCACGGCGGCAGCATCGTCGCGCA
CGGTTGTACCGGCAAGGGTAACGACCAGGTCCGATTCGAAGTCGGATTCG
CTTCGCTGGCACCGGATCTCGAAATATTGGCGCCGGTGCGCGACTACGCA
TGGACACGAGAGAAGGCGATCGCTTTCGCCGAAGAGAACGCCATCCCCAT
CAATGTCACCAAACGTTCGCCGTTCTCGATTGACCAGAATGTTTGGGGCC
GCGCAGTGGAAACCGGTTTCCTGGAACACTTGTGGCACGCACCTACTAAA
GAGGTTTATTCCTACACTGACGACCCCACCATCAATTGGAACACGCCCGA
TGAGGTGATCGTCGGTTTTGAGCACGGAGTTCCGGTGTCGATTGACGGTA
GTCCGGTGTCCATGCTGGGCGCCATCGAGGCACTCAACCGACGCGCTGGC
GCGCAAGGCGTCGGGCGTCTCGACGTTGTCGAAGACCGGCTGGTAGGCAT
CAAGAGCCGCGAGATTTACGAGGCACCCGGAGCAATGGTGCTCATCACCG
CGCACGCCGAACTCGAGCACGTCACGCTGGAGCGTGAGTTGGGACGCTTC
AAGCGTCAGACCGATCGACGCTGGGCCGAATTGGTGTATGACGGATTGTG
GTATTCGCCGCTGAAGACCGCACTGGAGAGTTTTGTCGCCGCTACGCAAC
AACACGTTACCGGTGAAGTTCGAATGGTGTTACATGGAGGCCATATTGCG
GTGAATGGGCGGCGCAGCGCCGAATCCCTATACGATTTCAATTTGGCCAC
CTACGACGAAGGGGATACCTTCGATCAATCCGCTGCTCGCGGCTTCGTCT
ACGTGTACGGGTTACCGTCGAAGCTCGCGGCACGTAGGGACTTACGG---
>C1
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C2
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C3
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C4
LMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C5
oMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
>C6
oMPERIILAYSGGLDTSVAINWIGKETSHEVVAVVIDLGQGGEDMEVVRQ
RALDCGAVEAIVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIV
KHLVAAARAHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEILAPVRDYA
WTREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWHAPTK
EVYSYTDDPTINWNTPDEVIVGFEHGVPVSIDGSPVSMLGAIEALNRRAG
AQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHAELEHVTLERELGRF
KRQTDRRWAELVYDGLWYSPLKTALESFVAATQQHVTGEVRMVLHGGHIA
VNGRRSAESLYDFNLATYDEGDTFDQSAARGFVYVYGLPSKLAARRDLR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 1200 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579772843
Setting output file names to "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1089045369
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8508321725
Seed = 731685120
Swapseed = 1579772843
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 6 unique site patterns
Division 2 has 6 unique site patterns
Division 3 has 6 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2678.358790 -- -24.965149
Chain 2 -- -2678.369029 -- -24.965149
Chain 3 -- -2678.358635 -- -24.965149
Chain 4 -- -2678.100905 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2678.358790 -- -24.965149
Chain 2 -- -2678.368875 -- -24.965149
Chain 3 -- -2678.369029 -- -24.965149
Chain 4 -- -2678.369018 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2678.359] (-2678.369) (-2678.359) (-2678.101) * [-2678.359] (-2678.369) (-2678.369) (-2678.369)
500 -- (-1665.042) (-1652.303) (-1645.153) [-1643.716] * [-1653.325] (-1667.291) (-1653.291) (-1654.395) -- 0:00:00
1000 -- (-1660.321) [-1651.499] (-1659.220) (-1645.306) * [-1644.470] (-1657.848) (-1652.306) (-1647.565) -- 0:00:00
1500 -- (-1649.573) (-1649.283) [-1644.492] (-1650.953) * [-1649.134] (-1645.384) (-1651.220) (-1657.816) -- 0:00:00
2000 -- (-1650.895) (-1650.589) (-1651.776) [-1645.391] * (-1650.085) [-1643.524] (-1648.338) (-1652.186) -- 0:00:00
2500 -- (-1650.933) (-1662.338) [-1643.995] (-1653.301) * (-1642.987) (-1653.184) (-1656.097) [-1643.562] -- 0:00:00
3000 -- (-1655.173) (-1646.246) [-1646.073] (-1648.089) * [-1646.506] (-1646.945) (-1656.648) (-1645.426) -- 0:00:00
3500 -- (-1648.532) (-1648.128) (-1655.128) [-1649.717] * (-1650.998) (-1655.443) [-1645.221] (-1644.726) -- 0:00:00
4000 -- (-1651.168) [-1649.006] (-1648.793) (-1650.904) * (-1648.779) [-1653.798] (-1669.397) (-1651.608) -- 0:00:00
4500 -- (-1649.878) (-1649.385) [-1652.282] (-1653.189) * [-1651.801] (-1650.557) (-1647.073) (-1656.404) -- 0:00:00
5000 -- (-1650.156) (-1651.615) (-1653.538) [-1650.145] * [-1649.648] (-1647.309) (-1646.523) (-1653.562) -- 0:00:00
Average standard deviation of split frequencies: 0.082309
5500 -- (-1655.160) (-1652.563) [-1646.867] (-1664.064) * [-1655.958] (-1655.073) (-1652.267) (-1656.820) -- 0:00:00
6000 -- (-1645.765) [-1644.357] (-1649.630) (-1652.789) * (-1648.836) (-1651.069) (-1651.135) [-1646.552] -- 0:00:00
6500 -- (-1650.308) (-1652.015) (-1647.290) [-1658.101] * (-1644.132) [-1650.960] (-1645.342) (-1659.143) -- 0:00:00
7000 -- (-1652.661) [-1658.683] (-1652.645) (-1644.990) * (-1647.537) (-1657.436) [-1645.440] (-1649.754) -- 0:00:00
7500 -- (-1646.608) (-1654.860) [-1656.754] (-1654.601) * (-1647.503) [-1649.843] (-1649.346) (-1646.035) -- 0:00:00
8000 -- (-1656.363) [-1652.980] (-1653.462) (-1652.315) * (-1646.399) (-1651.350) (-1654.304) [-1643.272] -- 0:00:00
8500 -- [-1648.103] (-1651.147) (-1648.959) (-1663.184) * (-1648.298) (-1654.851) [-1641.885] (-1646.086) -- 0:00:00
9000 -- (-1655.794) (-1649.032) [-1646.672] (-1646.965) * (-1652.173) (-1652.138) [-1649.856] (-1652.396) -- 0:00:00
9500 -- [-1656.619] (-1651.828) (-1651.383) (-1652.046) * (-1651.283) [-1653.201] (-1657.482) (-1651.184) -- 0:00:00
10000 -- (-1653.453) (-1650.751) [-1645.423] (-1655.346) * [-1646.546] (-1653.256) (-1656.851) (-1647.777) -- 0:01:39
Average standard deviation of split frequencies: 0.072106
10500 -- (-1651.683) [-1649.012] (-1649.499) (-1659.985) * [-1646.711] (-1655.715) (-1651.323) (-1654.851) -- 0:01:34
11000 -- (-1648.885) (-1645.169) (-1643.669) [-1645.485] * (-1654.849) [-1644.865] (-1653.739) (-1645.774) -- 0:01:29
11500 -- (-1663.385) (-1645.354) [-1650.963] (-1653.592) * (-1644.811) [-1643.396] (-1657.173) (-1653.317) -- 0:01:25
12000 -- (-1647.294) (-1650.798) (-1655.914) [-1646.291] * (-1652.420) (-1648.151) [-1647.717] (-1651.821) -- 0:01:22
12500 -- (-1646.600) [-1647.300] (-1650.113) (-1650.913) * (-1651.992) (-1647.603) (-1644.705) [-1645.187] -- 0:01:19
13000 -- (-1648.906) (-1648.070) (-1648.697) [-1645.554] * (-1647.367) (-1654.125) (-1658.752) [-1647.998] -- 0:01:15
13500 -- (-1649.970) (-1646.576) (-1653.431) [-1647.927] * (-1662.694) (-1645.359) [-1652.704] (-1652.472) -- 0:01:13
14000 -- (-1649.567) (-1651.197) [-1647.689] (-1655.322) * [-1650.985] (-1651.599) (-1646.296) (-1653.132) -- 0:01:10
14500 -- (-1654.559) [-1645.624] (-1650.269) (-1649.487) * [-1645.622] (-1651.433) (-1645.551) (-1652.467) -- 0:01:07
15000 -- (-1652.052) (-1646.180) (-1651.301) [-1646.963] * (-1657.381) (-1647.331) [-1644.846] (-1654.245) -- 0:01:05
Average standard deviation of split frequencies: 0.060329
15500 -- (-1644.847) (-1649.170) (-1644.523) [-1645.858] * (-1650.373) (-1655.185) [-1647.388] (-1653.125) -- 0:01:03
16000 -- [-1648.216] (-1651.339) (-1643.249) (-1648.980) * (-1642.933) [-1646.996] (-1656.707) (-1654.834) -- 0:01:01
16500 -- [-1646.346] (-1647.062) (-1656.042) (-1651.293) * (-1660.586) (-1660.231) [-1644.717] (-1658.358) -- 0:00:59
17000 -- (-1648.844) (-1647.225) (-1648.765) [-1653.783] * (-1653.331) [-1649.651] (-1647.456) (-1653.286) -- 0:00:57
17500 -- (-1648.347) (-1648.674) (-1647.160) [-1655.295] * (-1650.970) (-1646.827) (-1647.778) [-1649.303] -- 0:00:56
18000 -- [-1649.057] (-1646.748) (-1648.001) (-1649.794) * (-1646.198) [-1651.346] (-1653.675) (-1650.753) -- 0:00:54
18500 -- [-1644.777] (-1652.685) (-1649.529) (-1651.277) * (-1653.693) (-1649.327) [-1646.375] (-1646.166) -- 0:00:53
19000 -- (-1650.658) (-1647.826) (-1648.593) [-1647.619] * [-1653.018] (-1648.061) (-1646.563) (-1646.056) -- 0:00:51
19500 -- (-1653.231) (-1645.788) (-1652.744) [-1649.396] * (-1645.939) (-1652.808) (-1645.708) [-1652.082] -- 0:00:50
20000 -- [-1644.333] (-1649.097) (-1647.137) (-1657.752) * [-1645.047] (-1646.331) (-1651.304) (-1647.682) -- 0:00:49
Average standard deviation of split frequencies: 0.059559
20500 -- (-1644.313) [-1646.797] (-1654.689) (-1657.694) * (-1646.984) (-1649.083) (-1650.787) [-1644.918] -- 0:00:47
21000 -- (-1657.443) [-1645.825] (-1648.650) (-1648.023) * (-1647.681) (-1650.000) [-1644.581] (-1649.215) -- 0:00:46
21500 -- (-1655.935) (-1652.126) (-1647.378) [-1650.223] * [-1645.022] (-1647.843) (-1650.059) (-1652.429) -- 0:00:45
22000 -- [-1644.592] (-1654.200) (-1646.834) (-1657.154) * [-1643.575] (-1648.105) (-1652.404) (-1655.729) -- 0:00:44
22500 -- [-1649.718] (-1657.580) (-1644.890) (-1653.658) * (-1651.859) [-1649.225] (-1645.762) (-1648.450) -- 0:00:43
23000 -- [-1648.235] (-1651.460) (-1643.056) (-1648.960) * (-1650.264) (-1646.303) [-1653.207] (-1652.644) -- 0:01:24
23500 -- [-1644.817] (-1648.986) (-1640.087) (-1645.491) * [-1647.435] (-1650.683) (-1647.951) (-1650.054) -- 0:01:23
24000 -- (-1656.319) (-1651.377) [-1640.934] (-1644.902) * [-1647.010] (-1648.149) (-1649.589) (-1646.148) -- 0:01:21
24500 -- (-1648.326) (-1646.988) (-1640.171) [-1646.778] * [-1651.243] (-1656.993) (-1655.028) (-1644.036) -- 0:01:19
25000 -- (-1648.151) (-1653.951) [-1639.865] (-1649.737) * (-1645.971) (-1648.012) (-1652.708) [-1647.243] -- 0:01:18
Average standard deviation of split frequencies: 0.046622
25500 -- [-1649.346] (-1647.112) (-1639.955) (-1650.531) * (-1659.607) [-1646.118] (-1644.311) (-1649.213) -- 0:01:16
26000 -- (-1656.833) [-1653.269] (-1642.424) (-1648.973) * (-1651.062) (-1646.294) (-1652.523) [-1648.841] -- 0:01:14
26500 -- (-1647.055) (-1654.474) (-1640.352) [-1649.588] * (-1655.799) (-1647.898) (-1654.145) [-1649.844] -- 0:01:13
27000 -- (-1651.863) [-1649.513] (-1642.105) (-1655.052) * [-1648.265] (-1652.362) (-1650.854) (-1653.191) -- 0:01:12
27500 -- (-1654.799) [-1648.144] (-1643.531) (-1646.233) * (-1647.379) (-1652.476) (-1654.453) [-1646.152] -- 0:01:10
28000 -- (-1648.336) (-1649.921) (-1639.368) [-1650.667] * [-1649.262] (-1654.393) (-1649.282) (-1653.637) -- 0:01:09
28500 -- (-1645.134) (-1655.095) (-1639.162) [-1646.307] * (-1643.226) (-1651.760) (-1650.569) [-1651.640] -- 0:01:08
29000 -- (-1650.930) (-1645.003) [-1643.338] (-1656.406) * (-1654.479) [-1647.653] (-1647.976) (-1660.676) -- 0:01:06
29500 -- (-1659.644) [-1646.372] (-1640.444) (-1651.852) * (-1646.234) (-1660.273) (-1651.675) [-1644.551] -- 0:01:05
30000 -- (-1664.315) (-1646.823) [-1642.055] (-1649.125) * (-1646.351) [-1650.904] (-1658.578) (-1649.863) -- 0:01:04
Average standard deviation of split frequencies: 0.046116
30500 -- (-1650.907) (-1647.570) (-1641.504) [-1645.560] * (-1657.635) (-1644.133) [-1646.151] (-1656.317) -- 0:01:03
31000 -- (-1647.898) (-1653.820) [-1643.685] (-1650.967) * (-1655.918) (-1649.821) (-1654.483) [-1645.792] -- 0:01:02
31500 -- (-1655.960) [-1652.113] (-1642.640) (-1650.997) * (-1651.941) (-1658.623) (-1647.528) [-1644.527] -- 0:01:01
32000 -- (-1647.430) (-1655.349) (-1639.729) [-1643.002] * (-1652.262) (-1646.407) (-1645.681) [-1648.747] -- 0:01:00
32500 -- (-1653.803) (-1650.573) [-1644.552] (-1646.931) * (-1651.247) (-1646.396) (-1643.960) [-1643.741] -- 0:00:59
33000 -- (-1647.905) [-1643.726] (-1638.491) (-1652.361) * (-1648.463) (-1651.411) (-1649.292) [-1651.765] -- 0:00:58
33500 -- (-1656.627) (-1651.358) [-1639.839] (-1645.929) * [-1642.785] (-1651.212) (-1653.759) (-1649.359) -- 0:00:57
34000 -- (-1648.862) (-1651.038) [-1639.860] (-1645.390) * (-1653.068) (-1648.026) (-1650.568) [-1651.085] -- 0:00:56
34500 -- (-1645.715) [-1646.738] (-1639.034) (-1650.110) * (-1648.254) [-1646.183] (-1654.922) (-1654.625) -- 0:00:55
35000 -- (-1654.011) (-1650.054) [-1638.940] (-1645.951) * (-1646.135) (-1649.575) (-1649.246) [-1641.917] -- 0:00:55
Average standard deviation of split frequencies: 0.041069
35500 -- [-1651.352] (-1652.094) (-1639.512) (-1650.488) * (-1649.087) (-1650.965) (-1652.535) [-1649.082] -- 0:00:54
36000 -- (-1650.366) (-1653.632) [-1642.123] (-1649.509) * (-1655.762) (-1645.222) (-1648.480) [-1644.557] -- 0:01:20
36500 -- [-1646.157] (-1651.417) (-1639.577) (-1643.407) * (-1646.008) (-1648.075) (-1645.442) [-1648.283] -- 0:01:19
37000 -- (-1646.130) [-1649.928] (-1640.166) (-1644.087) * (-1651.084) (-1645.735) (-1646.154) [-1649.903] -- 0:01:18
37500 -- (-1651.700) (-1654.556) [-1638.996] (-1642.106) * (-1649.945) [-1645.883] (-1653.106) (-1652.841) -- 0:01:17
38000 -- (-1649.144) [-1651.631] (-1638.594) (-1644.249) * [-1645.572] (-1651.999) (-1643.556) (-1660.360) -- 0:01:15
38500 -- [-1645.340] (-1653.060) (-1638.925) (-1641.902) * [-1648.470] (-1648.720) (-1644.434) (-1650.428) -- 0:01:14
39000 -- (-1646.784) (-1655.214) [-1640.363] (-1642.046) * (-1649.187) (-1644.247) [-1646.654] (-1644.496) -- 0:01:13
39500 -- (-1646.325) (-1650.386) [-1638.534] (-1644.641) * (-1653.647) (-1649.135) [-1646.977] (-1644.940) -- 0:01:12
40000 -- (-1654.531) (-1645.450) [-1638.974] (-1639.860) * (-1653.747) (-1658.382) [-1644.701] (-1651.118) -- 0:01:12
Average standard deviation of split frequencies: 0.035830
40500 -- [-1649.359] (-1644.958) (-1641.422) (-1640.812) * (-1645.436) [-1654.741] (-1645.319) (-1653.102) -- 0:01:11
41000 -- (-1648.929) [-1641.527] (-1639.039) (-1639.712) * (-1649.937) (-1652.013) [-1651.145] (-1646.046) -- 0:01:10
41500 -- (-1646.605) [-1640.232] (-1639.479) (-1639.127) * (-1645.029) (-1645.170) (-1651.066) [-1645.031] -- 0:01:09
42000 -- (-1655.518) [-1638.534] (-1639.135) (-1638.163) * [-1650.199] (-1644.624) (-1647.822) (-1648.445) -- 0:01:08
42500 -- (-1659.674) [-1638.944] (-1638.897) (-1638.609) * (-1645.364) [-1646.627] (-1655.038) (-1651.790) -- 0:01:07
43000 -- (-1655.315) [-1643.137] (-1640.083) (-1640.590) * (-1651.191) (-1650.474) [-1647.303] (-1645.419) -- 0:01:06
43500 -- (-1646.408) [-1640.201] (-1639.333) (-1640.126) * [-1648.354] (-1655.093) (-1656.286) (-1657.018) -- 0:01:05
44000 -- (-1644.377) (-1639.006) (-1641.012) [-1639.966] * [-1650.458] (-1652.153) (-1656.308) (-1649.392) -- 0:01:05
44500 -- (-1646.088) (-1641.006) (-1649.911) [-1638.493] * (-1644.647) [-1648.424] (-1646.108) (-1645.367) -- 0:01:04
45000 -- (-1648.396) (-1641.121) [-1645.248] (-1640.359) * [-1639.305] (-1651.980) (-1651.684) (-1645.649) -- 0:01:03
Average standard deviation of split frequencies: 0.037731
45500 -- (-1649.869) [-1639.256] (-1642.169) (-1639.815) * (-1641.337) [-1652.052] (-1652.948) (-1648.183) -- 0:01:02
46000 -- (-1643.654) [-1639.148] (-1642.688) (-1640.253) * (-1639.721) (-1653.334) (-1651.064) [-1642.958] -- 0:01:02
46500 -- (-1646.357) (-1646.232) (-1647.005) [-1639.009] * (-1641.870) (-1651.840) (-1651.791) [-1649.207] -- 0:01:01
47000 -- (-1649.008) (-1639.959) (-1644.646) [-1639.818] * [-1639.358] (-1652.131) (-1658.388) (-1649.594) -- 0:01:00
47500 -- (-1665.872) (-1640.577) (-1641.041) [-1639.569] * (-1639.886) (-1663.339) [-1650.906] (-1651.398) -- 0:01:00
48000 -- (-1640.187) (-1640.156) [-1642.240] (-1640.879) * (-1639.943) (-1654.063) [-1651.694] (-1648.992) -- 0:00:59
48500 -- [-1642.423] (-1638.922) (-1644.196) (-1639.480) * (-1639.560) (-1662.212) (-1655.763) [-1652.470] -- 0:00:58
49000 -- (-1642.395) (-1638.038) (-1643.439) [-1639.868] * (-1643.018) (-1639.373) [-1653.016] (-1646.326) -- 0:00:58
49500 -- (-1644.501) (-1638.033) [-1641.593] (-1640.173) * (-1641.003) (-1639.608) (-1644.011) [-1650.785] -- 0:01:16
50000 -- (-1641.278) (-1638.460) (-1639.965) [-1639.410] * [-1640.303] (-1643.130) (-1654.515) (-1649.326) -- 0:01:16
Average standard deviation of split frequencies: 0.031148
50500 -- (-1639.745) [-1638.470] (-1641.865) (-1641.494) * (-1642.465) [-1640.095] (-1648.966) (-1651.850) -- 0:01:15
51000 -- (-1641.208) [-1638.589] (-1646.123) (-1639.216) * (-1640.757) [-1639.843] (-1654.925) (-1642.311) -- 0:01:14
51500 -- (-1643.639) (-1638.800) (-1648.868) [-1639.214] * (-1643.164) (-1640.685) [-1651.997] (-1647.320) -- 0:01:13
52000 -- (-1642.866) (-1640.958) (-1644.087) [-1639.040] * [-1639.068] (-1644.752) (-1648.523) (-1650.350) -- 0:01:12
52500 -- (-1641.150) [-1639.902] (-1647.334) (-1641.018) * (-1638.233) (-1642.180) (-1661.509) [-1651.700] -- 0:01:12
53000 -- [-1641.594] (-1639.619) (-1642.564) (-1638.928) * [-1638.229] (-1639.943) (-1649.183) (-1650.015) -- 0:01:11
53500 -- (-1642.133) (-1638.466) (-1642.042) [-1638.663] * [-1638.235] (-1639.920) (-1653.868) (-1646.206) -- 0:01:10
54000 -- (-1642.515) (-1638.429) (-1643.032) [-1638.664] * [-1641.199] (-1639.421) (-1648.575) (-1649.570) -- 0:01:10
54500 -- [-1640.286] (-1638.352) (-1641.217) (-1641.314) * (-1639.347) [-1640.518] (-1649.078) (-1656.043) -- 0:01:09
55000 -- (-1642.417) [-1638.348] (-1642.060) (-1638.266) * [-1639.687] (-1640.707) (-1656.099) (-1652.089) -- 0:01:08
Average standard deviation of split frequencies: 0.030064
55500 -- (-1639.921) [-1639.946] (-1640.541) (-1640.574) * (-1641.647) (-1639.718) [-1654.067] (-1649.902) -- 0:01:08
56000 -- (-1641.246) [-1641.622] (-1640.415) (-1641.668) * (-1645.379) (-1639.526) [-1650.392] (-1648.569) -- 0:01:07
56500 -- (-1641.874) [-1639.807] (-1643.239) (-1639.298) * (-1641.908) (-1643.110) [-1648.157] (-1650.425) -- 0:01:06
57000 -- (-1644.195) (-1639.497) [-1647.600] (-1638.297) * (-1641.118) (-1641.079) (-1640.515) [-1645.077] -- 0:01:06
57500 -- [-1643.370] (-1640.243) (-1646.251) (-1638.985) * (-1642.187) (-1640.246) [-1640.593] (-1647.927) -- 0:01:05
58000 -- (-1641.150) [-1640.189] (-1639.865) (-1641.156) * (-1641.622) (-1640.839) [-1639.709] (-1647.646) -- 0:01:04
58500 -- (-1642.521) [-1640.822] (-1639.521) (-1642.216) * (-1641.554) [-1640.735] (-1641.524) (-1646.283) -- 0:01:04
59000 -- (-1641.609) [-1639.910] (-1640.478) (-1640.888) * (-1640.923) (-1646.165) (-1640.089) [-1645.321] -- 0:01:03
59500 -- (-1640.024) (-1639.827) [-1638.910] (-1641.589) * (-1640.268) (-1642.338) (-1640.033) [-1652.285] -- 0:01:03
60000 -- (-1639.808) (-1639.827) [-1639.281] (-1640.697) * (-1644.656) [-1639.516] (-1640.441) (-1645.077) -- 0:01:02
Average standard deviation of split frequencies: 0.032247
60500 -- (-1639.966) (-1639.498) [-1639.466] (-1639.102) * (-1639.757) [-1639.014] (-1641.866) (-1648.514) -- 0:01:02
61000 -- (-1640.967) (-1640.709) (-1640.552) [-1639.752] * (-1639.003) (-1640.003) (-1639.786) [-1646.649] -- 0:01:01
61500 -- (-1640.441) (-1641.517) (-1646.358) [-1639.981] * (-1643.115) (-1638.433) (-1639.046) [-1651.971] -- 0:01:01
62000 -- [-1638.940] (-1641.219) (-1640.376) (-1639.914) * [-1641.120] (-1640.404) (-1641.144) (-1648.752) -- 0:01:00
62500 -- (-1638.640) (-1639.458) (-1640.087) [-1640.200] * [-1640.029] (-1640.551) (-1638.762) (-1644.030) -- 0:01:15
63000 -- [-1638.153] (-1639.441) (-1640.192) (-1640.382) * [-1640.292] (-1639.515) (-1639.605) (-1647.402) -- 0:01:14
63500 -- (-1640.165) (-1640.582) (-1644.164) [-1639.931] * (-1638.930) (-1639.610) [-1639.605] (-1654.645) -- 0:01:13
64000 -- (-1638.896) [-1641.746] (-1639.345) (-1640.530) * (-1639.214) [-1639.658] (-1640.178) (-1644.345) -- 0:01:13
64500 -- [-1638.875] (-1642.178) (-1640.876) (-1638.940) * [-1639.232] (-1640.712) (-1640.492) (-1656.151) -- 0:01:12
65000 -- (-1638.106) (-1642.596) [-1640.282] (-1639.315) * [-1639.838] (-1640.085) (-1640.426) (-1655.912) -- 0:01:11
Average standard deviation of split frequencies: 0.032651
65500 -- (-1639.626) (-1639.989) (-1644.119) [-1640.518] * (-1638.916) [-1640.309] (-1639.283) (-1652.994) -- 0:01:11
66000 -- (-1640.844) [-1639.722] (-1643.354) (-1642.223) * (-1638.217) [-1639.229] (-1640.526) (-1656.029) -- 0:01:10
66500 -- [-1640.548] (-1642.331) (-1639.795) (-1640.523) * (-1639.012) (-1638.730) (-1638.455) [-1650.078] -- 0:01:10
67000 -- (-1641.758) (-1643.039) (-1638.553) [-1639.964] * (-1639.414) (-1638.096) (-1640.095) [-1648.566] -- 0:01:09
67500 -- [-1640.882] (-1638.379) (-1641.192) (-1639.608) * (-1638.587) (-1641.171) [-1640.874] (-1650.344) -- 0:01:09
68000 -- [-1640.946] (-1639.652) (-1638.416) (-1642.527) * (-1639.780) (-1639.587) (-1641.633) [-1643.975] -- 0:01:08
68500 -- (-1641.568) (-1643.568) [-1638.504] (-1643.110) * (-1638.609) (-1641.637) (-1639.679) [-1653.954] -- 0:01:07
69000 -- (-1639.897) [-1639.179] (-1641.539) (-1640.566) * [-1640.523] (-1638.915) (-1639.490) (-1649.874) -- 0:01:07
69500 -- [-1639.196] (-1638.614) (-1640.385) (-1640.412) * [-1639.771] (-1640.329) (-1643.106) (-1653.153) -- 0:01:06
70000 -- (-1639.637) (-1642.259) [-1638.552] (-1640.412) * [-1641.014] (-1640.421) (-1644.541) (-1651.941) -- 0:01:06
Average standard deviation of split frequencies: 0.029018
70500 -- (-1638.818) (-1642.045) [-1638.876] (-1641.118) * [-1640.117] (-1640.034) (-1639.437) (-1657.296) -- 0:01:05
71000 -- [-1638.605] (-1640.737) (-1638.875) (-1643.404) * (-1639.902) [-1639.567] (-1639.625) (-1650.800) -- 0:01:05
71500 -- (-1638.724) [-1639.373] (-1639.212) (-1646.044) * (-1639.431) (-1641.671) (-1640.125) [-1648.077] -- 0:01:04
72000 -- [-1639.819] (-1639.825) (-1638.952) (-1640.292) * [-1639.428] (-1640.769) (-1640.912) (-1646.545) -- 0:01:04
72500 -- (-1639.131) (-1643.764) [-1641.115] (-1640.424) * [-1642.016] (-1640.257) (-1639.546) (-1649.973) -- 0:01:03
73000 -- (-1639.580) [-1645.367] (-1643.132) (-1640.202) * (-1640.472) [-1643.255] (-1639.978) (-1652.670) -- 0:01:03
73500 -- (-1641.426) (-1644.117) (-1641.522) [-1638.588] * (-1640.660) (-1641.409) [-1639.985] (-1652.223) -- 0:01:03
74000 -- (-1640.624) (-1641.873) [-1639.708] (-1640.681) * (-1640.194) [-1643.302] (-1640.565) (-1656.754) -- 0:01:02
74500 -- (-1639.641) (-1639.066) (-1642.234) [-1640.530] * (-1639.844) (-1644.711) [-1640.199] (-1650.889) -- 0:01:02
75000 -- (-1643.968) (-1638.811) (-1640.372) [-1640.560] * [-1640.211] (-1649.958) (-1640.180) (-1651.812) -- 0:01:01
Average standard deviation of split frequencies: 0.030687
75500 -- (-1645.395) (-1641.437) (-1642.382) [-1640.507] * (-1641.408) (-1650.454) (-1641.071) [-1646.429] -- 0:01:01
76000 -- [-1637.999] (-1639.736) (-1642.267) (-1641.415) * (-1646.276) [-1644.661] (-1639.936) (-1648.204) -- 0:01:12
76500 -- [-1639.379] (-1639.191) (-1641.074) (-1640.277) * (-1644.219) (-1643.773) [-1639.818] (-1651.551) -- 0:01:12
77000 -- [-1638.432] (-1638.893) (-1641.824) (-1639.617) * (-1639.511) [-1642.498] (-1639.281) (-1660.861) -- 0:01:11
77500 -- (-1638.615) (-1638.488) (-1640.918) [-1640.607] * (-1643.744) (-1641.004) (-1639.800) [-1646.262] -- 0:01:11
78000 -- (-1640.367) (-1640.710) (-1640.118) [-1645.496] * (-1641.619) (-1641.473) [-1640.626] (-1648.229) -- 0:01:10
78500 -- (-1640.824) [-1642.303] (-1638.924) (-1638.985) * [-1638.738] (-1641.343) (-1638.691) (-1640.569) -- 0:01:10
79000 -- (-1640.164) [-1641.474] (-1640.338) (-1639.885) * (-1640.569) [-1641.118] (-1640.954) (-1639.748) -- 0:01:09
79500 -- (-1640.095) [-1639.471] (-1639.026) (-1640.656) * (-1639.099) (-1644.061) (-1638.749) [-1641.572] -- 0:01:09
80000 -- (-1641.359) (-1639.779) [-1638.496] (-1639.349) * (-1639.109) (-1647.133) (-1638.597) [-1640.261] -- 0:01:09
Average standard deviation of split frequencies: 0.028895
80500 -- [-1641.606] (-1640.089) (-1639.791) (-1638.933) * (-1639.772) (-1646.013) [-1638.300] (-1640.262) -- 0:01:08
81000 -- [-1639.927] (-1640.237) (-1643.367) (-1639.583) * (-1639.041) (-1643.036) [-1640.220] (-1638.901) -- 0:01:08
81500 -- (-1642.455) (-1642.921) (-1639.803) [-1639.766] * (-1639.606) (-1641.622) (-1639.001) [-1640.144] -- 0:01:07
82000 -- (-1642.179) (-1642.150) [-1638.466] (-1640.658) * (-1639.066) (-1641.648) [-1639.536] (-1639.734) -- 0:01:07
82500 -- (-1644.462) [-1642.180] (-1642.797) (-1643.492) * (-1639.020) (-1642.159) [-1638.628] (-1638.600) -- 0:01:06
83000 -- [-1642.701] (-1639.494) (-1639.640) (-1642.119) * (-1638.850) (-1641.020) [-1638.690] (-1638.421) -- 0:01:06
83500 -- (-1639.947) (-1638.504) [-1639.363] (-1640.177) * (-1640.763) [-1640.241] (-1638.255) (-1638.817) -- 0:01:05
84000 -- (-1643.346) (-1639.364) [-1638.470] (-1639.230) * (-1645.946) (-1640.445) (-1638.679) [-1638.575] -- 0:01:05
84500 -- (-1642.425) (-1639.943) [-1638.376] (-1643.077) * [-1639.586] (-1640.910) (-1639.813) (-1645.199) -- 0:01:05
85000 -- (-1640.682) (-1639.803) (-1639.968) [-1643.997] * [-1641.642] (-1644.800) (-1638.255) (-1640.545) -- 0:01:04
Average standard deviation of split frequencies: 0.028273
85500 -- (-1638.957) [-1639.077] (-1642.696) (-1640.309) * (-1645.123) (-1643.912) (-1639.360) [-1640.504] -- 0:01:04
86000 -- (-1639.035) (-1638.590) [-1641.762] (-1643.729) * [-1641.066] (-1641.179) (-1642.202) (-1639.282) -- 0:01:03
86500 -- [-1639.679] (-1638.558) (-1642.172) (-1642.085) * (-1640.309) (-1640.853) [-1638.503] (-1640.735) -- 0:01:03
87000 -- (-1640.605) (-1638.556) [-1639.111] (-1640.383) * (-1642.980) [-1640.075] (-1640.038) (-1639.623) -- 0:01:02
87500 -- (-1643.538) [-1638.506] (-1640.021) (-1639.990) * (-1642.099) (-1640.903) [-1638.519] (-1638.902) -- 0:01:02
88000 -- (-1640.140) (-1638.783) [-1639.427] (-1639.681) * [-1643.594] (-1639.827) (-1638.311) (-1638.915) -- 0:01:02
88500 -- [-1638.607] (-1642.179) (-1638.543) (-1641.204) * (-1639.451) (-1640.116) [-1640.166] (-1638.487) -- 0:01:01
89000 -- (-1638.129) [-1644.615] (-1639.606) (-1639.146) * [-1643.209] (-1641.313) (-1640.941) (-1643.040) -- 0:01:01
89500 -- (-1641.105) (-1642.996) [-1639.314] (-1639.138) * (-1639.118) [-1640.521] (-1639.652) (-1643.751) -- 0:01:01
90000 -- (-1638.557) (-1639.592) (-1639.709) [-1640.894] * (-1638.315) (-1639.817) [-1641.601] (-1644.797) -- 0:01:10
Average standard deviation of split frequencies: 0.022713
90500 -- [-1638.703] (-1639.572) (-1640.104) (-1640.381) * [-1638.348] (-1640.295) (-1643.291) (-1641.617) -- 0:01:10
91000 -- [-1638.710] (-1640.240) (-1638.418) (-1640.861) * (-1638.630) (-1639.706) [-1641.351] (-1642.275) -- 0:01:09
91500 -- (-1643.532) (-1643.993) (-1638.895) [-1640.792] * (-1639.257) (-1641.410) [-1640.182] (-1641.662) -- 0:01:09
92000 -- (-1645.152) (-1639.380) (-1638.895) [-1640.229] * (-1639.732) [-1641.410] (-1639.702) (-1640.780) -- 0:01:09
92500 -- (-1641.098) (-1642.705) (-1639.403) [-1640.402] * (-1640.996) (-1641.185) (-1641.771) [-1643.349] -- 0:01:08
93000 -- (-1641.488) (-1640.093) (-1640.072) [-1640.832] * (-1639.453) [-1641.021] (-1642.137) (-1647.151) -- 0:01:08
93500 -- [-1639.051] (-1639.194) (-1640.737) (-1639.556) * (-1642.116) [-1639.804] (-1640.583) (-1641.114) -- 0:01:07
94000 -- [-1641.263] (-1639.219) (-1641.194) (-1644.586) * (-1638.963) (-1640.301) [-1640.785] (-1642.133) -- 0:01:07
94500 -- [-1640.059] (-1639.231) (-1640.101) (-1639.709) * [-1639.403] (-1640.494) (-1639.715) (-1643.154) -- 0:01:07
95000 -- (-1639.925) (-1640.756) [-1640.212] (-1640.986) * (-1639.113) [-1638.955] (-1639.235) (-1643.771) -- 0:01:06
Average standard deviation of split frequencies: 0.022097
95500 -- (-1639.586) (-1639.282) [-1640.239] (-1639.355) * (-1639.179) (-1638.191) [-1639.560] (-1641.866) -- 0:01:06
96000 -- [-1638.531] (-1640.653) (-1640.423) (-1639.577) * (-1638.195) (-1639.017) [-1639.045] (-1644.868) -- 0:01:05
96500 -- [-1639.203] (-1643.841) (-1639.665) (-1641.144) * (-1639.859) (-1641.170) [-1639.226] (-1639.777) -- 0:01:05
97000 -- [-1639.124] (-1640.828) (-1639.548) (-1640.521) * [-1641.060] (-1642.719) (-1639.355) (-1639.264) -- 0:01:05
97500 -- (-1641.061) (-1646.516) [-1638.968] (-1639.974) * (-1641.219) (-1641.807) [-1640.532] (-1639.992) -- 0:01:04
98000 -- [-1639.302] (-1642.321) (-1641.691) (-1642.395) * (-1641.029) [-1641.820] (-1640.674) (-1640.051) -- 0:01:04
98500 -- (-1639.376) (-1642.545) (-1639.371) [-1640.517] * (-1640.517) (-1640.611) (-1640.439) [-1640.726] -- 0:01:04
99000 -- (-1639.843) (-1639.578) [-1639.993] (-1641.644) * (-1639.073) (-1645.718) [-1641.774] (-1640.727) -- 0:01:03
99500 -- [-1641.258] (-1639.870) (-1640.223) (-1641.323) * [-1639.314] (-1643.627) (-1639.670) (-1640.060) -- 0:01:03
100000 -- (-1638.675) (-1643.132) [-1639.826] (-1643.310) * [-1639.822] (-1644.705) (-1639.004) (-1639.401) -- 0:01:02
Average standard deviation of split frequencies: 0.020032
100500 -- [-1640.001] (-1641.338) (-1639.861) (-1643.649) * (-1641.811) (-1639.226) (-1639.193) [-1639.973] -- 0:01:02
101000 -- (-1641.870) (-1644.771) [-1638.996] (-1640.344) * (-1641.626) (-1639.316) (-1640.135) [-1640.448] -- 0:01:02
101500 -- (-1640.185) [-1643.990] (-1639.555) (-1639.100) * (-1640.448) (-1639.168) [-1642.375] (-1639.562) -- 0:01:01
102000 -- (-1647.181) (-1641.860) [-1640.579] (-1641.649) * (-1639.392) [-1641.334] (-1643.451) (-1639.538) -- 0:01:01
102500 -- (-1646.708) (-1642.101) (-1639.434) [-1639.772] * (-1640.120) (-1641.436) (-1641.657) [-1639.063] -- 0:01:01
103000 -- (-1642.362) (-1640.664) [-1639.353] (-1639.177) * (-1640.104) (-1641.854) (-1641.765) [-1639.309] -- 0:01:09
103500 -- (-1645.154) (-1642.756) (-1640.825) [-1640.267] * (-1640.419) (-1641.029) (-1642.637) [-1640.172] -- 0:01:09
104000 -- [-1640.541] (-1641.454) (-1642.019) (-1639.224) * (-1640.525) [-1638.975] (-1642.239) (-1639.634) -- 0:01:08
104500 -- [-1639.907] (-1641.133) (-1641.095) (-1639.261) * (-1639.903) [-1639.631] (-1643.010) (-1641.435) -- 0:01:08
105000 -- (-1640.187) [-1640.336] (-1642.828) (-1638.671) * (-1641.891) [-1639.191] (-1642.044) (-1642.695) -- 0:01:08
Average standard deviation of split frequencies: 0.020235
105500 -- (-1642.574) (-1641.115) (-1639.994) [-1639.158] * (-1643.243) [-1639.693] (-1640.918) (-1640.612) -- 0:01:07
106000 -- [-1639.417] (-1642.109) (-1640.545) (-1640.533) * (-1641.966) (-1641.238) [-1642.719] (-1640.424) -- 0:01:07
106500 -- [-1638.344] (-1640.710) (-1644.504) (-1641.408) * (-1643.418) (-1641.247) [-1641.864] (-1640.630) -- 0:01:07
107000 -- [-1638.703] (-1639.363) (-1639.241) (-1639.868) * (-1641.320) (-1643.661) (-1641.071) [-1640.672] -- 0:01:06
107500 -- (-1639.291) [-1640.032] (-1640.433) (-1638.615) * [-1639.177] (-1643.051) (-1639.494) (-1639.755) -- 0:01:06
108000 -- (-1639.385) [-1639.203] (-1640.541) (-1641.599) * (-1642.535) (-1644.151) [-1642.278] (-1638.856) -- 0:01:06
108500 -- [-1639.547] (-1639.775) (-1642.091) (-1641.239) * (-1642.183) (-1639.280) (-1641.794) [-1640.202] -- 0:01:05
109000 -- (-1641.839) (-1643.046) (-1644.349) [-1640.158] * (-1639.462) (-1639.745) (-1639.810) [-1640.445] -- 0:01:05
109500 -- (-1641.728) (-1642.586) (-1644.695) [-1642.246] * (-1647.071) (-1639.671) (-1640.019) [-1642.026] -- 0:01:05
110000 -- (-1642.206) (-1641.070) (-1645.558) [-1638.049] * (-1647.906) (-1640.533) (-1642.854) [-1638.274] -- 0:01:04
Average standard deviation of split frequencies: 0.019729
110500 -- (-1641.383) [-1639.801] (-1642.723) (-1639.121) * [-1642.938] (-1644.030) (-1639.666) (-1640.970) -- 0:01:04
111000 -- (-1642.536) [-1639.451] (-1644.675) (-1639.862) * (-1639.909) (-1643.521) (-1641.892) [-1638.184] -- 0:01:04
111500 -- (-1641.653) (-1639.652) (-1642.708) [-1639.247] * (-1643.765) (-1641.306) (-1640.265) [-1638.162] -- 0:01:03
112000 -- (-1641.654) (-1641.362) (-1639.378) [-1639.483] * (-1642.995) (-1642.766) [-1640.048] (-1638.475) -- 0:01:03
112500 -- (-1639.479) (-1642.345) [-1640.781] (-1639.583) * (-1641.190) [-1646.654] (-1640.311) (-1639.858) -- 0:01:03
113000 -- [-1641.149] (-1640.946) (-1639.231) (-1642.086) * [-1642.247] (-1647.097) (-1640.060) (-1639.961) -- 0:01:02
113500 -- (-1643.397) (-1638.799) [-1639.395] (-1639.383) * [-1640.652] (-1642.351) (-1639.720) (-1645.910) -- 0:01:02
114000 -- (-1642.985) (-1641.601) [-1638.337] (-1639.622) * (-1639.502) (-1641.167) (-1641.926) [-1644.199] -- 0:01:02
114500 -- [-1641.459] (-1640.527) (-1638.457) (-1639.931) * (-1642.462) [-1640.427] (-1639.602) (-1646.116) -- 0:01:01
115000 -- (-1640.551) (-1640.382) [-1639.232] (-1639.580) * [-1639.145] (-1645.217) (-1641.502) (-1642.154) -- 0:01:01
Average standard deviation of split frequencies: 0.017111
115500 -- (-1638.376) [-1638.386] (-1638.576) (-1639.671) * (-1639.904) (-1639.891) [-1639.778] (-1643.571) -- 0:01:01
116000 -- (-1638.642) [-1639.135] (-1642.564) (-1642.088) * [-1640.018] (-1640.400) (-1640.802) (-1642.499) -- 0:01:00
116500 -- [-1639.480] (-1642.164) (-1641.854) (-1640.911) * [-1641.713] (-1640.254) (-1639.754) (-1640.080) -- 0:01:08
117000 -- [-1639.347] (-1642.605) (-1641.135) (-1639.509) * (-1640.529) [-1639.759] (-1639.603) (-1639.862) -- 0:01:07
117500 -- [-1640.127] (-1639.414) (-1642.290) (-1640.790) * (-1642.056) [-1638.113] (-1639.466) (-1638.678) -- 0:01:07
118000 -- [-1639.283] (-1639.005) (-1640.018) (-1641.638) * (-1641.575) [-1640.773] (-1641.410) (-1639.129) -- 0:01:07
118500 -- (-1641.268) (-1641.963) (-1639.136) [-1642.896] * [-1640.028] (-1641.777) (-1641.733) (-1640.255) -- 0:01:06
119000 -- (-1640.805) (-1642.659) [-1638.895] (-1641.639) * [-1640.057] (-1640.577) (-1641.270) (-1639.346) -- 0:01:06
119500 -- (-1642.663) [-1639.924] (-1641.762) (-1638.087) * (-1641.888) (-1640.028) [-1641.543] (-1639.249) -- 0:01:06
120000 -- (-1644.524) (-1639.989) (-1642.834) [-1638.148] * (-1644.267) [-1638.271] (-1639.988) (-1640.197) -- 0:01:06
Average standard deviation of split frequencies: 0.019074
120500 -- (-1643.112) (-1641.543) (-1640.977) [-1638.610] * (-1642.006) [-1638.440] (-1640.018) (-1640.510) -- 0:01:05
121000 -- (-1640.658) [-1639.171] (-1640.990) (-1639.261) * (-1642.551) (-1639.022) [-1640.605] (-1641.119) -- 0:01:05
121500 -- (-1641.838) (-1640.413) (-1639.196) [-1639.525] * (-1643.540) (-1640.438) (-1639.518) [-1642.747] -- 0:01:05
122000 -- (-1642.099) [-1641.111] (-1639.924) (-1641.494) * (-1639.189) (-1638.529) (-1639.537) [-1639.676] -- 0:01:04
122500 -- [-1643.309] (-1639.968) (-1641.997) (-1639.839) * [-1638.955] (-1638.559) (-1641.204) (-1640.928) -- 0:01:04
123000 -- (-1641.663) [-1639.000] (-1638.866) (-1644.073) * (-1641.049) (-1640.657) (-1641.805) [-1639.275] -- 0:01:04
123500 -- (-1642.182) [-1641.233] (-1642.545) (-1641.473) * (-1639.015) (-1640.092) (-1638.293) [-1639.311] -- 0:01:03
124000 -- [-1641.463] (-1638.390) (-1644.267) (-1639.959) * (-1638.994) (-1643.525) [-1638.862] (-1639.487) -- 0:01:03
124500 -- (-1643.912) (-1644.726) [-1641.580] (-1639.962) * (-1642.764) (-1642.194) [-1640.240] (-1639.442) -- 0:01:03
125000 -- (-1645.401) (-1647.585) (-1642.701) [-1639.473] * (-1643.891) [-1640.994] (-1639.204) (-1638.974) -- 0:01:03
Average standard deviation of split frequencies: 0.017131
125500 -- (-1645.532) [-1640.512] (-1640.478) (-1643.511) * (-1644.918) [-1641.695] (-1640.606) (-1638.372) -- 0:01:02
126000 -- (-1641.508) (-1638.735) (-1639.527) [-1641.960] * (-1642.733) (-1642.656) (-1642.434) [-1641.016] -- 0:01:02
126500 -- (-1643.093) [-1641.235] (-1641.925) (-1639.886) * [-1641.599] (-1639.854) (-1643.299) (-1640.198) -- 0:01:02
127000 -- (-1643.338) [-1643.571] (-1643.497) (-1641.284) * [-1645.103] (-1640.637) (-1641.652) (-1641.742) -- 0:01:01
127500 -- [-1640.811] (-1640.556) (-1640.206) (-1644.585) * (-1644.715) (-1640.447) (-1641.198) [-1640.882] -- 0:01:01
128000 -- (-1642.756) (-1645.040) [-1641.500] (-1638.739) * (-1641.848) (-1639.212) (-1640.573) [-1638.157] -- 0:01:01
128500 -- (-1641.634) (-1643.928) (-1639.866) [-1639.454] * (-1642.645) [-1639.212] (-1643.425) (-1644.357) -- 0:01:01
129000 -- (-1638.087) (-1639.656) [-1640.037] (-1639.905) * [-1641.796] (-1639.734) (-1641.853) (-1643.395) -- 0:01:00
129500 -- (-1642.038) (-1640.125) (-1640.437) [-1638.628] * (-1641.999) (-1638.518) (-1643.228) [-1639.576] -- 0:01:00
130000 -- [-1638.282] (-1640.161) (-1640.482) (-1643.617) * (-1642.199) (-1638.392) (-1643.123) [-1640.403] -- 0:01:06
Average standard deviation of split frequencies: 0.015380
130500 -- [-1639.217] (-1640.294) (-1642.842) (-1638.984) * (-1640.238) (-1639.343) [-1641.282] (-1639.656) -- 0:01:06
131000 -- [-1638.236] (-1642.572) (-1642.445) (-1640.885) * (-1641.036) [-1638.626] (-1639.183) (-1647.528) -- 0:01:06
131500 -- [-1638.928] (-1640.758) (-1640.311) (-1638.387) * (-1644.036) (-1638.228) (-1640.070) [-1639.411] -- 0:01:06
132000 -- (-1638.702) (-1643.225) (-1640.347) [-1639.076] * (-1640.308) [-1638.661] (-1640.211) (-1639.388) -- 0:01:05
132500 -- (-1638.719) [-1638.869] (-1641.613) (-1639.233) * [-1640.970] (-1638.322) (-1638.291) (-1639.406) -- 0:01:05
133000 -- (-1638.158) [-1639.287] (-1641.387) (-1638.166) * [-1638.573] (-1638.318) (-1638.749) (-1641.277) -- 0:01:05
133500 -- (-1638.175) [-1639.364] (-1643.723) (-1638.058) * (-1640.667) [-1643.874] (-1642.006) (-1640.360) -- 0:01:04
134000 -- [-1639.335] (-1640.253) (-1641.584) (-1638.333) * (-1639.138) (-1643.341) (-1640.101) [-1638.243] -- 0:01:04
134500 -- (-1638.411) [-1640.612] (-1641.762) (-1638.170) * (-1639.695) [-1639.855] (-1640.614) (-1638.243) -- 0:01:04
135000 -- (-1639.113) (-1639.648) (-1641.700) [-1640.225] * [-1638.675] (-1647.189) (-1639.939) (-1638.654) -- 0:01:04
Average standard deviation of split frequencies: 0.013865
135500 -- (-1639.063) [-1644.036] (-1640.024) (-1640.246) * [-1638.673] (-1640.907) (-1639.394) (-1638.611) -- 0:01:03
136000 -- (-1638.671) (-1641.013) [-1638.878] (-1641.520) * [-1638.616] (-1642.341) (-1642.785) (-1643.630) -- 0:01:03
136500 -- (-1639.031) (-1641.856) [-1639.689] (-1641.648) * [-1638.847] (-1639.766) (-1640.669) (-1644.694) -- 0:01:03
137000 -- (-1639.045) (-1641.995) [-1639.968] (-1643.326) * (-1639.633) (-1639.381) (-1639.929) [-1641.418] -- 0:01:02
137500 -- (-1642.606) [-1643.763] (-1640.818) (-1642.247) * (-1639.863) (-1640.357) [-1640.541] (-1639.256) -- 0:01:02
138000 -- (-1639.122) (-1643.354) [-1639.824] (-1643.559) * [-1641.923] (-1639.326) (-1639.307) (-1639.256) -- 0:01:02
138500 -- (-1642.920) (-1643.620) (-1638.914) [-1640.016] * (-1638.588) [-1638.995] (-1638.815) (-1638.304) -- 0:01:02
139000 -- (-1643.034) (-1640.644) [-1639.119] (-1640.616) * [-1638.588] (-1638.994) (-1639.361) (-1638.700) -- 0:01:01
139500 -- (-1646.369) (-1640.679) [-1639.108] (-1643.847) * (-1639.347) (-1639.692) (-1638.493) [-1640.754] -- 0:01:01
140000 -- (-1642.301) (-1640.307) [-1640.570] (-1644.722) * [-1639.777] (-1638.955) (-1642.276) (-1639.192) -- 0:01:01
Average standard deviation of split frequencies: 0.013219
140500 -- (-1640.684) (-1641.378) [-1638.864] (-1646.336) * (-1640.680) (-1638.807) [-1641.674] (-1639.849) -- 0:01:01
141000 -- [-1640.632] (-1638.757) (-1638.711) (-1642.947) * (-1639.085) [-1638.483] (-1642.839) (-1643.903) -- 0:01:00
141500 -- (-1641.599) (-1639.550) [-1638.860] (-1641.799) * (-1639.090) (-1639.997) (-1639.808) [-1639.179] -- 0:01:00
142000 -- (-1642.096) (-1638.879) [-1638.891] (-1640.023) * (-1639.137) (-1638.894) (-1640.885) [-1638.946] -- 0:01:00
142500 -- (-1641.571) (-1638.562) [-1641.767] (-1639.908) * [-1640.998] (-1640.386) (-1643.762) (-1639.213) -- 0:01:00
143000 -- (-1639.883) (-1639.644) [-1638.398] (-1639.847) * (-1639.681) (-1639.210) (-1641.901) [-1639.237] -- 0:00:59
143500 -- (-1640.033) (-1639.445) [-1638.863] (-1639.847) * (-1638.563) (-1641.196) (-1640.077) [-1639.430] -- 0:00:59
144000 -- [-1641.818] (-1639.821) (-1639.634) (-1639.594) * (-1638.869) [-1639.565] (-1639.357) (-1641.662) -- 0:01:05
144500 -- [-1641.099] (-1638.196) (-1639.522) (-1639.464) * (-1639.929) [-1638.225] (-1639.357) (-1639.302) -- 0:01:05
145000 -- (-1639.926) (-1640.605) [-1639.734] (-1641.165) * (-1640.436) (-1643.319) [-1640.705] (-1640.101) -- 0:01:04
Average standard deviation of split frequencies: 0.013765
145500 -- [-1641.019] (-1639.668) (-1639.589) (-1641.030) * [-1640.013] (-1643.183) (-1643.016) (-1639.328) -- 0:01:04
146000 -- (-1642.872) (-1639.539) (-1640.633) [-1640.048] * (-1639.417) (-1639.679) (-1641.530) [-1638.835] -- 0:01:04
146500 -- [-1644.371] (-1640.317) (-1641.590) (-1638.354) * [-1639.571] (-1638.449) (-1641.503) (-1639.407) -- 0:01:04
147000 -- (-1639.130) (-1642.176) (-1640.989) [-1638.681] * (-1640.911) [-1638.541] (-1642.320) (-1639.407) -- 0:01:03
147500 -- (-1640.705) (-1639.969) (-1640.504) [-1639.278] * (-1640.408) (-1638.351) [-1640.982] (-1639.496) -- 0:01:03
148000 -- (-1648.261) (-1642.178) [-1640.068] (-1639.573) * (-1641.033) [-1639.025] (-1639.959) (-1640.436) -- 0:01:03
148500 -- [-1640.794] (-1641.611) (-1640.312) (-1639.242) * [-1641.979] (-1641.343) (-1642.618) (-1639.276) -- 0:01:03
149000 -- [-1640.212] (-1641.468) (-1640.808) (-1640.699) * (-1640.746) (-1641.615) [-1640.086] (-1641.296) -- 0:01:02
149500 -- [-1639.783] (-1640.975) (-1640.380) (-1640.755) * (-1639.632) (-1643.888) [-1641.617] (-1642.788) -- 0:01:02
150000 -- (-1640.930) (-1641.052) (-1641.223) [-1638.853] * (-1640.145) [-1641.299] (-1640.756) (-1641.753) -- 0:01:02
Average standard deviation of split frequencies: 0.011646
150500 -- (-1640.605) (-1640.938) (-1643.693) [-1638.609] * (-1643.883) [-1638.954] (-1642.979) (-1641.753) -- 0:01:02
151000 -- [-1640.835] (-1639.601) (-1644.671) (-1639.015) * (-1644.586) [-1638.654] (-1641.801) (-1640.446) -- 0:01:01
151500 -- (-1640.470) (-1639.256) (-1641.056) [-1638.565] * [-1639.073] (-1639.265) (-1644.393) (-1638.509) -- 0:01:01
152000 -- (-1647.302) [-1639.433] (-1639.368) (-1638.613) * (-1640.735) (-1639.349) (-1643.895) [-1639.088] -- 0:01:01
152500 -- (-1641.074) (-1639.678) [-1639.427] (-1639.698) * [-1640.641] (-1639.161) (-1641.511) (-1639.630) -- 0:01:01
153000 -- (-1640.647) [-1639.013] (-1639.250) (-1640.034) * (-1644.342) (-1638.533) (-1640.527) [-1638.695] -- 0:01:00
153500 -- (-1639.833) [-1638.917] (-1639.250) (-1638.582) * (-1640.957) (-1638.575) [-1643.655] (-1639.528) -- 0:01:00
154000 -- (-1640.675) (-1642.133) (-1646.249) [-1638.450] * (-1639.552) [-1638.501] (-1642.006) (-1643.171) -- 0:01:00
154500 -- (-1640.297) (-1640.447) [-1642.937] (-1639.782) * (-1643.156) (-1638.451) [-1639.887] (-1643.424) -- 0:01:00
155000 -- (-1639.312) (-1643.831) (-1638.949) [-1638.773] * (-1648.604) [-1639.067] (-1641.651) (-1638.859) -- 0:00:59
Average standard deviation of split frequencies: 0.012246
155500 -- (-1640.594) (-1645.371) (-1639.905) [-1639.292] * (-1644.530) (-1640.846) [-1642.481] (-1640.462) -- 0:00:59
156000 -- (-1640.268) (-1643.750) [-1639.312] (-1639.291) * [-1641.034] (-1638.963) (-1639.843) (-1638.490) -- 0:00:59
156500 -- (-1643.556) [-1641.698] (-1638.630) (-1641.813) * (-1642.622) [-1642.278] (-1638.973) (-1638.346) -- 0:00:59
157000 -- (-1640.056) (-1639.083) (-1638.774) [-1638.747] * (-1640.537) (-1640.166) (-1641.433) [-1641.958] -- 0:01:04
157500 -- (-1640.267) (-1638.703) [-1639.855] (-1640.790) * (-1644.102) (-1641.929) (-1640.288) [-1641.386] -- 0:01:04
158000 -- (-1647.968) (-1643.687) (-1639.799) [-1639.254] * (-1641.606) (-1641.530) (-1639.186) [-1639.390] -- 0:01:03
158500 -- (-1644.263) (-1640.276) [-1640.746] (-1640.085) * (-1640.361) (-1642.203) (-1643.771) [-1639.479] -- 0:01:03
159000 -- (-1639.981) (-1639.648) [-1639.294] (-1638.824) * [-1640.075] (-1641.479) (-1641.799) (-1640.094) -- 0:01:03
159500 -- (-1640.044) (-1642.140) (-1639.829) [-1639.023] * (-1640.162) (-1641.043) [-1639.014] (-1641.418) -- 0:01:03
160000 -- [-1640.446] (-1639.451) (-1641.349) (-1639.021) * (-1640.256) (-1641.286) [-1638.639] (-1639.700) -- 0:01:02
Average standard deviation of split frequencies: 0.012817
160500 -- [-1639.030] (-1639.124) (-1638.862) (-1638.921) * (-1639.605) (-1641.485) (-1638.870) [-1639.951] -- 0:01:02
161000 -- (-1638.263) (-1646.582) (-1644.427) [-1639.693] * (-1642.631) (-1641.475) [-1638.868] (-1640.896) -- 0:01:02
161500 -- (-1638.280) [-1641.350] (-1643.193) (-1638.546) * [-1640.698] (-1640.703) (-1638.577) (-1639.737) -- 0:01:02
162000 -- (-1638.359) [-1642.551] (-1641.943) (-1638.841) * (-1640.523) [-1639.562] (-1641.594) (-1639.170) -- 0:01:02
162500 -- (-1638.998) [-1640.329] (-1643.062) (-1639.291) * (-1640.861) (-1639.468) (-1640.743) [-1640.573] -- 0:01:01
163000 -- (-1640.028) (-1640.574) [-1642.523] (-1639.031) * [-1641.376] (-1639.368) (-1639.428) (-1640.837) -- 0:01:01
163500 -- (-1639.003) (-1640.680) (-1641.174) [-1639.322] * [-1639.401] (-1638.938) (-1640.660) (-1639.149) -- 0:01:01
164000 -- (-1640.782) (-1642.587) [-1640.785] (-1639.222) * (-1639.321) (-1639.164) [-1639.895] (-1640.345) -- 0:01:01
164500 -- [-1639.940] (-1641.783) (-1641.130) (-1640.818) * (-1639.837) (-1639.409) (-1639.731) [-1638.579] -- 0:01:00
165000 -- (-1638.780) [-1641.603] (-1641.977) (-1640.572) * (-1639.977) [-1638.368] (-1638.849) (-1639.614) -- 0:01:00
Average standard deviation of split frequencies: 0.012555
165500 -- (-1638.757) [-1640.446] (-1641.276) (-1641.947) * (-1639.823) (-1641.185) [-1638.433] (-1640.358) -- 0:01:00
166000 -- [-1638.700] (-1641.700) (-1646.452) (-1643.258) * (-1640.063) (-1639.181) [-1638.578] (-1639.692) -- 0:01:00
166500 -- (-1640.035) (-1638.896) [-1642.312] (-1643.692) * (-1639.187) (-1639.117) (-1639.517) [-1640.055] -- 0:01:00
167000 -- (-1640.765) (-1638.896) [-1639.126] (-1639.410) * (-1643.198) (-1638.928) [-1640.395] (-1638.801) -- 0:00:59
167500 -- (-1642.854) [-1638.957] (-1639.140) (-1640.211) * (-1641.007) (-1640.016) (-1640.329) [-1638.933] -- 0:00:59
168000 -- [-1639.055] (-1640.643) (-1639.073) (-1639.718) * (-1639.589) [-1638.862] (-1640.228) (-1640.982) -- 0:00:59
168500 -- [-1639.015] (-1640.581) (-1640.164) (-1639.481) * (-1641.228) [-1640.896] (-1638.934) (-1640.351) -- 0:00:59
169000 -- (-1639.490) [-1638.899] (-1639.794) (-1641.765) * (-1644.936) (-1640.655) [-1640.725] (-1640.666) -- 0:00:59
169500 -- (-1639.961) (-1640.110) [-1638.721] (-1643.032) * (-1645.026) (-1640.187) (-1639.767) [-1640.031] -- 0:00:58
170000 -- (-1639.944) (-1639.343) (-1638.659) [-1641.011] * (-1641.142) (-1640.609) [-1640.117] (-1642.116) -- 0:00:58
Average standard deviation of split frequencies: 0.014501
170500 -- (-1640.374) (-1639.234) (-1638.575) [-1640.661] * (-1640.403) [-1639.720] (-1640.257) (-1643.286) -- 0:01:03
171000 -- [-1638.826] (-1638.778) (-1639.021) (-1641.445) * (-1638.820) (-1642.497) [-1639.903] (-1642.699) -- 0:01:03
171500 -- (-1641.989) [-1638.507] (-1642.421) (-1640.790) * (-1638.732) (-1639.048) (-1642.198) [-1638.943] -- 0:01:02
172000 -- (-1639.590) (-1638.571) (-1640.466) [-1640.638] * (-1638.516) (-1639.766) [-1641.735] (-1641.553) -- 0:01:02
172500 -- [-1639.561] (-1639.893) (-1640.739) (-1638.471) * (-1638.610) (-1640.142) [-1642.902] (-1642.410) -- 0:01:02
173000 -- (-1640.583) (-1638.652) (-1640.648) [-1640.789] * (-1638.685) (-1639.890) [-1640.733] (-1646.693) -- 0:01:02
173500 -- [-1640.975] (-1638.546) (-1640.707) (-1640.845) * [-1638.880] (-1639.261) (-1640.318) (-1639.604) -- 0:01:01
174000 -- [-1640.916] (-1639.075) (-1640.643) (-1640.393) * (-1640.337) (-1638.376) (-1641.827) [-1639.494] -- 0:01:01
174500 -- (-1638.085) [-1639.890] (-1640.846) (-1638.835) * [-1639.446] (-1640.780) (-1638.722) (-1642.703) -- 0:01:01
175000 -- (-1639.539) (-1642.685) (-1640.327) [-1638.558] * (-1639.747) (-1640.133) [-1640.142] (-1642.633) -- 0:01:01
Average standard deviation of split frequencies: 0.014999
175500 -- (-1640.723) (-1639.530) [-1638.477] (-1640.993) * (-1642.594) (-1640.249) (-1641.450) [-1640.897] -- 0:01:01
176000 -- [-1638.699] (-1641.261) (-1638.424) (-1638.067) * (-1642.104) (-1641.296) (-1639.489) [-1643.052] -- 0:01:00
176500 -- (-1638.792) (-1640.707) (-1639.916) [-1638.664] * (-1640.232) [-1639.577] (-1643.608) (-1643.479) -- 0:01:00
177000 -- (-1642.023) (-1641.789) (-1641.213) [-1640.794] * (-1641.118) (-1638.890) (-1639.566) [-1639.410] -- 0:01:00
177500 -- [-1641.451] (-1640.133) (-1639.954) (-1639.341) * (-1640.999) (-1640.774) (-1643.904) [-1640.986] -- 0:01:00
178000 -- (-1639.158) (-1639.496) [-1640.610] (-1640.077) * (-1640.292) [-1638.306] (-1645.165) (-1641.362) -- 0:01:00
178500 -- [-1638.720] (-1641.324) (-1639.184) (-1640.989) * (-1639.685) [-1640.259] (-1642.242) (-1640.133) -- 0:00:59
179000 -- [-1638.346] (-1641.323) (-1639.740) (-1640.062) * (-1638.686) (-1638.519) [-1642.529] (-1640.410) -- 0:00:59
179500 -- [-1639.512] (-1639.286) (-1638.717) (-1642.677) * (-1638.850) [-1639.050] (-1643.055) (-1641.960) -- 0:00:59
180000 -- (-1641.680) (-1640.665) (-1639.336) [-1642.036] * (-1638.656) [-1638.328] (-1646.604) (-1639.565) -- 0:00:59
Average standard deviation of split frequencies: 0.015003
180500 -- [-1639.973] (-1641.483) (-1640.713) (-1641.358) * (-1640.277) (-1640.890) (-1642.741) [-1640.917] -- 0:00:59
181000 -- (-1644.807) (-1639.651) (-1640.653) [-1641.226] * [-1638.356] (-1638.458) (-1644.405) (-1643.876) -- 0:00:58
181500 -- (-1646.254) [-1639.577] (-1639.512) (-1640.014) * (-1638.382) [-1641.406] (-1647.902) (-1644.762) -- 0:00:58
182000 -- (-1644.715) (-1640.729) [-1639.508] (-1641.626) * [-1639.109] (-1639.521) (-1642.737) (-1645.267) -- 0:00:58
182500 -- (-1640.553) (-1640.748) (-1638.604) [-1640.776] * [-1639.918] (-1638.174) (-1643.404) (-1643.850) -- 0:00:58
183000 -- (-1645.769) (-1640.615) [-1639.204] (-1639.785) * (-1641.588) (-1638.147) [-1641.738] (-1640.760) -- 0:00:58
183500 -- (-1644.779) [-1639.788] (-1639.329) (-1639.561) * (-1640.076) [-1639.879] (-1640.343) (-1640.846) -- 0:00:57
184000 -- (-1641.362) [-1640.098] (-1641.599) (-1639.849) * [-1641.826] (-1640.620) (-1643.337) (-1639.649) -- 0:01:02
184500 -- (-1642.134) [-1639.813] (-1640.575) (-1639.336) * (-1638.425) [-1639.125] (-1643.674) (-1642.747) -- 0:01:01
185000 -- (-1640.841) (-1642.685) (-1640.314) [-1640.455] * (-1638.774) (-1638.229) [-1641.408] (-1640.180) -- 0:01:01
Average standard deviation of split frequencies: 0.014446
185500 -- [-1642.137] (-1640.456) (-1639.901) (-1641.063) * (-1639.086) (-1639.945) (-1640.126) [-1641.791] -- 0:01:01
186000 -- (-1641.627) (-1641.628) [-1640.168] (-1640.603) * (-1638.876) (-1639.460) [-1639.679] (-1642.060) -- 0:01:01
186500 -- (-1641.215) [-1640.974] (-1639.573) (-1640.262) * [-1639.496] (-1639.655) (-1638.466) (-1640.436) -- 0:01:01
187000 -- (-1641.870) (-1640.079) [-1641.024] (-1642.075) * (-1640.820) (-1639.725) [-1638.603] (-1640.296) -- 0:01:00
187500 -- (-1643.149) (-1639.639) (-1640.913) [-1640.305] * (-1641.659) [-1639.832] (-1638.596) (-1640.864) -- 0:01:00
188000 -- (-1639.550) [-1639.599] (-1639.044) (-1639.146) * (-1642.496) [-1639.708] (-1638.590) (-1642.382) -- 0:01:00
188500 -- [-1639.579] (-1640.190) (-1638.894) (-1638.314) * (-1642.022) [-1641.704] (-1638.879) (-1647.348) -- 0:01:00
189000 -- [-1639.642] (-1641.733) (-1638.949) (-1640.106) * (-1639.787) (-1641.728) (-1638.526) [-1641.448] -- 0:01:00
189500 -- (-1639.533) (-1640.745) [-1638.949] (-1640.651) * (-1645.102) (-1643.428) (-1642.289) [-1641.896] -- 0:00:59
190000 -- (-1640.678) (-1639.624) (-1640.581) [-1642.656] * (-1642.015) [-1641.256] (-1641.883) (-1638.862) -- 0:00:59
Average standard deviation of split frequencies: 0.017060
190500 -- (-1640.856) (-1640.644) [-1639.678] (-1640.800) * (-1643.639) (-1643.903) (-1642.551) [-1638.828] -- 0:00:59
191000 -- (-1643.433) [-1640.659] (-1640.186) (-1641.617) * (-1640.758) [-1638.073] (-1640.418) (-1638.610) -- 0:00:59
191500 -- (-1647.151) (-1640.572) (-1641.239) [-1640.741] * (-1640.531) (-1638.132) (-1642.968) [-1639.725] -- 0:00:59
192000 -- (-1643.735) [-1640.287] (-1641.149) (-1639.827) * (-1640.580) (-1638.770) (-1642.216) [-1639.106] -- 0:00:58
192500 -- (-1641.934) (-1639.687) (-1642.921) [-1647.345] * (-1642.794) [-1638.521] (-1641.417) (-1639.605) -- 0:00:58
193000 -- (-1638.823) (-1639.893) (-1642.848) [-1639.547] * [-1641.192] (-1638.961) (-1640.175) (-1638.867) -- 0:00:58
193500 -- [-1639.511] (-1639.390) (-1639.994) (-1642.783) * [-1641.665] (-1640.278) (-1641.439) (-1638.311) -- 0:00:58
194000 -- [-1640.907] (-1640.359) (-1639.836) (-1640.009) * [-1641.506] (-1643.992) (-1641.364) (-1639.519) -- 0:00:58
194500 -- (-1642.308) (-1640.706) [-1639.833] (-1641.860) * (-1640.645) (-1639.663) (-1641.234) [-1639.459] -- 0:00:57
195000 -- (-1641.799) (-1642.173) [-1646.118] (-1641.381) * (-1640.530) [-1641.365] (-1642.251) (-1641.270) -- 0:00:57
Average standard deviation of split frequencies: 0.018355
195500 -- [-1640.241] (-1640.874) (-1645.570) (-1642.832) * (-1640.659) (-1640.204) [-1640.697] (-1642.620) -- 0:00:57
196000 -- (-1639.824) (-1640.593) [-1643.035] (-1641.195) * (-1639.365) [-1639.359] (-1640.547) (-1639.704) -- 0:00:57
196500 -- (-1638.882) (-1641.822) [-1642.393] (-1639.776) * [-1639.183] (-1639.884) (-1641.450) (-1638.985) -- 0:00:57
197000 -- [-1641.332] (-1641.486) (-1640.079) (-1641.089) * [-1639.033] (-1640.995) (-1638.915) (-1639.925) -- 0:01:01
197500 -- (-1640.038) (-1648.933) [-1640.079] (-1639.075) * (-1639.096) [-1640.163] (-1639.516) (-1640.197) -- 0:01:00
198000 -- (-1642.490) (-1639.746) [-1639.414] (-1639.062) * (-1640.283) (-1642.218) [-1639.726] (-1639.786) -- 0:01:00
198500 -- (-1639.640) (-1642.564) [-1639.782] (-1643.341) * (-1641.956) (-1647.592) (-1639.493) [-1639.158] -- 0:01:00
199000 -- (-1640.104) (-1641.883) [-1640.576] (-1638.825) * [-1638.888] (-1638.943) (-1639.412) (-1640.708) -- 0:01:00
199500 -- [-1640.359] (-1639.235) (-1646.893) (-1638.622) * [-1638.622] (-1638.633) (-1641.317) (-1639.211) -- 0:01:00
200000 -- (-1640.101) (-1641.904) [-1642.273] (-1639.984) * (-1640.690) [-1639.940] (-1646.163) (-1640.805) -- 0:00:59
Average standard deviation of split frequencies: 0.017804
200500 -- (-1639.977) (-1640.636) (-1641.744) [-1640.883] * [-1643.281] (-1640.484) (-1642.325) (-1640.623) -- 0:00:59
201000 -- [-1643.463] (-1637.950) (-1640.325) (-1641.176) * (-1642.046) (-1640.949) (-1645.280) [-1639.863] -- 0:00:59
201500 -- (-1644.048) (-1640.202) (-1639.995) [-1641.845] * (-1639.437) (-1642.041) [-1640.108] (-1640.157) -- 0:00:59
202000 -- (-1639.925) [-1638.721] (-1641.617) (-1639.066) * (-1642.287) [-1639.532] (-1640.537) (-1639.291) -- 0:00:59
202500 -- [-1642.316] (-1639.155) (-1641.749) (-1639.569) * (-1638.744) (-1639.364) (-1640.066) [-1641.166] -- 0:00:59
203000 -- (-1642.675) (-1641.404) (-1640.737) [-1640.519] * (-1639.182) [-1639.944] (-1639.563) (-1640.403) -- 0:00:58
203500 -- [-1642.248] (-1640.374) (-1639.753) (-1641.074) * [-1638.973] (-1642.583) (-1639.878) (-1640.846) -- 0:00:58
204000 -- (-1642.599) (-1641.441) (-1639.541) [-1642.472] * (-1639.690) [-1641.448] (-1640.079) (-1639.334) -- 0:00:58
204500 -- (-1640.401) (-1638.474) (-1638.283) [-1642.662] * (-1640.953) (-1640.880) [-1640.165] (-1640.904) -- 0:00:58
205000 -- (-1639.972) (-1640.121) [-1639.267] (-1641.584) * (-1639.480) (-1640.183) [-1639.317] (-1640.233) -- 0:00:58
Average standard deviation of split frequencies: 0.016621
205500 -- (-1640.847) [-1639.442] (-1638.716) (-1640.013) * [-1641.511] (-1641.080) (-1638.992) (-1641.114) -- 0:00:57
206000 -- (-1640.296) (-1638.401) (-1644.910) [-1640.156] * (-1638.858) (-1639.622) [-1640.003] (-1640.860) -- 0:00:57
206500 -- (-1640.982) [-1638.418] (-1644.099) (-1639.988) * (-1638.619) (-1639.745) (-1639.984) [-1639.313] -- 0:00:57
207000 -- (-1640.994) [-1638.393] (-1643.027) (-1639.942) * (-1638.626) (-1639.040) (-1640.405) [-1639.209] -- 0:00:57
207500 -- (-1643.705) (-1638.428) [-1643.373] (-1639.109) * (-1640.129) (-1642.509) (-1639.248) [-1638.911] -- 0:00:57
208000 -- (-1640.845) (-1638.800) [-1638.629] (-1642.823) * (-1638.802) (-1640.794) (-1641.356) [-1639.030] -- 0:00:57
208500 -- [-1641.657] (-1639.896) (-1638.497) (-1639.569) * (-1640.603) (-1638.070) (-1643.186) [-1642.693] -- 0:00:56
209000 -- (-1642.536) [-1638.832] (-1639.836) (-1640.167) * (-1643.017) [-1640.922] (-1641.177) (-1642.612) -- 0:00:56
209500 -- (-1642.030) (-1640.187) [-1638.321] (-1643.071) * (-1640.291) (-1640.421) (-1642.729) [-1639.669] -- 0:00:56
210000 -- [-1638.563] (-1639.202) (-1638.718) (-1641.217) * (-1640.759) (-1641.706) (-1640.245) [-1639.643] -- 0:00:56
Average standard deviation of split frequencies: 0.015310
210500 -- (-1638.546) (-1641.119) (-1639.027) [-1638.482] * [-1640.133] (-1644.203) (-1640.538) (-1640.799) -- 0:01:00
211000 -- (-1638.394) (-1644.390) (-1640.666) [-1641.258] * [-1638.738] (-1640.615) (-1641.867) (-1644.994) -- 0:00:59
211500 -- (-1638.239) (-1645.460) [-1639.685] (-1642.503) * [-1640.006] (-1640.985) (-1639.090) (-1642.226) -- 0:00:59
212000 -- [-1642.478] (-1641.162) (-1640.147) (-1638.374) * (-1638.188) (-1640.467) [-1639.481] (-1639.887) -- 0:00:59
212500 -- (-1639.970) [-1641.283] (-1639.645) (-1638.376) * (-1640.202) [-1640.136] (-1640.983) (-1639.647) -- 0:00:59
213000 -- [-1640.151] (-1642.796) (-1639.437) (-1639.533) * [-1639.125] (-1641.339) (-1639.081) (-1639.062) -- 0:00:59
213500 -- (-1642.515) (-1641.599) (-1639.655) [-1639.596] * (-1640.397) (-1639.407) [-1639.808] (-1639.869) -- 0:00:58
214000 -- (-1639.190) [-1638.912] (-1638.835) (-1640.310) * [-1641.388] (-1639.010) (-1641.596) (-1641.056) -- 0:00:58
214500 -- (-1640.370) [-1639.019] (-1639.049) (-1640.508) * (-1641.979) (-1638.686) [-1640.684] (-1638.202) -- 0:00:58
215000 -- (-1641.736) (-1638.920) [-1642.004] (-1640.099) * [-1642.381] (-1638.491) (-1642.181) (-1644.868) -- 0:00:58
Average standard deviation of split frequencies: 0.014473
215500 -- (-1640.192) [-1638.711] (-1640.807) (-1640.621) * (-1642.220) (-1639.050) [-1639.676] (-1639.688) -- 0:00:58
216000 -- (-1640.524) (-1639.939) [-1641.091] (-1640.497) * (-1639.395) (-1641.009) [-1639.651] (-1638.054) -- 0:00:58
216500 -- (-1640.007) [-1641.006] (-1641.034) (-1642.104) * (-1639.296) (-1638.538) [-1639.219] (-1643.625) -- 0:00:57
217000 -- [-1640.190] (-1639.422) (-1639.514) (-1642.661) * (-1643.619) [-1639.026] (-1639.255) (-1640.118) -- 0:00:57
217500 -- (-1638.634) (-1641.074) (-1641.576) [-1639.835] * (-1644.364) (-1640.259) [-1642.498] (-1640.128) -- 0:00:57
218000 -- (-1638.222) [-1639.328] (-1643.256) (-1640.200) * (-1640.200) (-1639.812) [-1639.342] (-1640.832) -- 0:00:57
218500 -- [-1638.518] (-1639.317) (-1643.395) (-1638.824) * (-1640.293) (-1640.708) (-1642.540) [-1639.073] -- 0:00:57
219000 -- [-1639.287] (-1640.594) (-1643.853) (-1638.888) * (-1641.142) [-1639.725] (-1640.636) (-1640.640) -- 0:00:57
219500 -- (-1642.950) (-1642.152) (-1640.658) [-1639.031] * (-1640.342) [-1640.003] (-1640.637) (-1638.771) -- 0:00:56
220000 -- [-1640.145] (-1645.333) (-1640.541) (-1639.732) * [-1639.341] (-1639.308) (-1638.925) (-1641.360) -- 0:00:56
Average standard deviation of split frequencies: 0.012480
220500 -- (-1645.847) (-1640.234) [-1640.583] (-1641.011) * [-1646.331] (-1639.847) (-1638.765) (-1638.253) -- 0:00:56
221000 -- (-1642.406) (-1638.451) [-1641.789] (-1639.195) * (-1640.916) (-1640.084) (-1638.726) [-1639.063] -- 0:00:56
221500 -- (-1646.858) [-1640.374] (-1638.358) (-1639.577) * [-1639.626] (-1642.425) (-1640.534) (-1646.648) -- 0:00:56
222000 -- (-1641.516) (-1642.397) (-1640.863) [-1640.514] * (-1641.157) (-1638.242) [-1639.586] (-1640.931) -- 0:00:56
222500 -- (-1640.697) [-1638.752] (-1638.744) (-1641.900) * [-1638.495] (-1638.452) (-1640.348) (-1645.837) -- 0:00:55
223000 -- [-1639.041] (-1638.577) (-1639.197) (-1639.922) * [-1639.227] (-1642.957) (-1641.114) (-1643.788) -- 0:00:55
223500 -- (-1641.476) (-1639.682) (-1639.107) [-1638.751] * (-1639.344) [-1638.750] (-1642.800) (-1642.716) -- 0:00:55
224000 -- (-1638.592) [-1642.683] (-1640.478) (-1639.787) * [-1641.945] (-1639.288) (-1639.884) (-1644.504) -- 0:00:58
224500 -- [-1638.592] (-1640.662) (-1639.340) (-1641.503) * (-1643.383) (-1641.130) [-1640.413] (-1641.788) -- 0:00:58
225000 -- (-1644.985) [-1641.584] (-1643.228) (-1639.918) * (-1642.904) [-1639.414] (-1639.933) (-1642.524) -- 0:00:58
Average standard deviation of split frequencies: 0.013503
225500 -- [-1644.087] (-1642.825) (-1640.640) (-1641.351) * (-1643.666) [-1641.654] (-1640.277) (-1642.773) -- 0:00:58
226000 -- (-1640.774) [-1639.626] (-1641.770) (-1640.259) * (-1643.787) (-1639.303) [-1640.358] (-1638.921) -- 0:00:58
226500 -- (-1638.611) [-1640.454] (-1641.421) (-1642.923) * (-1643.854) (-1641.589) (-1641.509) [-1638.184] -- 0:00:58
227000 -- (-1639.093) (-1639.958) (-1640.667) [-1640.057] * [-1638.803] (-1639.165) (-1643.401) (-1639.428) -- 0:00:57
227500 -- (-1639.042) (-1643.782) [-1642.844] (-1640.763) * [-1639.891] (-1639.699) (-1641.781) (-1639.379) -- 0:00:57
228000 -- (-1639.008) [-1639.956] (-1644.643) (-1639.979) * (-1639.179) [-1641.737] (-1639.247) (-1639.427) -- 0:00:57
228500 -- (-1642.442) (-1643.751) (-1641.574) [-1644.287] * [-1640.567] (-1639.075) (-1639.420) (-1639.551) -- 0:00:57
229000 -- (-1644.991) (-1644.338) [-1639.161] (-1640.919) * (-1641.770) (-1641.177) [-1640.830] (-1640.947) -- 0:00:57
229500 -- (-1646.162) [-1645.945] (-1638.662) (-1640.783) * (-1639.926) (-1639.488) [-1641.544] (-1644.987) -- 0:00:57
230000 -- (-1641.632) (-1642.305) (-1639.852) [-1638.223] * (-1639.543) [-1639.248] (-1638.556) (-1645.230) -- 0:00:56
Average standard deviation of split frequencies: 0.012671
230500 -- (-1640.217) (-1640.084) (-1640.994) [-1639.364] * (-1639.939) (-1639.765) (-1638.345) [-1641.565] -- 0:00:56
231000 -- (-1640.271) (-1639.646) [-1641.157] (-1639.633) * (-1642.165) (-1639.688) (-1638.600) [-1639.267] -- 0:00:56
231500 -- (-1639.172) [-1639.112] (-1643.295) (-1639.530) * (-1644.068) (-1638.439) (-1639.716) [-1642.887] -- 0:00:56
232000 -- (-1639.783) [-1639.696] (-1642.979) (-1639.030) * (-1641.271) [-1640.865] (-1638.976) (-1647.493) -- 0:00:56
232500 -- (-1640.978) (-1639.274) [-1643.894] (-1643.202) * (-1640.685) [-1642.502] (-1639.094) (-1642.912) -- 0:00:56
233000 -- [-1639.166] (-1642.011) (-1640.848) (-1640.097) * (-1639.358) (-1640.554) [-1638.081] (-1642.136) -- 0:00:55
233500 -- (-1641.545) (-1639.859) (-1642.319) [-1639.565] * (-1639.527) (-1640.918) [-1638.561] (-1642.175) -- 0:00:55
234000 -- (-1641.013) [-1641.741] (-1641.297) (-1639.448) * (-1639.291) (-1640.100) [-1638.746] (-1640.071) -- 0:00:55
234500 -- (-1642.943) (-1642.445) [-1640.170] (-1638.818) * (-1640.132) (-1643.074) (-1639.433) [-1639.719] -- 0:00:55
235000 -- (-1642.650) [-1638.789] (-1639.482) (-1638.696) * (-1642.955) (-1640.334) [-1641.500] (-1638.929) -- 0:00:55
Average standard deviation of split frequencies: 0.012185
235500 -- (-1642.404) (-1639.838) [-1642.470] (-1639.939) * [-1639.379] (-1641.470) (-1641.404) (-1640.862) -- 0:00:55
236000 -- (-1643.809) [-1641.022] (-1640.560) (-1639.550) * [-1638.615] (-1644.515) (-1639.194) (-1642.003) -- 0:00:55
236500 -- (-1638.985) [-1638.639] (-1644.093) (-1639.265) * (-1638.926) (-1640.747) [-1641.040] (-1644.435) -- 0:00:54
237000 -- (-1640.562) (-1641.002) (-1644.416) [-1639.201] * (-1646.944) (-1642.561) [-1640.398] (-1640.502) -- 0:00:54
237500 -- (-1640.248) (-1639.679) [-1640.516] (-1642.000) * (-1645.039) (-1638.949) (-1640.591) [-1641.545] -- 0:00:57
238000 -- (-1641.553) (-1640.247) [-1643.687] (-1638.523) * (-1640.741) [-1638.822] (-1641.790) (-1641.416) -- 0:00:57
238500 -- (-1639.381) (-1642.248) (-1641.374) [-1639.126] * [-1644.059] (-1641.588) (-1640.277) (-1640.537) -- 0:00:57
239000 -- [-1639.537] (-1639.776) (-1640.702) (-1642.071) * (-1640.789) (-1641.334) [-1640.428] (-1641.391) -- 0:00:57
239500 -- [-1638.289] (-1638.135) (-1638.947) (-1642.480) * [-1639.386] (-1642.313) (-1641.104) (-1642.559) -- 0:00:57
240000 -- (-1638.046) [-1639.211] (-1638.540) (-1644.490) * [-1638.018] (-1641.193) (-1638.583) (-1644.613) -- 0:00:56
Average standard deviation of split frequencies: 0.011752
240500 -- (-1639.579) [-1640.491] (-1640.154) (-1644.152) * (-1641.695) (-1638.483) [-1642.603] (-1639.598) -- 0:00:56
241000 -- (-1638.681) (-1642.123) (-1640.962) [-1640.481] * (-1639.596) (-1638.336) (-1647.970) [-1639.099] -- 0:00:56
241500 -- [-1640.041] (-1641.967) (-1639.206) (-1640.234) * (-1640.559) (-1642.126) [-1641.149] (-1639.853) -- 0:00:56
242000 -- [-1640.156] (-1642.926) (-1640.818) (-1641.174) * (-1639.161) [-1640.100] (-1641.933) (-1640.214) -- 0:00:56
242500 -- (-1644.056) (-1640.229) [-1639.320] (-1644.173) * (-1641.399) (-1638.998) [-1645.436] (-1639.594) -- 0:00:56
243000 -- [-1642.178] (-1639.937) (-1643.149) (-1640.816) * (-1641.399) [-1639.819] (-1643.858) (-1639.499) -- 0:00:56
243500 -- (-1641.034) (-1640.187) [-1640.205] (-1642.184) * (-1641.001) [-1641.420] (-1640.987) (-1639.866) -- 0:00:55
244000 -- (-1639.275) [-1644.349] (-1638.727) (-1640.155) * [-1640.445] (-1641.339) (-1642.113) (-1640.790) -- 0:00:55
244500 -- (-1639.176) (-1644.356) [-1640.883] (-1641.073) * (-1639.555) [-1639.266] (-1639.517) (-1640.706) -- 0:00:55
245000 -- (-1638.939) [-1640.016] (-1639.624) (-1639.139) * (-1642.308) (-1640.511) [-1640.485] (-1640.975) -- 0:00:55
Average standard deviation of split frequencies: 0.012456
245500 -- [-1638.725] (-1641.833) (-1639.789) (-1639.685) * (-1642.476) (-1640.112) (-1640.409) [-1641.326] -- 0:00:55
246000 -- (-1639.253) [-1642.520] (-1639.911) (-1640.679) * (-1641.883) [-1639.510] (-1639.666) (-1640.385) -- 0:00:55
246500 -- (-1638.611) (-1644.968) (-1639.557) [-1640.309] * (-1639.199) [-1639.185] (-1641.132) (-1642.136) -- 0:00:55
247000 -- (-1638.692) (-1646.948) [-1640.869] (-1642.924) * [-1638.285] (-1639.959) (-1645.017) (-1640.309) -- 0:00:54
247500 -- (-1639.462) (-1639.789) [-1640.630] (-1641.446) * (-1639.601) [-1639.766] (-1640.955) (-1638.735) -- 0:00:54
248000 -- (-1638.395) (-1639.744) (-1640.864) [-1641.264] * [-1643.095] (-1643.292) (-1639.998) (-1638.532) -- 0:00:54
248500 -- (-1639.598) (-1640.359) [-1638.059] (-1639.039) * (-1642.534) (-1643.588) [-1640.372] (-1638.576) -- 0:00:54
249000 -- (-1639.918) (-1641.208) (-1639.369) [-1638.653] * (-1642.792) [-1639.756] (-1639.577) (-1638.565) -- 0:00:54
249500 -- [-1638.515] (-1639.845) (-1638.009) (-1638.581) * (-1641.234) (-1640.748) [-1638.864] (-1639.001) -- 0:00:54
250000 -- (-1639.923) [-1638.974] (-1640.102) (-1638.503) * (-1638.805) (-1638.976) (-1639.933) [-1639.334] -- 0:00:54
Average standard deviation of split frequencies: 0.013560
250500 -- (-1640.085) [-1639.459] (-1642.335) (-1638.832) * [-1638.533] (-1639.611) (-1640.716) (-1639.197) -- 0:00:53
251000 -- (-1641.022) [-1639.423] (-1640.508) (-1641.322) * (-1644.673) (-1639.563) (-1639.012) [-1638.510] -- 0:00:56
251500 -- (-1641.019) (-1643.549) [-1640.565] (-1639.249) * (-1640.952) [-1639.281] (-1639.121) (-1638.599) -- 0:00:56
252000 -- [-1643.035] (-1638.441) (-1641.029) (-1638.349) * (-1642.748) (-1640.693) (-1638.787) [-1638.300] -- 0:00:56
252500 -- (-1643.228) (-1638.710) (-1639.037) [-1642.263] * (-1640.243) (-1638.513) [-1640.803] (-1639.418) -- 0:00:56
253000 -- (-1638.834) (-1640.307) [-1638.548] (-1641.693) * (-1639.682) (-1638.748) [-1639.833] (-1640.001) -- 0:00:56
253500 -- (-1638.799) (-1644.293) [-1638.286] (-1640.920) * (-1639.279) (-1638.927) (-1639.901) [-1639.977] -- 0:00:55
254000 -- (-1638.750) (-1642.263) (-1639.510) [-1641.012] * (-1640.045) (-1638.835) (-1641.452) [-1640.335] -- 0:00:55
254500 -- (-1639.433) (-1644.618) (-1641.067) [-1640.223] * (-1640.039) [-1638.536] (-1638.250) (-1643.703) -- 0:00:55
255000 -- [-1640.414] (-1639.600) (-1639.669) (-1638.877) * (-1638.564) (-1639.121) (-1638.292) [-1641.931] -- 0:00:55
Average standard deviation of split frequencies: 0.014538
255500 -- (-1639.531) (-1641.228) (-1642.791) [-1640.168] * [-1638.313] (-1639.942) (-1638.381) (-1641.612) -- 0:00:55
256000 -- (-1640.095) [-1639.681] (-1643.310) (-1642.133) * (-1639.780) (-1640.033) [-1641.381] (-1639.305) -- 0:00:55
256500 -- [-1638.757] (-1639.585) (-1639.592) (-1640.952) * (-1643.039) (-1639.075) [-1638.376] (-1639.766) -- 0:00:55
257000 -- [-1638.844] (-1642.501) (-1638.764) (-1639.865) * [-1640.168] (-1642.605) (-1638.828) (-1639.726) -- 0:00:54
257500 -- [-1640.260] (-1640.013) (-1639.817) (-1639.169) * (-1639.986) (-1639.217) (-1639.573) [-1638.731] -- 0:00:54
258000 -- (-1644.099) (-1640.013) (-1640.100) [-1637.917] * [-1638.740] (-1638.421) (-1639.062) (-1638.459) -- 0:00:54
258500 -- [-1639.234] (-1643.288) (-1640.147) (-1637.935) * (-1637.982) (-1638.764) (-1640.010) [-1638.348] -- 0:00:54
259000 -- (-1644.774) (-1641.161) (-1640.032) [-1638.130] * (-1637.982) (-1641.260) (-1643.362) [-1638.864] -- 0:00:54
259500 -- (-1639.510) (-1639.032) [-1640.430] (-1638.132) * [-1638.038] (-1640.405) (-1640.700) (-1639.587) -- 0:00:54
260000 -- (-1641.167) (-1640.218) [-1641.227] (-1640.414) * (-1641.516) [-1641.261] (-1641.463) (-1639.476) -- 0:00:54
Average standard deviation of split frequencies: 0.013706
260500 -- (-1641.561) (-1640.099) (-1638.657) [-1639.379] * (-1641.248) (-1638.515) (-1640.777) [-1642.022] -- 0:00:53
261000 -- (-1643.421) [-1641.319] (-1640.864) (-1641.034) * (-1640.166) [-1640.803] (-1639.332) (-1642.373) -- 0:00:53
261500 -- (-1640.372) (-1641.995) [-1638.567] (-1642.527) * (-1641.076) (-1640.305) (-1639.706) [-1640.100] -- 0:00:53
262000 -- (-1640.070) [-1640.989] (-1638.510) (-1642.527) * (-1638.535) (-1641.869) (-1638.322) [-1639.852] -- 0:00:53
262500 -- (-1643.417) (-1641.690) (-1639.634) [-1638.774] * (-1640.533) [-1641.576] (-1638.656) (-1639.559) -- 0:00:53
263000 -- (-1639.095) [-1641.403] (-1651.571) (-1639.929) * [-1639.160] (-1640.599) (-1639.886) (-1639.131) -- 0:00:53
263500 -- (-1638.182) (-1639.734) (-1647.239) [-1640.655] * (-1641.295) (-1640.842) (-1639.232) [-1639.109] -- 0:00:53
264000 -- (-1638.166) (-1644.426) (-1641.793) [-1640.925] * [-1639.640] (-1638.206) (-1639.550) (-1639.403) -- 0:00:52
264500 -- (-1642.633) (-1643.441) [-1640.624] (-1640.216) * (-1639.727) [-1638.213] (-1638.642) (-1639.399) -- 0:00:55
265000 -- (-1639.107) (-1640.625) (-1640.628) [-1639.846] * [-1638.890] (-1641.912) (-1643.372) (-1641.524) -- 0:00:55
Average standard deviation of split frequencies: 0.012583
265500 -- (-1638.243) (-1640.947) [-1645.373] (-1642.092) * (-1640.239) (-1639.231) (-1641.496) [-1643.563] -- 0:00:55
266000 -- [-1640.650] (-1644.595) (-1640.819) (-1638.856) * (-1640.665) [-1638.756] (-1642.899) (-1643.164) -- 0:00:55
266500 -- (-1642.821) (-1639.872) (-1639.544) [-1639.695] * (-1639.531) (-1638.613) (-1638.612) [-1644.246] -- 0:00:55
267000 -- (-1642.559) (-1640.911) (-1639.508) [-1638.887] * [-1643.133] (-1638.631) (-1640.546) (-1642.565) -- 0:00:54
267500 -- (-1639.996) [-1640.466] (-1640.857) (-1640.473) * (-1643.662) (-1639.263) [-1640.779] (-1638.900) -- 0:00:54
268000 -- (-1639.535) (-1640.965) [-1639.300] (-1647.862) * (-1640.465) [-1639.279] (-1638.786) (-1643.857) -- 0:00:54
268500 -- (-1638.500) (-1643.495) (-1640.118) [-1642.258] * [-1639.151] (-1641.916) (-1638.786) (-1641.513) -- 0:00:54
269000 -- [-1640.911] (-1644.004) (-1640.065) (-1645.210) * (-1645.771) (-1640.673) [-1640.669] (-1641.064) -- 0:00:54
269500 -- (-1640.996) [-1641.367] (-1640.156) (-1643.649) * (-1641.107) (-1640.798) [-1641.274] (-1640.276) -- 0:00:54
270000 -- (-1638.298) (-1639.626) (-1639.455) [-1639.603] * (-1642.379) (-1639.727) [-1642.369] (-1639.767) -- 0:00:54
Average standard deviation of split frequencies: 0.013383
270500 -- [-1639.246] (-1639.618) (-1640.212) (-1639.356) * (-1641.403) [-1640.644] (-1644.277) (-1640.342) -- 0:00:53
271000 -- (-1639.337) (-1641.876) [-1641.474] (-1639.454) * (-1641.553) (-1639.608) (-1641.906) [-1640.443] -- 0:00:53
271500 -- (-1643.669) (-1642.316) [-1642.524] (-1638.586) * (-1643.231) (-1641.214) [-1642.198] (-1643.885) -- 0:00:53
272000 -- [-1643.567] (-1641.186) (-1641.991) (-1638.854) * [-1641.820] (-1646.581) (-1640.741) (-1639.106) -- 0:00:53
272500 -- (-1640.770) [-1638.933] (-1640.867) (-1641.830) * (-1641.041) (-1640.851) (-1642.407) [-1638.884] -- 0:00:53
273000 -- [-1640.958] (-1638.886) (-1639.729) (-1643.023) * (-1639.315) [-1638.618] (-1641.185) (-1638.884) -- 0:00:53
273500 -- [-1638.735] (-1639.321) (-1644.364) (-1640.351) * (-1640.399) [-1641.775] (-1641.962) (-1640.032) -- 0:00:53
274000 -- (-1641.519) (-1639.347) [-1638.615] (-1640.533) * [-1640.407] (-1640.869) (-1637.998) (-1638.904) -- 0:00:52
274500 -- (-1643.902) (-1640.255) (-1640.519) [-1639.367] * (-1639.002) (-1639.588) [-1638.040] (-1640.603) -- 0:00:52
275000 -- (-1642.957) (-1639.594) (-1640.967) [-1640.182] * (-1642.286) (-1639.501) (-1638.069) [-1639.629] -- 0:00:52
Average standard deviation of split frequencies: 0.013844
275500 -- (-1641.056) (-1639.481) (-1640.589) [-1639.786] * (-1643.738) (-1641.683) (-1638.601) [-1641.607] -- 0:00:52
276000 -- (-1640.714) (-1639.371) (-1640.394) [-1642.277] * [-1640.257] (-1641.497) (-1639.611) (-1639.642) -- 0:00:52
276500 -- (-1639.233) [-1642.390] (-1640.560) (-1640.608) * (-1640.906) (-1641.961) [-1640.014] (-1640.298) -- 0:00:52
277000 -- (-1640.372) (-1640.783) [-1639.577] (-1643.285) * [-1640.059] (-1641.624) (-1638.718) (-1640.084) -- 0:00:52
277500 -- (-1642.032) (-1641.994) [-1638.714] (-1642.803) * (-1640.187) (-1644.312) (-1640.490) [-1639.606] -- 0:00:52
278000 -- [-1639.285] (-1638.516) (-1640.003) (-1640.573) * (-1640.723) (-1638.323) (-1641.556) [-1638.903] -- 0:00:54
278500 -- (-1642.483) [-1639.480] (-1639.398) (-1639.305) * [-1639.394] (-1638.486) (-1640.557) (-1640.290) -- 0:00:54
279000 -- (-1641.052) [-1639.995] (-1638.492) (-1640.373) * (-1639.184) [-1638.667] (-1639.659) (-1640.331) -- 0:00:54
279500 -- (-1641.458) [-1640.003] (-1639.036) (-1641.996) * (-1640.942) (-1640.411) [-1639.701] (-1640.972) -- 0:00:54
280000 -- [-1641.003] (-1640.828) (-1639.915) (-1640.556) * (-1642.063) [-1638.799] (-1640.058) (-1638.687) -- 0:00:53
Average standard deviation of split frequencies: 0.013605
280500 -- (-1644.140) (-1639.131) [-1639.015] (-1641.343) * (-1642.438) (-1640.314) [-1639.377] (-1638.320) -- 0:00:53
281000 -- [-1638.821] (-1640.085) (-1640.275) (-1638.861) * (-1640.521) (-1639.550) (-1645.542) [-1639.829] -- 0:00:53
281500 -- [-1640.506] (-1639.931) (-1642.214) (-1638.587) * (-1641.160) (-1640.853) (-1644.239) [-1639.676] -- 0:00:53
282000 -- [-1639.257] (-1640.072) (-1642.084) (-1638.567) * (-1640.719) (-1642.906) [-1641.188] (-1641.647) -- 0:00:53
282500 -- [-1640.108] (-1639.145) (-1641.137) (-1642.723) * (-1641.294) [-1639.944] (-1641.682) (-1640.609) -- 0:00:53
283000 -- [-1638.861] (-1642.710) (-1641.139) (-1642.366) * (-1640.351) [-1639.789] (-1639.970) (-1639.062) -- 0:00:53
283500 -- (-1641.095) (-1641.577) [-1642.071] (-1638.720) * (-1639.114) (-1640.698) (-1641.323) [-1639.167] -- 0:00:53
284000 -- [-1640.869] (-1639.069) (-1641.947) (-1639.642) * (-1641.392) (-1644.473) (-1642.269) [-1640.967] -- 0:00:52
284500 -- [-1642.657] (-1640.840) (-1639.167) (-1641.671) * (-1639.446) (-1644.485) (-1640.537) [-1639.866] -- 0:00:52
285000 -- (-1641.194) [-1638.998] (-1640.941) (-1640.562) * [-1640.708] (-1640.785) (-1640.223) (-1642.369) -- 0:00:52
Average standard deviation of split frequencies: 0.013021
285500 -- (-1640.264) [-1639.564] (-1642.847) (-1639.046) * (-1640.160) (-1640.068) (-1640.989) [-1641.530] -- 0:00:52
286000 -- (-1639.968) (-1640.475) (-1638.308) [-1639.512] * (-1639.657) (-1640.346) [-1640.053] (-1642.547) -- 0:00:52
286500 -- (-1641.630) (-1638.543) [-1638.179] (-1638.932) * (-1640.157) (-1640.623) (-1640.089) [-1643.303] -- 0:00:52
287000 -- (-1644.967) [-1638.223] (-1638.586) (-1641.162) * (-1641.664) (-1639.731) [-1638.787] (-1640.299) -- 0:00:52
287500 -- [-1642.133] (-1638.098) (-1639.191) (-1639.883) * (-1640.079) [-1642.894] (-1638.255) (-1640.517) -- 0:00:52
288000 -- [-1640.419] (-1639.229) (-1638.970) (-1638.481) * (-1641.332) (-1639.458) (-1639.878) [-1639.539] -- 0:00:51
288500 -- (-1643.628) (-1640.032) [-1638.126] (-1639.157) * (-1639.739) [-1639.328] (-1640.276) (-1640.710) -- 0:00:51
289000 -- [-1641.405] (-1640.000) (-1638.124) (-1639.318) * (-1641.628) (-1642.419) [-1640.226] (-1640.606) -- 0:00:51
289500 -- (-1638.606) [-1639.396] (-1640.037) (-1639.211) * (-1641.214) (-1639.622) (-1640.289) [-1638.669] -- 0:00:51
290000 -- (-1638.063) (-1642.147) (-1640.185) [-1639.985] * (-1640.676) (-1638.506) (-1640.424) [-1638.260] -- 0:00:51
Average standard deviation of split frequencies: 0.012569
290500 -- (-1639.149) [-1640.843] (-1641.174) (-1641.341) * (-1640.853) [-1639.380] (-1644.040) (-1638.891) -- 0:00:51
291000 -- (-1638.985) (-1643.223) (-1646.852) [-1643.272] * (-1639.381) (-1639.843) [-1642.248] (-1639.376) -- 0:00:51
291500 -- (-1638.782) (-1642.155) [-1642.148] (-1639.023) * (-1640.070) (-1639.901) (-1639.316) [-1639.278] -- 0:00:53
292000 -- [-1638.504] (-1642.111) (-1638.164) (-1640.638) * (-1640.633) (-1639.434) (-1644.565) [-1639.117] -- 0:00:53
292500 -- (-1645.357) [-1639.561] (-1638.725) (-1640.592) * (-1639.365) (-1638.057) (-1643.183) [-1642.327] -- 0:00:53
293000 -- (-1651.432) (-1639.436) (-1639.640) [-1642.027] * (-1639.814) (-1638.498) (-1642.053) [-1640.989] -- 0:00:53
293500 -- [-1642.599] (-1640.841) (-1642.981) (-1640.922) * (-1639.601) [-1640.246] (-1641.720) (-1641.111) -- 0:00:52
294000 -- (-1643.768) [-1640.072] (-1640.542) (-1643.964) * [-1638.135] (-1641.381) (-1639.744) (-1639.653) -- 0:00:52
294500 -- (-1641.528) (-1639.863) [-1640.369] (-1638.591) * (-1638.390) (-1641.652) (-1639.934) [-1638.340] -- 0:00:52
295000 -- (-1639.841) (-1643.582) (-1640.203) [-1639.894] * (-1638.394) [-1643.013] (-1644.689) (-1640.114) -- 0:00:52
Average standard deviation of split frequencies: 0.013298
295500 -- [-1638.660] (-1642.120) (-1640.030) (-1645.020) * [-1639.254] (-1644.431) (-1645.173) (-1638.928) -- 0:00:52
296000 -- (-1642.380) (-1641.098) (-1638.648) [-1640.242] * (-1639.305) (-1642.154) (-1642.413) [-1640.841] -- 0:00:52
296500 -- [-1638.839] (-1639.927) (-1640.377) (-1640.814) * (-1638.500) (-1642.878) [-1640.821] (-1639.978) -- 0:00:52
297000 -- (-1639.034) [-1639.927] (-1640.306) (-1640.837) * (-1638.456) (-1642.232) [-1640.932] (-1638.456) -- 0:00:52
297500 -- (-1639.364) (-1638.849) [-1640.690] (-1638.952) * (-1638.555) (-1638.723) [-1641.688] (-1638.190) -- 0:00:51
298000 -- (-1641.902) (-1639.372) (-1640.088) [-1639.111] * (-1639.549) [-1640.438] (-1641.826) (-1643.444) -- 0:00:51
298500 -- (-1642.992) (-1639.031) (-1639.782) [-1640.076] * (-1642.282) [-1643.496] (-1642.914) (-1645.160) -- 0:00:51
299000 -- (-1639.559) [-1639.945] (-1639.656) (-1641.405) * [-1642.359] (-1641.449) (-1641.049) (-1646.292) -- 0:00:51
299500 -- [-1638.796] (-1641.073) (-1639.873) (-1639.177) * [-1640.774] (-1640.265) (-1641.725) (-1645.504) -- 0:00:51
300000 -- [-1641.874] (-1640.128) (-1639.319) (-1640.657) * [-1640.221] (-1639.231) (-1640.891) (-1640.819) -- 0:00:51
Average standard deviation of split frequencies: 0.014024
300500 -- (-1639.721) (-1640.003) (-1639.607) [-1641.066] * [-1639.188] (-1640.078) (-1641.108) (-1640.420) -- 0:00:51
301000 -- [-1639.657] (-1640.507) (-1641.373) (-1640.692) * [-1639.840] (-1640.022) (-1639.214) (-1640.598) -- 0:00:51
301500 -- (-1639.113) (-1640.515) (-1639.510) [-1641.233] * (-1639.540) [-1640.591] (-1640.296) (-1639.200) -- 0:00:50
302000 -- [-1639.250] (-1640.328) (-1640.306) (-1639.927) * [-1638.775] (-1644.733) (-1641.172) (-1639.723) -- 0:00:50
302500 -- (-1642.805) [-1638.325] (-1641.898) (-1641.707) * (-1639.565) [-1639.390] (-1641.436) (-1642.829) -- 0:00:50
303000 -- (-1640.727) [-1638.744] (-1640.455) (-1641.707) * (-1640.225) [-1640.016] (-1639.328) (-1643.073) -- 0:00:50
303500 -- (-1638.480) (-1638.607) (-1640.715) [-1639.512] * [-1639.741] (-1639.137) (-1639.629) (-1643.828) -- 0:00:50
304000 -- [-1638.312] (-1644.785) (-1641.764) (-1639.305) * [-1639.650] (-1645.748) (-1639.997) (-1641.007) -- 0:00:50
304500 -- (-1639.008) (-1641.195) [-1644.670] (-1638.882) * [-1639.890] (-1641.113) (-1640.034) (-1639.147) -- 0:00:52
305000 -- (-1641.311) (-1642.915) [-1645.272] (-1638.983) * (-1640.873) [-1642.643] (-1640.048) (-1639.665) -- 0:00:52
Average standard deviation of split frequencies: 0.013480
305500 -- (-1642.283) (-1646.484) (-1641.432) [-1639.122] * [-1639.987] (-1640.049) (-1644.629) (-1641.962) -- 0:00:52
306000 -- (-1640.272) (-1640.817) [-1641.007] (-1640.243) * (-1639.038) [-1639.217] (-1641.175) (-1641.406) -- 0:00:52
306500 -- [-1641.627] (-1639.059) (-1647.465) (-1642.265) * [-1641.036] (-1638.995) (-1641.632) (-1644.958) -- 0:00:52
307000 -- (-1639.407) [-1639.015] (-1640.221) (-1641.040) * (-1642.177) [-1638.695] (-1643.457) (-1643.756) -- 0:00:51
307500 -- [-1641.557] (-1639.034) (-1642.086) (-1640.648) * (-1642.682) (-1642.890) [-1641.035] (-1643.749) -- 0:00:51
308000 -- (-1642.942) (-1638.117) [-1639.546] (-1640.827) * [-1644.942] (-1642.933) (-1640.360) (-1640.630) -- 0:00:51
308500 -- (-1644.370) (-1638.196) [-1641.084] (-1644.643) * (-1643.387) [-1641.977] (-1644.210) (-1640.820) -- 0:00:51
309000 -- [-1644.608] (-1638.430) (-1638.322) (-1647.902) * [-1638.383] (-1643.256) (-1641.112) (-1641.837) -- 0:00:51
309500 -- (-1638.198) (-1639.015) [-1638.741] (-1644.466) * (-1638.429) (-1639.294) (-1639.312) [-1640.567] -- 0:00:51
310000 -- (-1639.084) [-1639.640] (-1638.257) (-1640.720) * (-1640.939) (-1640.563) [-1638.445] (-1639.853) -- 0:00:51
Average standard deviation of split frequencies: 0.013210
310500 -- (-1638.247) (-1640.331) [-1638.398] (-1641.356) * (-1639.297) (-1643.516) [-1638.018] (-1640.344) -- 0:00:51
311000 -- (-1638.499) [-1638.367] (-1638.572) (-1641.622) * [-1638.595] (-1641.339) (-1638.918) (-1638.191) -- 0:00:50
311500 -- [-1641.626] (-1638.500) (-1639.053) (-1642.855) * (-1638.898) (-1639.107) [-1640.049] (-1638.191) -- 0:00:50
312000 -- [-1638.922] (-1642.084) (-1640.441) (-1642.101) * [-1639.019] (-1643.951) (-1639.502) (-1639.143) -- 0:00:50
312500 -- [-1641.080] (-1643.019) (-1640.045) (-1640.643) * [-1638.924] (-1645.633) (-1638.507) (-1639.408) -- 0:00:50
313000 -- [-1638.427] (-1642.551) (-1642.738) (-1639.429) * (-1640.096) (-1644.023) (-1638.475) [-1643.109] -- 0:00:50
313500 -- (-1640.824) (-1642.020) (-1641.703) [-1641.637] * [-1640.305] (-1640.121) (-1639.387) (-1641.534) -- 0:00:50
314000 -- (-1641.563) (-1639.107) [-1642.139] (-1642.336) * [-1639.853] (-1640.565) (-1639.276) (-1642.568) -- 0:00:50
314500 -- (-1640.643) [-1638.872] (-1646.319) (-1639.493) * [-1643.455] (-1641.228) (-1639.939) (-1640.001) -- 0:00:50
315000 -- (-1644.706) (-1639.338) [-1642.022] (-1638.722) * [-1640.563] (-1640.458) (-1639.915) (-1640.213) -- 0:00:50
Average standard deviation of split frequencies: 0.013758
315500 -- (-1640.988) (-1640.319) (-1641.711) [-1640.953] * (-1641.887) (-1641.318) (-1639.186) [-1648.368] -- 0:00:49
316000 -- (-1639.380) (-1646.248) [-1641.159] (-1643.169) * [-1639.481] (-1640.298) (-1638.736) (-1647.872) -- 0:00:49
316500 -- (-1642.171) [-1640.524] (-1641.944) (-1641.244) * (-1643.084) (-1640.492) (-1639.122) [-1643.220] -- 0:00:49
317000 -- (-1651.604) [-1640.671] (-1641.963) (-1638.869) * (-1642.556) (-1639.281) (-1639.727) [-1640.838] -- 0:00:49
317500 -- (-1640.949) (-1641.045) (-1640.031) [-1640.453] * (-1643.161) (-1639.192) [-1641.155] (-1642.178) -- 0:00:49
318000 -- (-1639.631) (-1640.390) [-1639.735] (-1639.449) * (-1642.498) (-1639.193) [-1638.174] (-1640.268) -- 0:00:51
318500 -- (-1638.969) (-1640.564) (-1639.961) [-1638.205] * (-1642.371) (-1639.005) (-1640.473) [-1639.433] -- 0:00:51
319000 -- [-1640.138] (-1641.670) (-1639.886) (-1638.858) * (-1642.564) (-1640.368) (-1641.704) [-1639.132] -- 0:00:51
319500 -- (-1642.176) (-1642.044) [-1639.351] (-1639.207) * [-1640.538] (-1638.426) (-1642.035) (-1639.141) -- 0:00:51
320000 -- [-1639.118] (-1642.597) (-1638.986) (-1638.228) * (-1640.675) (-1638.964) [-1640.153] (-1640.198) -- 0:00:50
Average standard deviation of split frequencies: 0.014292
320500 -- (-1640.763) (-1642.051) (-1639.379) [-1639.286] * [-1641.566] (-1639.237) (-1640.878) (-1638.095) -- 0:00:50
321000 -- [-1638.577] (-1640.694) (-1641.640) (-1639.009) * (-1639.616) (-1640.523) (-1638.898) [-1640.040] -- 0:00:50
321500 -- [-1639.610] (-1640.180) (-1643.611) (-1642.448) * (-1641.763) (-1639.355) (-1638.433) [-1641.328] -- 0:00:50
322000 -- (-1646.838) [-1640.539] (-1644.532) (-1642.627) * (-1640.470) (-1638.388) (-1639.524) [-1641.612] -- 0:00:50
322500 -- (-1641.558) [-1642.418] (-1644.186) (-1638.339) * (-1639.295) [-1639.517] (-1639.456) (-1639.854) -- 0:00:50
323000 -- (-1642.781) (-1642.929) (-1641.586) [-1641.928] * (-1640.545) (-1639.561) (-1640.588) [-1639.636] -- 0:00:50
323500 -- (-1639.835) (-1642.893) (-1642.485) [-1638.690] * (-1638.257) [-1639.070] (-1639.121) (-1638.201) -- 0:00:50
324000 -- [-1639.669] (-1640.179) (-1642.812) (-1640.789) * [-1638.625] (-1638.334) (-1641.803) (-1638.545) -- 0:00:50
324500 -- (-1640.855) (-1641.808) (-1642.655) [-1639.839] * (-1639.699) (-1639.610) (-1640.474) [-1638.219] -- 0:00:49
325000 -- (-1642.090) (-1641.531) (-1640.499) [-1640.133] * (-1640.238) (-1639.514) [-1639.359] (-1639.944) -- 0:00:49
Average standard deviation of split frequencies: 0.014621
325500 -- (-1646.813) [-1638.214] (-1639.748) (-1639.444) * (-1641.498) [-1642.116] (-1641.149) (-1639.775) -- 0:00:49
326000 -- [-1640.994] (-1642.025) (-1641.443) (-1638.279) * (-1641.467) [-1641.117] (-1640.566) (-1638.425) -- 0:00:49
326500 -- [-1639.411] (-1640.562) (-1643.288) (-1638.308) * (-1642.104) (-1641.160) (-1639.579) [-1639.513] -- 0:00:49
327000 -- (-1640.510) [-1639.955] (-1640.660) (-1640.219) * (-1640.361) (-1643.828) [-1640.346] (-1640.993) -- 0:00:49
327500 -- (-1641.465) (-1639.095) [-1640.588] (-1642.657) * (-1641.918) (-1642.367) (-1640.228) [-1642.176] -- 0:00:49
328000 -- (-1642.133) (-1640.537) (-1639.424) [-1638.970] * (-1641.882) [-1639.682] (-1639.050) (-1641.779) -- 0:00:49
328500 -- (-1639.861) [-1638.805] (-1640.426) (-1640.191) * [-1639.021] (-1639.340) (-1638.847) (-1642.106) -- 0:00:49
329000 -- (-1639.511) (-1642.025) [-1643.346] (-1646.169) * (-1639.176) (-1639.022) (-1638.619) [-1640.417] -- 0:00:48
329500 -- [-1639.423] (-1638.728) (-1643.382) (-1639.888) * (-1640.323) [-1638.519] (-1638.354) (-1640.194) -- 0:00:48
330000 -- (-1639.765) (-1638.519) (-1641.869) [-1641.100] * (-1646.066) (-1638.239) [-1638.513] (-1648.114) -- 0:00:48
Average standard deviation of split frequencies: 0.014811
330500 -- (-1642.304) [-1638.805] (-1643.513) (-1639.611) * (-1640.101) (-1639.838) (-1640.767) [-1642.636] -- 0:00:48
331000 -- [-1645.515] (-1642.257) (-1642.958) (-1646.745) * (-1640.578) (-1640.307) (-1639.624) [-1639.255] -- 0:00:48
331500 -- [-1640.221] (-1641.255) (-1639.692) (-1639.312) * (-1639.360) [-1639.642] (-1642.066) (-1640.132) -- 0:00:50
332000 -- (-1639.096) (-1640.332) (-1639.083) [-1640.362] * [-1638.886] (-1639.355) (-1639.844) (-1641.413) -- 0:00:50
332500 -- (-1640.689) (-1639.706) (-1640.140) [-1641.482] * (-1640.178) [-1642.848] (-1641.925) (-1643.777) -- 0:00:50
333000 -- [-1640.872] (-1640.210) (-1641.221) (-1640.547) * (-1641.167) (-1640.381) [-1641.316] (-1639.706) -- 0:00:50
333500 -- (-1638.898) [-1639.583] (-1642.993) (-1639.088) * (-1639.606) (-1641.734) (-1639.852) [-1639.826] -- 0:00:49
334000 -- [-1639.908] (-1640.805) (-1639.684) (-1642.088) * (-1639.169) (-1642.097) (-1640.903) [-1638.140] -- 0:00:49
334500 -- [-1642.572] (-1642.117) (-1640.448) (-1639.882) * (-1638.985) (-1641.348) [-1640.686] (-1638.182) -- 0:00:49
335000 -- [-1640.064] (-1639.971) (-1639.347) (-1642.584) * [-1638.305] (-1642.189) (-1640.244) (-1638.480) -- 0:00:49
Average standard deviation of split frequencies: 0.015199
335500 -- [-1639.111] (-1640.682) (-1641.022) (-1639.190) * (-1638.776) (-1641.146) (-1640.733) [-1640.295] -- 0:00:49
336000 -- (-1638.438) [-1640.706] (-1641.462) (-1638.818) * (-1641.882) [-1640.079] (-1639.186) (-1643.288) -- 0:00:49
336500 -- (-1638.573) (-1640.954) [-1639.635] (-1639.834) * (-1638.477) [-1640.789] (-1639.925) (-1642.024) -- 0:00:49
337000 -- [-1638.123] (-1638.861) (-1639.484) (-1638.652) * (-1639.896) (-1640.156) [-1645.302] (-1642.296) -- 0:00:49
337500 -- (-1637.951) (-1639.108) [-1638.590] (-1641.641) * (-1640.669) [-1638.934] (-1644.072) (-1640.926) -- 0:00:49
338000 -- (-1640.856) (-1640.292) (-1641.026) [-1640.772] * (-1639.752) (-1637.913) (-1640.905) [-1641.706] -- 0:00:48
338500 -- [-1639.976] (-1642.042) (-1639.196) (-1641.247) * (-1638.703) [-1642.959] (-1640.812) (-1638.395) -- 0:00:48
339000 -- (-1639.398) [-1642.530] (-1639.260) (-1641.473) * [-1641.227] (-1642.351) (-1640.655) (-1640.979) -- 0:00:48
339500 -- (-1638.979) (-1641.205) [-1639.469] (-1643.053) * [-1640.667] (-1642.485) (-1638.694) (-1641.988) -- 0:00:48
340000 -- (-1638.728) [-1640.851] (-1639.205) (-1639.550) * (-1641.725) (-1641.101) [-1638.645] (-1641.173) -- 0:00:48
Average standard deviation of split frequencies: 0.014652
340500 -- (-1641.916) (-1639.683) (-1639.362) [-1639.766] * (-1639.736) (-1639.358) (-1640.157) [-1639.855] -- 0:00:48
341000 -- [-1638.684] (-1642.360) (-1639.511) (-1639.448) * [-1639.725] (-1643.244) (-1641.421) (-1638.867) -- 0:00:48
341500 -- [-1639.000] (-1640.753) (-1641.428) (-1638.868) * (-1639.310) (-1640.755) (-1643.285) [-1638.798] -- 0:00:48
342000 -- (-1641.668) (-1644.791) (-1639.833) [-1639.108] * (-1640.045) (-1641.277) [-1642.907] (-1639.202) -- 0:00:48
342500 -- (-1639.698) (-1639.617) [-1639.404] (-1639.968) * (-1643.317) (-1639.160) (-1638.673) [-1639.321] -- 0:00:47
343000 -- (-1643.780) [-1639.268] (-1639.506) (-1640.813) * (-1640.852) [-1643.015] (-1641.276) (-1641.795) -- 0:00:47
343500 -- (-1643.896) [-1639.567] (-1641.598) (-1645.002) * (-1641.998) (-1640.878) (-1638.999) [-1638.474] -- 0:00:47
344000 -- (-1640.940) [-1638.693] (-1643.799) (-1646.798) * (-1641.270) (-1639.287) (-1638.904) [-1638.372] -- 0:00:47
344500 -- [-1638.817] (-1640.022) (-1641.771) (-1640.277) * [-1638.616] (-1639.087) (-1639.046) (-1638.388) -- 0:00:47
345000 -- (-1638.423) (-1641.322) (-1640.594) [-1641.678] * (-1638.974) [-1639.309] (-1639.368) (-1638.853) -- 0:00:49
Average standard deviation of split frequencies: 0.014907
345500 -- [-1640.381] (-1643.249) (-1640.583) (-1639.135) * (-1640.502) (-1641.169) (-1640.145) [-1639.316] -- 0:00:49
346000 -- (-1638.969) (-1643.551) [-1639.313] (-1640.905) * (-1648.198) [-1638.995] (-1639.996) (-1642.781) -- 0:00:49
346500 -- (-1638.906) [-1642.720] (-1641.768) (-1641.769) * (-1646.444) [-1638.848] (-1640.252) (-1638.301) -- 0:00:49
347000 -- (-1640.299) (-1642.036) [-1638.602] (-1639.956) * (-1638.400) [-1639.265] (-1641.047) (-1638.260) -- 0:00:48
347500 -- (-1640.126) (-1640.373) [-1639.451] (-1640.139) * [-1639.649] (-1640.059) (-1639.608) (-1639.356) -- 0:00:48
348000 -- (-1639.891) [-1640.971] (-1639.451) (-1640.639) * (-1639.072) [-1641.152] (-1639.630) (-1641.530) -- 0:00:48
348500 -- (-1639.764) [-1638.924] (-1639.472) (-1641.214) * [-1639.354] (-1642.507) (-1638.292) (-1642.410) -- 0:00:48
349000 -- (-1641.172) (-1643.798) (-1638.604) [-1640.090] * (-1639.966) [-1639.718] (-1638.207) (-1641.124) -- 0:00:48
349500 -- (-1648.586) (-1641.370) [-1638.707] (-1641.199) * (-1640.814) (-1639.901) [-1643.693] (-1646.873) -- 0:00:48
350000 -- [-1640.589] (-1642.403) (-1640.531) (-1639.740) * (-1644.315) (-1644.589) [-1640.561] (-1642.518) -- 0:00:48
Average standard deviation of split frequencies: 0.014471
350500 -- (-1642.123) [-1640.056] (-1639.230) (-1641.966) * (-1641.679) (-1647.432) [-1640.241] (-1640.558) -- 0:00:48
351000 -- [-1641.587] (-1641.050) (-1641.095) (-1641.131) * (-1644.107) (-1641.684) [-1639.508] (-1641.734) -- 0:00:48
351500 -- (-1640.878) (-1640.731) [-1638.928] (-1640.188) * (-1648.083) (-1642.194) (-1638.861) [-1640.775] -- 0:00:47
352000 -- (-1644.106) [-1640.750] (-1642.742) (-1640.398) * (-1638.284) (-1639.502) [-1639.598] (-1639.878) -- 0:00:47
352500 -- (-1643.612) (-1639.990) [-1638.768] (-1643.753) * [-1638.284] (-1641.802) (-1640.538) (-1642.435) -- 0:00:47
353000 -- [-1641.581] (-1641.207) (-1638.821) (-1638.722) * (-1638.274) (-1640.280) (-1640.950) [-1648.469] -- 0:00:47
353500 -- [-1640.075] (-1639.598) (-1639.776) (-1638.338) * (-1638.682) (-1641.948) [-1639.577] (-1644.079) -- 0:00:47
354000 -- (-1641.335) [-1639.846] (-1638.238) (-1639.193) * (-1639.634) [-1640.020] (-1642.239) (-1638.826) -- 0:00:47
354500 -- (-1641.520) (-1639.573) [-1638.188] (-1638.544) * (-1639.989) (-1641.591) (-1641.726) [-1639.161] -- 0:00:47
355000 -- (-1638.600) (-1640.176) (-1639.826) [-1638.293] * (-1639.860) [-1641.045] (-1641.685) (-1640.830) -- 0:00:47
Average standard deviation of split frequencies: 0.014254
355500 -- (-1639.790) (-1640.693) (-1641.886) [-1639.483] * (-1640.129) [-1639.279] (-1643.438) (-1640.932) -- 0:00:47
356000 -- (-1638.003) (-1639.849) [-1642.008] (-1640.315) * (-1641.106) (-1639.156) [-1642.831] (-1639.002) -- 0:00:47
356500 -- [-1638.701] (-1639.641) (-1643.548) (-1644.008) * (-1639.188) (-1643.527) (-1643.396) [-1640.764] -- 0:00:46
357000 -- [-1639.168] (-1640.826) (-1641.189) (-1642.478) * (-1641.051) [-1641.438] (-1643.159) (-1642.503) -- 0:00:46
357500 -- (-1640.018) (-1639.827) (-1643.181) [-1639.858] * (-1641.678) (-1641.232) [-1639.415] (-1644.559) -- 0:00:46
358000 -- (-1643.269) [-1640.401] (-1641.010) (-1638.896) * (-1640.335) (-1641.524) (-1641.722) [-1640.073] -- 0:00:46
358500 -- (-1638.334) [-1642.501] (-1640.695) (-1639.881) * (-1640.688) (-1639.189) [-1639.454] (-1644.967) -- 0:00:48
359000 -- (-1639.985) [-1640.202] (-1641.173) (-1640.036) * (-1641.079) [-1642.123] (-1639.485) (-1640.655) -- 0:00:48
359500 -- (-1640.493) [-1642.694] (-1640.192) (-1638.255) * [-1639.595] (-1644.154) (-1638.449) (-1640.955) -- 0:00:48
360000 -- (-1643.014) (-1638.982) [-1638.879] (-1638.980) * [-1638.692] (-1642.931) (-1638.793) (-1638.882) -- 0:00:47
Average standard deviation of split frequencies: 0.014377
360500 -- (-1639.656) [-1639.440] (-1639.466) (-1638.879) * (-1641.610) (-1647.048) (-1642.471) [-1639.659] -- 0:00:47
361000 -- (-1640.209) (-1640.767) [-1640.071] (-1639.969) * [-1638.530] (-1641.972) (-1641.582) (-1639.765) -- 0:00:47
361500 -- (-1642.762) (-1638.836) [-1641.117] (-1639.029) * [-1638.530] (-1644.599) (-1643.970) (-1641.274) -- 0:00:47
362000 -- [-1641.033] (-1638.315) (-1639.233) (-1639.169) * [-1641.665] (-1641.554) (-1648.437) (-1645.071) -- 0:00:47
362500 -- (-1640.433) [-1638.733] (-1643.364) (-1639.762) * [-1641.643] (-1641.809) (-1646.068) (-1639.222) -- 0:00:47
363000 -- (-1639.239) (-1640.709) [-1640.985] (-1641.364) * (-1639.989) [-1641.522] (-1649.945) (-1638.318) -- 0:00:47
363500 -- (-1643.204) (-1645.334) [-1640.170] (-1640.765) * (-1638.611) (-1641.208) (-1646.670) [-1638.318] -- 0:00:47
364000 -- (-1639.485) (-1645.834) (-1639.642) [-1639.889] * [-1643.246] (-1639.503) (-1648.261) (-1641.026) -- 0:00:47
364500 -- [-1640.925] (-1642.218) (-1638.922) (-1640.468) * (-1642.450) (-1640.876) (-1643.769) [-1639.893] -- 0:00:47
365000 -- (-1640.033) (-1638.186) [-1639.192] (-1641.236) * (-1644.449) (-1643.247) [-1642.687] (-1639.769) -- 0:00:46
Average standard deviation of split frequencies: 0.013638
365500 -- (-1640.274) (-1638.321) [-1640.235] (-1643.404) * (-1644.840) (-1639.680) (-1639.159) [-1640.607] -- 0:00:46
366000 -- (-1639.372) (-1640.949) (-1641.455) [-1640.110] * (-1639.993) (-1642.566) [-1638.716] (-1643.340) -- 0:00:46
366500 -- (-1640.784) (-1639.103) (-1642.929) [-1640.465] * [-1641.733] (-1641.324) (-1638.499) (-1642.733) -- 0:00:46
367000 -- [-1640.510] (-1639.237) (-1641.679) (-1640.872) * (-1641.182) [-1641.487] (-1639.591) (-1640.778) -- 0:00:46
367500 -- (-1641.245) (-1638.550) (-1645.774) [-1640.433] * [-1640.161] (-1640.813) (-1642.143) (-1639.155) -- 0:00:46
368000 -- (-1640.204) (-1639.081) [-1642.491] (-1640.680) * [-1638.942] (-1640.829) (-1639.498) (-1638.911) -- 0:00:46
368500 -- (-1639.909) (-1638.350) (-1640.070) [-1638.962] * (-1639.787) [-1639.167] (-1643.449) (-1641.167) -- 0:00:46
369000 -- (-1643.128) (-1638.385) [-1638.556] (-1641.037) * (-1639.002) [-1639.627] (-1640.296) (-1642.371) -- 0:00:46
369500 -- (-1638.319) (-1641.145) (-1640.569) [-1638.910] * (-1638.487) [-1642.046] (-1640.352) (-1642.285) -- 0:00:46
370000 -- [-1641.094] (-1646.658) (-1640.712) (-1641.551) * [-1639.903] (-1641.728) (-1639.890) (-1639.331) -- 0:00:45
Average standard deviation of split frequencies: 0.012793
370500 -- (-1639.916) (-1651.576) [-1640.161] (-1638.540) * (-1639.611) [-1639.712] (-1639.304) (-1641.414) -- 0:00:45
371000 -- (-1641.621) (-1643.181) [-1640.206] (-1638.994) * (-1638.584) (-1639.089) (-1638.950) [-1640.123] -- 0:00:45
371500 -- (-1643.729) (-1640.193) [-1641.258] (-1639.861) * [-1641.878] (-1639.645) (-1638.426) (-1638.876) -- 0:00:45
372000 -- (-1640.411) [-1639.121] (-1639.081) (-1639.816) * (-1639.095) (-1639.482) (-1639.873) [-1638.588] -- 0:00:47
372500 -- (-1638.692) (-1640.093) [-1640.292] (-1639.028) * (-1638.425) [-1639.448] (-1639.707) (-1638.901) -- 0:00:47
373000 -- (-1640.368) [-1639.362] (-1639.508) (-1643.133) * (-1638.374) [-1640.498] (-1640.752) (-1642.369) -- 0:00:47
373500 -- (-1640.000) (-1640.637) (-1639.015) [-1642.056] * [-1638.373] (-1639.548) (-1641.080) (-1641.334) -- 0:00:46
374000 -- (-1639.615) [-1639.601] (-1638.813) (-1642.979) * (-1640.214) (-1641.249) (-1639.739) [-1640.829] -- 0:00:46
374500 -- (-1640.713) [-1639.068] (-1640.325) (-1640.980) * (-1640.690) [-1640.066] (-1638.494) (-1640.628) -- 0:00:46
375000 -- (-1639.729) (-1638.227) (-1638.854) [-1638.970] * [-1642.661] (-1640.692) (-1639.801) (-1640.172) -- 0:00:46
Average standard deviation of split frequencies: 0.013717
375500 -- (-1640.513) (-1639.472) (-1638.847) [-1639.997] * (-1640.001) [-1639.340] (-1639.179) (-1639.193) -- 0:00:46
376000 -- (-1638.926) [-1639.714] (-1640.219) (-1640.825) * (-1639.369) (-1639.909) (-1641.416) [-1639.124] -- 0:00:46
376500 -- (-1640.870) (-1639.714) (-1640.788) [-1644.238] * (-1637.925) [-1639.278] (-1640.792) (-1639.015) -- 0:00:46
377000 -- (-1641.194) (-1639.655) [-1639.290] (-1642.451) * [-1639.377] (-1639.308) (-1640.329) (-1639.105) -- 0:00:46
377500 -- [-1639.902] (-1638.603) (-1641.005) (-1641.768) * (-1640.174) (-1640.128) [-1639.932] (-1638.669) -- 0:00:46
378000 -- (-1640.876) [-1639.008] (-1639.426) (-1639.094) * (-1642.538) (-1639.122) (-1640.736) [-1638.775] -- 0:00:46
378500 -- (-1640.028) [-1642.525] (-1638.593) (-1642.818) * (-1642.121) (-1639.101) [-1640.712] (-1640.518) -- 0:00:45
379000 -- (-1642.489) (-1639.638) (-1639.618) [-1638.838] * (-1641.205) (-1641.801) (-1639.457) [-1639.103] -- 0:00:45
379500 -- (-1643.074) (-1638.619) [-1639.343] (-1639.478) * (-1638.936) (-1638.612) (-1639.889) [-1639.106] -- 0:00:45
380000 -- (-1641.531) (-1638.569) (-1640.645) [-1643.962] * [-1639.929] (-1642.882) (-1641.723) (-1639.164) -- 0:00:45
Average standard deviation of split frequencies: 0.013913
380500 -- [-1639.311] (-1640.096) (-1639.908) (-1640.465) * (-1640.664) (-1638.164) [-1638.934] (-1643.488) -- 0:00:45
381000 -- (-1639.032) (-1640.996) [-1639.892] (-1639.629) * (-1638.119) [-1640.830] (-1641.404) (-1640.684) -- 0:00:45
381500 -- [-1638.755] (-1641.662) (-1639.868) (-1640.872) * (-1639.721) (-1642.133) [-1640.032] (-1639.023) -- 0:00:45
382000 -- (-1642.624) (-1644.358) (-1641.485) [-1641.720] * (-1641.346) (-1639.986) (-1638.569) [-1641.732] -- 0:00:45
382500 -- (-1642.086) [-1641.002] (-1641.302) (-1642.149) * (-1639.269) (-1640.742) (-1640.629) [-1640.548] -- 0:00:45
383000 -- (-1643.825) [-1639.260] (-1640.440) (-1638.795) * (-1641.082) (-1639.519) (-1640.845) [-1640.733] -- 0:00:45
383500 -- (-1640.286) [-1638.732] (-1639.136) (-1638.827) * (-1640.965) [-1641.216] (-1641.644) (-1641.197) -- 0:00:45
384000 -- (-1641.328) (-1638.682) [-1643.428] (-1640.013) * (-1640.863) (-1639.345) (-1641.186) [-1638.666] -- 0:00:44
384500 -- (-1643.419) (-1639.977) (-1642.186) [-1640.201] * (-1641.354) (-1639.979) (-1639.986) [-1642.521] -- 0:00:44
385000 -- (-1641.283) (-1640.485) [-1642.897] (-1638.634) * [-1638.837] (-1641.408) (-1642.541) (-1640.351) -- 0:00:44
Average standard deviation of split frequencies: 0.013937
385500 -- (-1638.681) (-1640.187) [-1641.545] (-1640.242) * [-1639.765] (-1642.379) (-1640.735) (-1639.536) -- 0:00:46
386000 -- (-1639.218) (-1639.624) (-1639.422) [-1640.345] * [-1638.855] (-1639.651) (-1637.999) (-1640.557) -- 0:00:46
386500 -- (-1640.429) [-1639.358] (-1642.074) (-1640.250) * (-1641.213) (-1640.283) (-1640.001) [-1639.117] -- 0:00:46
387000 -- (-1641.402) (-1639.399) (-1639.015) [-1639.125] * (-1642.411) [-1639.184] (-1643.495) (-1639.798) -- 0:00:45
387500 -- (-1642.152) (-1642.530) [-1638.725] (-1644.668) * (-1639.944) (-1644.684) (-1641.407) [-1639.539] -- 0:00:45
388000 -- (-1640.733) [-1641.992] (-1641.233) (-1638.830) * [-1640.413] (-1647.006) (-1640.386) (-1641.286) -- 0:00:45
388500 -- (-1640.617) (-1643.709) (-1639.942) [-1638.847] * (-1644.345) (-1642.245) (-1640.744) [-1640.077] -- 0:00:45
389000 -- (-1641.155) (-1643.309) (-1639.442) [-1638.351] * (-1639.302) (-1642.032) [-1640.158] (-1641.820) -- 0:00:45
389500 -- [-1640.524] (-1641.440) (-1640.032) (-1638.959) * (-1639.542) (-1639.339) [-1638.911] (-1641.336) -- 0:00:45
390000 -- [-1640.423] (-1639.143) (-1640.057) (-1641.335) * (-1639.740) [-1639.164] (-1638.951) (-1640.186) -- 0:00:45
Average standard deviation of split frequencies: 0.012776
390500 -- (-1640.350) [-1640.670] (-1639.902) (-1638.798) * (-1641.262) (-1639.261) (-1639.134) [-1638.284] -- 0:00:45
391000 -- (-1640.350) (-1644.935) (-1640.051) [-1639.940] * (-1641.526) [-1642.069] (-1638.859) (-1638.134) -- 0:00:45
391500 -- (-1638.223) (-1638.985) (-1643.369) [-1639.036] * (-1644.949) (-1644.047) (-1640.218) [-1638.336] -- 0:00:45
392000 -- (-1640.290) [-1639.932] (-1642.299) (-1640.448) * (-1639.363) (-1642.750) (-1639.952) [-1640.656] -- 0:00:44
392500 -- (-1639.616) (-1641.935) (-1641.337) [-1640.988] * (-1643.067) [-1638.165] (-1638.671) (-1639.948) -- 0:00:44
393000 -- (-1638.912) (-1646.943) [-1641.071] (-1640.634) * (-1644.044) [-1638.165] (-1639.352) (-1641.298) -- 0:00:44
393500 -- (-1639.483) [-1640.629] (-1640.781) (-1641.076) * [-1639.479] (-1638.567) (-1641.669) (-1638.170) -- 0:00:44
394000 -- [-1638.504] (-1641.572) (-1639.115) (-1639.895) * (-1640.033) [-1638.847] (-1642.169) (-1640.486) -- 0:00:44
394500 -- [-1639.603] (-1640.191) (-1642.362) (-1639.309) * [-1640.458] (-1640.356) (-1639.027) (-1640.158) -- 0:00:44
395000 -- (-1638.708) (-1641.398) [-1643.488] (-1640.054) * (-1641.042) (-1646.740) [-1640.755] (-1645.245) -- 0:00:44
Average standard deviation of split frequencies: 0.012324
395500 -- (-1639.672) (-1641.309) (-1640.847) [-1639.999] * (-1640.075) [-1641.058] (-1643.784) (-1645.083) -- 0:00:44
396000 -- [-1638.768] (-1639.757) (-1640.855) (-1639.751) * (-1642.270) (-1641.650) (-1639.106) [-1642.929] -- 0:00:44
396500 -- (-1638.990) (-1639.469) [-1639.350] (-1640.001) * (-1644.454) (-1639.551) (-1638.443) [-1642.120] -- 0:00:44
397000 -- (-1638.325) [-1638.328] (-1643.457) (-1639.934) * [-1643.788] (-1642.201) (-1639.860) (-1646.918) -- 0:00:44
397500 -- (-1638.500) (-1641.084) (-1639.948) [-1638.960] * (-1647.806) [-1640.606] (-1639.774) (-1641.695) -- 0:00:43
398000 -- (-1638.800) (-1639.833) (-1640.149) [-1642.037] * (-1643.155) [-1640.049] (-1640.717) (-1641.466) -- 0:00:43
398500 -- (-1639.153) (-1641.684) (-1638.751) [-1641.453] * [-1639.268] (-1640.802) (-1641.774) (-1639.404) -- 0:00:45
399000 -- (-1639.207) (-1640.797) (-1638.635) [-1641.415] * [-1638.209] (-1639.807) (-1641.274) (-1641.627) -- 0:00:45
399500 -- (-1639.058) (-1640.335) [-1638.666] (-1644.213) * (-1638.313) (-1640.409) [-1643.763] (-1640.297) -- 0:00:45
400000 -- (-1638.605) (-1640.064) (-1638.741) [-1638.771] * (-1639.264) [-1640.976] (-1641.894) (-1639.234) -- 0:00:44
Average standard deviation of split frequencies: 0.012280
400500 -- (-1638.605) (-1639.326) (-1638.928) [-1639.307] * (-1639.252) (-1640.235) [-1640.081] (-1638.422) -- 0:00:44
401000 -- (-1640.352) (-1639.138) (-1641.986) [-1638.897] * (-1639.259) (-1640.275) (-1642.395) [-1638.422] -- 0:00:44
401500 -- (-1645.311) (-1640.311) (-1639.843) [-1639.084] * (-1639.202) (-1641.090) (-1641.701) [-1640.314] -- 0:00:44
402000 -- (-1642.958) (-1640.617) [-1638.781] (-1638.789) * (-1639.139) (-1641.129) (-1641.450) [-1639.278] -- 0:00:44
402500 -- (-1640.781) [-1643.223] (-1638.971) (-1643.645) * (-1639.715) (-1649.500) [-1640.267] (-1641.293) -- 0:00:44
403000 -- (-1640.610) [-1641.909] (-1640.039) (-1643.780) * (-1642.880) [-1640.758] (-1639.652) (-1641.413) -- 0:00:44
403500 -- [-1638.723] (-1641.865) (-1641.290) (-1644.623) * (-1640.391) [-1641.732] (-1640.541) (-1639.895) -- 0:00:44
404000 -- (-1639.403) [-1638.652] (-1639.529) (-1641.596) * (-1640.824) (-1640.809) (-1638.489) [-1639.667] -- 0:00:44
404500 -- (-1638.488) [-1640.877] (-1640.967) (-1641.540) * [-1641.098] (-1641.465) (-1641.288) (-1644.026) -- 0:00:44
405000 -- (-1641.886) (-1640.066) (-1640.524) [-1641.935] * (-1641.384) (-1641.405) (-1642.786) [-1639.383] -- 0:00:44
Average standard deviation of split frequencies: 0.012482
405500 -- (-1640.499) (-1638.930) (-1640.462) [-1640.042] * (-1642.033) [-1639.112] (-1639.839) (-1642.657) -- 0:00:43
406000 -- [-1640.455] (-1640.992) (-1640.932) (-1641.941) * [-1640.329] (-1639.378) (-1646.496) (-1639.891) -- 0:00:43
406500 -- (-1639.869) (-1643.473) (-1639.514) [-1640.244] * (-1640.164) [-1641.188] (-1641.969) (-1640.436) -- 0:00:43
407000 -- (-1639.999) (-1640.938) [-1641.271] (-1639.977) * [-1640.095] (-1640.456) (-1643.792) (-1638.948) -- 0:00:43
407500 -- (-1641.645) (-1644.562) (-1638.836) [-1641.003] * (-1640.398) (-1640.091) [-1640.937] (-1638.947) -- 0:00:43
408000 -- (-1642.596) [-1641.316] (-1640.407) (-1638.212) * [-1643.307] (-1639.933) (-1638.617) (-1639.126) -- 0:00:43
408500 -- [-1638.643] (-1642.656) (-1642.153) (-1638.427) * (-1639.422) (-1639.106) (-1644.049) [-1642.512] -- 0:00:43
409000 -- (-1638.759) [-1644.016] (-1639.918) (-1638.414) * (-1639.088) [-1638.757] (-1644.116) (-1640.202) -- 0:00:43
409500 -- (-1638.795) (-1639.466) [-1638.259] (-1639.570) * (-1640.349) [-1639.103] (-1639.137) (-1639.172) -- 0:00:43
410000 -- (-1639.292) (-1639.960) (-1639.133) [-1640.945] * (-1639.545) [-1639.102] (-1640.704) (-1638.450) -- 0:00:43
Average standard deviation of split frequencies: 0.011981
410500 -- (-1639.344) (-1643.098) (-1640.154) [-1639.254] * (-1639.692) (-1638.653) (-1645.334) [-1640.591] -- 0:00:43
411000 -- (-1639.574) (-1645.579) (-1640.147) [-1639.462] * (-1642.970) [-1638.335] (-1640.225) (-1639.387) -- 0:00:42
411500 -- [-1640.230] (-1640.097) (-1640.462) (-1639.150) * (-1645.099) [-1638.948] (-1638.737) (-1641.932) -- 0:00:42
412000 -- (-1638.152) (-1638.781) (-1639.603) [-1638.275] * (-1642.044) (-1638.336) (-1640.026) [-1639.834] -- 0:00:44
412500 -- [-1640.238] (-1639.971) (-1639.516) (-1640.742) * (-1641.572) (-1638.399) [-1640.853] (-1643.138) -- 0:00:44
413000 -- (-1641.330) [-1639.015] (-1641.368) (-1641.467) * [-1641.843] (-1638.735) (-1639.053) (-1641.666) -- 0:00:44
413500 -- [-1641.712] (-1640.416) (-1642.315) (-1639.837) * (-1642.765) (-1639.204) [-1639.329] (-1638.931) -- 0:00:43
414000 -- [-1642.184] (-1640.826) (-1640.480) (-1639.236) * (-1643.376) [-1639.789] (-1643.365) (-1639.211) -- 0:00:43
414500 -- [-1638.823] (-1640.389) (-1643.929) (-1640.852) * (-1644.284) (-1640.914) (-1641.358) [-1638.907] -- 0:00:43
415000 -- (-1639.704) (-1640.486) [-1638.888] (-1642.016) * (-1639.813) (-1639.124) (-1638.530) [-1639.097] -- 0:00:43
Average standard deviation of split frequencies: 0.011615
415500 -- (-1639.060) (-1639.771) (-1640.540) [-1641.718] * [-1639.073] (-1641.219) (-1638.480) (-1639.095) -- 0:00:43
416000 -- [-1638.782] (-1639.408) (-1640.586) (-1639.583) * (-1641.804) (-1639.577) (-1638.099) [-1638.960] -- 0:00:43
416500 -- [-1639.517] (-1643.522) (-1638.939) (-1638.624) * (-1638.314) [-1639.969] (-1638.858) (-1639.611) -- 0:00:43
417000 -- (-1641.540) (-1644.154) (-1640.924) [-1638.159] * [-1638.451] (-1642.050) (-1639.153) (-1640.503) -- 0:00:43
417500 -- (-1641.200) (-1645.350) [-1639.157] (-1639.339) * (-1641.284) (-1639.511) [-1639.184] (-1640.338) -- 0:00:43
418000 -- (-1643.010) (-1641.828) [-1643.868] (-1638.236) * (-1640.839) [-1644.002] (-1638.899) (-1640.263) -- 0:00:43
418500 -- [-1645.378] (-1640.690) (-1640.614) (-1638.178) * (-1642.552) (-1641.316) [-1641.481] (-1642.489) -- 0:00:43
419000 -- [-1642.894] (-1643.266) (-1640.955) (-1639.920) * (-1640.895) (-1644.787) (-1640.500) [-1640.310] -- 0:00:42
419500 -- [-1640.179] (-1642.560) (-1639.533) (-1641.918) * [-1640.125] (-1642.374) (-1639.140) (-1643.913) -- 0:00:42
420000 -- (-1641.429) [-1639.934] (-1640.304) (-1640.558) * (-1640.099) (-1643.449) [-1638.978] (-1641.109) -- 0:00:42
Average standard deviation of split frequencies: 0.010926
420500 -- (-1641.282) (-1643.458) (-1640.089) [-1640.801] * (-1642.004) (-1640.484) [-1638.096] (-1639.863) -- 0:00:42
421000 -- (-1643.627) (-1646.230) [-1638.273] (-1640.892) * (-1644.504) (-1639.791) (-1638.542) [-1642.428] -- 0:00:42
421500 -- (-1642.748) (-1644.933) [-1639.091] (-1641.758) * (-1639.717) (-1639.083) [-1638.702] (-1643.649) -- 0:00:42
422000 -- (-1642.319) (-1643.249) (-1639.063) [-1642.219] * (-1642.926) [-1640.173] (-1642.326) (-1641.727) -- 0:00:42
422500 -- (-1639.945) [-1642.285] (-1641.073) (-1638.892) * (-1642.485) (-1642.592) (-1641.321) [-1640.464] -- 0:00:42
423000 -- (-1639.569) [-1642.015] (-1639.465) (-1638.625) * (-1642.599) [-1638.374] (-1639.411) (-1640.785) -- 0:00:42
423500 -- (-1639.707) (-1640.697) (-1641.839) [-1640.324] * (-1639.684) (-1638.375) (-1639.466) [-1642.069] -- 0:00:42
424000 -- (-1643.884) (-1640.283) (-1641.928) [-1642.680] * (-1646.165) [-1639.551] (-1640.743) (-1640.938) -- 0:00:42
424500 -- (-1644.904) (-1639.572) [-1639.752] (-1641.585) * (-1639.163) [-1640.114] (-1642.844) (-1641.586) -- 0:00:42
425000 -- [-1641.521] (-1639.789) (-1642.463) (-1640.165) * (-1639.411) (-1640.080) (-1642.963) [-1642.298] -- 0:00:43
Average standard deviation of split frequencies: 0.010305
425500 -- (-1642.091) (-1641.300) (-1638.732) [-1639.459] * (-1642.366) [-1643.007] (-1641.778) (-1648.518) -- 0:00:43
426000 -- (-1640.803) [-1640.124] (-1639.276) (-1641.210) * (-1642.104) [-1642.527] (-1638.805) (-1641.164) -- 0:00:43
426500 -- [-1639.233] (-1639.222) (-1639.776) (-1642.103) * (-1641.175) (-1644.113) [-1638.400] (-1638.960) -- 0:00:43
427000 -- (-1639.764) (-1642.242) (-1640.641) [-1638.410] * (-1641.680) (-1641.210) (-1641.751) [-1639.064] -- 0:00:42
427500 -- (-1640.692) [-1641.714] (-1640.765) (-1642.510) * (-1640.152) (-1641.193) (-1641.185) [-1639.731] -- 0:00:42
428000 -- [-1640.030] (-1638.012) (-1643.956) (-1642.340) * [-1639.350] (-1638.763) (-1639.098) (-1640.322) -- 0:00:42
428500 -- (-1640.126) (-1639.329) (-1638.558) [-1638.775] * (-1639.381) (-1640.015) [-1640.894] (-1639.064) -- 0:00:42
429000 -- (-1638.754) [-1641.252] (-1641.567) (-1639.337) * (-1639.676) [-1639.993] (-1638.564) (-1639.728) -- 0:00:42
429500 -- (-1639.383) (-1642.534) [-1639.739] (-1640.573) * [-1640.079] (-1638.655) (-1638.370) (-1639.283) -- 0:00:42
430000 -- (-1639.556) [-1640.462] (-1644.124) (-1641.437) * (-1641.497) (-1638.719) (-1640.698) [-1645.129] -- 0:00:42
Average standard deviation of split frequencies: 0.010882
430500 -- (-1639.708) (-1639.803) [-1645.994] (-1638.831) * (-1639.409) [-1643.427] (-1639.536) (-1638.227) -- 0:00:42
431000 -- (-1639.497) (-1641.231) (-1642.004) [-1640.715] * (-1639.678) (-1641.003) [-1639.689] (-1643.617) -- 0:00:42
431500 -- (-1639.828) (-1640.093) [-1641.057] (-1640.715) * (-1640.667) (-1639.398) (-1640.117) [-1641.322] -- 0:00:42
432000 -- (-1642.482) (-1640.347) (-1638.661) [-1639.068] * (-1640.086) (-1641.174) (-1644.974) [-1640.874] -- 0:00:42
432500 -- (-1639.090) [-1640.204] (-1641.682) (-1643.404) * (-1642.517) [-1640.427] (-1643.443) (-1644.857) -- 0:00:41
433000 -- [-1639.482] (-1641.201) (-1642.301) (-1638.939) * (-1644.179) (-1639.595) [-1639.028] (-1641.907) -- 0:00:41
433500 -- [-1642.107] (-1639.364) (-1641.662) (-1642.142) * (-1640.271) [-1639.281] (-1638.416) (-1641.596) -- 0:00:41
434000 -- (-1641.694) (-1639.534) [-1639.811] (-1639.492) * (-1640.510) [-1638.992] (-1638.508) (-1641.725) -- 0:00:41
434500 -- (-1638.052) (-1639.058) [-1640.520] (-1639.724) * (-1639.923) [-1638.855] (-1640.667) (-1639.883) -- 0:00:41
435000 -- [-1638.321] (-1641.276) (-1639.368) (-1639.536) * (-1641.468) (-1639.344) (-1640.370) [-1640.154] -- 0:00:41
Average standard deviation of split frequencies: 0.010677
435500 -- [-1640.018] (-1639.762) (-1641.892) (-1639.523) * (-1641.855) (-1639.866) [-1639.317] (-1639.474) -- 0:00:41
436000 -- (-1642.553) [-1639.875] (-1641.892) (-1639.903) * [-1640.952] (-1639.775) (-1639.676) (-1642.007) -- 0:00:41
436500 -- (-1642.903) (-1640.640) (-1646.165) [-1639.591] * [-1640.220] (-1638.697) (-1644.484) (-1639.855) -- 0:00:41
437000 -- (-1644.453) [-1638.749] (-1639.704) (-1640.745) * [-1637.921] (-1638.941) (-1642.167) (-1639.575) -- 0:00:41
437500 -- [-1645.614] (-1639.271) (-1646.325) (-1641.244) * (-1637.915) (-1638.970) (-1639.983) [-1638.777] -- 0:00:42
438000 -- [-1640.327] (-1639.868) (-1644.102) (-1638.735) * (-1638.261) (-1641.982) [-1641.467] (-1640.668) -- 0:00:42
438500 -- (-1645.098) (-1638.601) (-1639.126) [-1639.518] * (-1638.018) (-1640.203) (-1640.895) [-1640.325] -- 0:00:42
439000 -- (-1642.378) (-1639.814) (-1639.998) [-1639.636] * (-1638.027) [-1640.294] (-1641.688) (-1644.424) -- 0:00:42
439500 -- [-1641.317] (-1640.544) (-1639.982) (-1639.911) * (-1639.562) (-1640.294) [-1640.916] (-1639.721) -- 0:00:42
440000 -- [-1640.112] (-1640.090) (-1639.063) (-1642.993) * (-1638.996) (-1640.520) [-1640.550] (-1642.771) -- 0:00:41
Average standard deviation of split frequencies: 0.010831
440500 -- [-1639.855] (-1639.829) (-1640.190) (-1638.742) * [-1638.562] (-1642.366) (-1646.187) (-1640.989) -- 0:00:41
441000 -- (-1639.902) [-1640.422] (-1639.830) (-1640.703) * (-1638.608) [-1641.066] (-1644.505) (-1638.527) -- 0:00:41
441500 -- (-1640.062) [-1640.299] (-1640.865) (-1649.699) * (-1638.051) (-1642.422) (-1646.083) [-1639.390] -- 0:00:41
442000 -- (-1642.964) (-1640.857) (-1640.679) [-1641.102] * (-1640.573) (-1642.172) [-1640.654] (-1640.345) -- 0:00:41
442500 -- (-1639.973) (-1640.361) [-1638.418] (-1642.199) * (-1639.485) (-1640.685) [-1639.685] (-1642.052) -- 0:00:41
443000 -- [-1639.766] (-1641.060) (-1638.863) (-1643.011) * (-1640.019) [-1639.028] (-1639.811) (-1646.840) -- 0:00:41
443500 -- (-1639.571) [-1638.690] (-1640.145) (-1639.885) * [-1640.001] (-1639.085) (-1642.005) (-1642.927) -- 0:00:41
444000 -- (-1640.723) [-1638.741] (-1639.593) (-1646.787) * (-1640.569) (-1641.477) (-1640.428) [-1642.600] -- 0:00:41
444500 -- (-1640.726) (-1642.008) (-1639.478) [-1641.324] * [-1638.953] (-1638.698) (-1639.501) (-1640.661) -- 0:00:41
445000 -- (-1643.247) [-1642.408] (-1641.506) (-1642.069) * (-1642.442) [-1639.125] (-1638.687) (-1639.125) -- 0:00:41
Average standard deviation of split frequencies: 0.010010
445500 -- (-1649.288) [-1640.392] (-1642.685) (-1640.631) * (-1642.207) (-1640.823) (-1642.076) [-1641.245] -- 0:00:41
446000 -- (-1643.994) (-1640.863) [-1639.534] (-1642.426) * (-1639.801) (-1642.619) (-1644.371) [-1640.031] -- 0:00:40
446500 -- (-1642.968) (-1639.243) (-1638.842) [-1643.169] * (-1639.955) [-1639.845] (-1642.868) (-1638.287) -- 0:00:40
447000 -- (-1642.235) (-1640.004) [-1640.930] (-1642.478) * (-1643.150) [-1638.357] (-1639.365) (-1645.635) -- 0:00:40
447500 -- [-1640.675] (-1639.227) (-1639.755) (-1638.622) * (-1651.272) (-1638.364) [-1643.336] (-1640.358) -- 0:00:40
448000 -- [-1641.175] (-1638.962) (-1639.238) (-1641.744) * (-1643.425) (-1643.117) [-1642.240] (-1639.406) -- 0:00:40
448500 -- (-1639.602) (-1640.891) [-1638.804] (-1640.470) * [-1640.538] (-1642.140) (-1639.148) (-1639.093) -- 0:00:40
449000 -- (-1642.993) [-1642.455] (-1638.714) (-1638.548) * (-1639.780) (-1640.735) (-1639.291) [-1639.444] -- 0:00:40
449500 -- (-1639.981) [-1639.705] (-1638.703) (-1638.478) * (-1642.369) [-1642.977] (-1639.227) (-1639.262) -- 0:00:41
450000 -- (-1642.570) [-1639.307] (-1638.434) (-1638.468) * (-1642.184) (-1639.895) (-1638.982) [-1640.857] -- 0:00:41
Average standard deviation of split frequencies: 0.009968
450500 -- [-1644.080] (-1639.758) (-1638.061) (-1640.544) * (-1640.335) [-1639.755] (-1642.725) (-1639.974) -- 0:00:41
451000 -- (-1640.071) (-1645.051) (-1639.989) [-1641.302] * (-1640.469) (-1640.210) [-1639.736] (-1640.443) -- 0:00:41
451500 -- (-1639.186) (-1647.713) [-1638.938] (-1640.143) * (-1639.271) (-1645.167) (-1638.953) [-1640.832] -- 0:00:41
452000 -- (-1642.566) (-1641.391) [-1641.456] (-1641.994) * [-1639.135] (-1642.319) (-1641.321) (-1642.756) -- 0:00:41
452500 -- (-1642.770) (-1639.205) (-1641.456) [-1640.007] * (-1641.002) (-1641.446) (-1641.321) [-1638.868] -- 0:00:41
453000 -- [-1641.377] (-1638.939) (-1638.218) (-1639.508) * (-1640.792) (-1641.620) [-1640.850] (-1641.706) -- 0:00:41
453500 -- (-1641.377) [-1639.613] (-1638.036) (-1639.794) * (-1641.338) (-1643.167) (-1640.672) [-1644.341] -- 0:00:40
454000 -- (-1639.059) (-1640.033) [-1638.016] (-1640.894) * (-1641.608) (-1642.015) [-1642.490] (-1641.136) -- 0:00:40
454500 -- (-1642.170) [-1641.657] (-1639.241) (-1639.500) * (-1646.144) (-1638.357) (-1639.745) [-1643.709] -- 0:00:40
455000 -- (-1640.778) (-1642.288) (-1642.452) [-1641.938] * (-1641.296) (-1638.482) (-1639.844) [-1639.387] -- 0:00:40
Average standard deviation of split frequencies: 0.010338
455500 -- (-1641.161) [-1641.806] (-1640.177) (-1640.743) * (-1642.342) [-1639.539] (-1644.743) (-1639.752) -- 0:00:40
456000 -- (-1640.771) [-1639.911] (-1640.969) (-1638.828) * [-1639.084] (-1643.816) (-1644.186) (-1639.268) -- 0:00:40
456500 -- (-1641.681) (-1639.286) [-1637.893] (-1638.746) * (-1639.523) (-1642.841) [-1639.266] (-1640.103) -- 0:00:40
457000 -- (-1639.478) [-1639.325] (-1638.237) (-1639.711) * (-1640.879) [-1638.319] (-1640.357) (-1640.875) -- 0:00:40
457500 -- [-1640.819] (-1639.890) (-1642.656) (-1642.923) * (-1639.604) (-1638.854) [-1640.355] (-1642.531) -- 0:00:40
458000 -- (-1640.097) [-1639.947] (-1643.838) (-1640.345) * [-1639.766] (-1638.286) (-1640.108) (-1640.918) -- 0:00:40
458500 -- [-1641.581] (-1639.162) (-1639.588) (-1640.799) * [-1639.763] (-1638.599) (-1640.164) (-1639.931) -- 0:00:40
459000 -- (-1639.297) (-1638.755) [-1639.410] (-1639.162) * (-1641.069) [-1639.185] (-1638.627) (-1640.114) -- 0:00:40
459500 -- (-1641.023) (-1639.157) (-1639.771) [-1639.927] * (-1642.498) (-1639.121) [-1641.639] (-1640.300) -- 0:00:39
460000 -- (-1639.375) [-1639.380] (-1640.987) (-1643.946) * [-1645.144] (-1642.740) (-1638.562) (-1640.155) -- 0:00:39
Average standard deviation of split frequencies: 0.010745
460500 -- (-1639.456) (-1641.542) [-1642.532] (-1640.812) * [-1644.583] (-1639.503) (-1638.627) (-1638.856) -- 0:00:39
461000 -- (-1639.031) (-1644.230) (-1643.709) [-1640.532] * (-1641.308) (-1641.051) (-1638.641) [-1640.232] -- 0:00:39
461500 -- (-1640.559) [-1640.047] (-1644.488) (-1639.098) * (-1641.427) (-1642.053) (-1638.575) [-1638.637] -- 0:00:39
462000 -- [-1638.782] (-1640.409) (-1640.867) (-1641.084) * [-1639.094] (-1640.034) (-1640.525) (-1644.481) -- 0:00:39
462500 -- [-1638.749] (-1642.238) (-1640.498) (-1639.409) * (-1641.573) (-1641.620) [-1638.404] (-1643.248) -- 0:00:40
463000 -- (-1642.386) [-1641.282] (-1639.855) (-1638.973) * [-1639.981] (-1642.157) (-1639.986) (-1640.861) -- 0:00:40
463500 -- (-1641.784) (-1639.392) (-1643.235) [-1638.506] * (-1644.698) [-1639.534] (-1639.792) (-1638.505) -- 0:00:40
464000 -- (-1638.678) (-1639.035) [-1640.122] (-1638.477) * (-1639.458) (-1644.682) [-1639.366] (-1639.735) -- 0:00:40
464500 -- (-1641.060) [-1644.636] (-1639.297) (-1639.859) * [-1640.141] (-1644.872) (-1639.090) (-1643.216) -- 0:00:40
465000 -- [-1640.359] (-1643.523) (-1639.450) (-1642.446) * [-1638.722] (-1639.067) (-1642.205) (-1638.718) -- 0:00:40
Average standard deviation of split frequencies: 0.011001
465500 -- [-1640.316] (-1641.740) (-1639.351) (-1641.626) * [-1638.021] (-1638.962) (-1640.880) (-1640.593) -- 0:00:40
466000 -- (-1638.739) [-1640.049] (-1642.188) (-1639.291) * (-1638.310) (-1641.705) (-1640.244) [-1640.391] -- 0:00:40
466500 -- (-1641.792) (-1639.767) (-1638.688) [-1641.465] * [-1639.753] (-1641.712) (-1640.174) (-1639.727) -- 0:00:40
467000 -- (-1644.435) (-1641.425) [-1639.762] (-1644.069) * (-1639.991) [-1639.443] (-1640.715) (-1639.308) -- 0:00:39
467500 -- (-1642.710) (-1640.869) (-1639.908) [-1639.995] * [-1641.285] (-1638.594) (-1640.144) (-1642.294) -- 0:00:39
468000 -- (-1638.187) (-1643.664) (-1641.378) [-1644.121] * (-1641.125) (-1638.699) [-1638.792] (-1644.175) -- 0:00:39
468500 -- (-1639.695) (-1641.133) [-1642.166] (-1642.251) * (-1640.563) [-1639.046] (-1638.659) (-1640.255) -- 0:00:39
469000 -- (-1644.667) (-1644.523) (-1640.549) [-1638.804] * [-1638.600] (-1639.246) (-1639.105) (-1644.153) -- 0:00:39
469500 -- (-1642.582) (-1638.550) (-1644.471) [-1639.646] * (-1638.835) [-1638.934] (-1639.195) (-1640.274) -- 0:00:39
470000 -- (-1643.749) (-1639.536) (-1641.803) [-1640.684] * (-1641.165) [-1639.300] (-1639.465) (-1639.718) -- 0:00:39
Average standard deviation of split frequencies: 0.010899
470500 -- (-1641.651) (-1639.864) (-1639.441) [-1641.300] * [-1641.965] (-1646.469) (-1640.682) (-1639.358) -- 0:00:39
471000 -- [-1639.632] (-1639.819) (-1641.268) (-1642.086) * (-1641.111) (-1640.831) [-1640.670] (-1639.414) -- 0:00:39
471500 -- (-1639.806) [-1641.653] (-1641.199) (-1640.320) * (-1639.026) (-1640.961) [-1642.247] (-1642.750) -- 0:00:39
472000 -- (-1641.830) (-1640.873) [-1641.816] (-1641.991) * (-1638.650) (-1640.968) [-1640.317] (-1642.386) -- 0:00:39
472500 -- (-1638.719) (-1641.616) [-1641.306] (-1641.574) * (-1639.868) (-1641.186) (-1638.275) [-1639.899] -- 0:00:39
473000 -- (-1639.404) (-1640.502) [-1639.074] (-1641.461) * (-1639.971) (-1639.287) [-1638.429] (-1639.005) -- 0:00:38
473500 -- (-1641.204) [-1638.571] (-1639.203) (-1642.927) * (-1642.016) (-1639.017) (-1638.783) [-1640.226] -- 0:00:38
474000 -- (-1639.964) [-1639.691] (-1640.346) (-1641.295) * [-1639.792] (-1638.729) (-1639.913) (-1638.643) -- 0:00:38
474500 -- (-1638.139) (-1640.760) [-1642.376] (-1639.427) * (-1639.214) [-1638.636] (-1639.939) (-1641.174) -- 0:00:38
475000 -- (-1640.205) (-1646.732) [-1643.265] (-1641.197) * (-1639.122) (-1641.837) [-1642.240] (-1640.385) -- 0:00:38
Average standard deviation of split frequencies: 0.010770
475500 -- [-1640.993] (-1638.589) (-1640.954) (-1640.264) * (-1640.446) [-1641.837] (-1647.288) (-1638.205) -- 0:00:39
476000 -- [-1638.986] (-1640.820) (-1640.280) (-1642.932) * (-1639.731) [-1639.664] (-1642.109) (-1638.214) -- 0:00:39
476500 -- [-1639.157] (-1642.508) (-1640.207) (-1643.231) * (-1641.388) (-1639.727) (-1643.523) [-1640.132] -- 0:00:39
477000 -- [-1642.241] (-1638.664) (-1640.528) (-1642.738) * (-1642.685) [-1640.767] (-1640.912) (-1638.085) -- 0:00:39
477500 -- (-1642.522) [-1639.200] (-1639.953) (-1640.749) * (-1638.923) [-1640.067] (-1643.481) (-1638.201) -- 0:00:39
478000 -- (-1641.486) [-1645.394] (-1639.778) (-1638.768) * (-1638.857) (-1639.686) (-1644.126) [-1638.647] -- 0:00:39
478500 -- (-1639.966) [-1644.716] (-1638.793) (-1638.741) * (-1638.841) (-1640.972) (-1645.293) [-1639.537] -- 0:00:39
479000 -- (-1640.701) (-1642.127) [-1643.568] (-1638.666) * [-1638.268] (-1639.855) (-1640.030) (-1642.469) -- 0:00:39
479500 -- (-1639.282) (-1641.925) (-1641.556) [-1641.198] * (-1642.015) (-1641.277) [-1639.226] (-1640.174) -- 0:00:39
480000 -- [-1641.073] (-1638.064) (-1640.221) (-1638.430) * (-1641.707) (-1639.626) [-1644.346] (-1639.195) -- 0:00:39
Average standard deviation of split frequencies: 0.011217
480500 -- [-1638.990] (-1639.141) (-1643.761) (-1641.837) * (-1641.901) (-1639.346) (-1638.632) [-1640.791] -- 0:00:38
481000 -- [-1640.966] (-1638.705) (-1642.097) (-1640.539) * (-1641.901) [-1640.439] (-1638.537) (-1639.410) -- 0:00:38
481500 -- (-1639.393) (-1640.229) (-1642.111) [-1641.023] * (-1642.481) (-1646.812) [-1639.489] (-1643.464) -- 0:00:38
482000 -- (-1640.041) (-1638.437) (-1646.280) [-1640.876] * (-1640.262) (-1639.317) (-1639.526) [-1641.123] -- 0:00:38
482500 -- (-1639.831) [-1640.162] (-1642.964) (-1642.947) * (-1640.559) (-1646.378) (-1641.021) [-1639.149] -- 0:00:38
483000 -- [-1639.577] (-1642.194) (-1641.443) (-1644.890) * (-1638.472) [-1641.650] (-1640.953) (-1639.842) -- 0:00:38
483500 -- (-1639.282) (-1638.618) (-1642.845) [-1643.082] * (-1638.476) [-1639.271] (-1640.736) (-1641.428) -- 0:00:38
484000 -- (-1639.601) (-1638.619) (-1640.766) [-1640.243] * (-1640.855) [-1638.762] (-1642.256) (-1642.349) -- 0:00:38
484500 -- (-1638.712) (-1638.638) (-1642.523) [-1638.814] * (-1641.547) (-1640.137) (-1639.865) [-1639.649] -- 0:00:38
485000 -- (-1643.086) (-1639.177) [-1641.040] (-1640.093) * [-1639.478] (-1641.374) (-1638.820) (-1639.029) -- 0:00:38
Average standard deviation of split frequencies: 0.010488
485500 -- [-1643.078] (-1639.178) (-1642.030) (-1638.146) * (-1640.551) (-1640.241) [-1640.040] (-1639.137) -- 0:00:38
486000 -- (-1641.628) (-1641.394) (-1641.006) [-1639.037] * [-1640.426] (-1640.181) (-1640.781) (-1638.355) -- 0:00:38
486500 -- (-1641.976) (-1641.179) (-1640.735) [-1640.954] * (-1639.552) (-1639.262) (-1641.582) [-1639.138] -- 0:00:37
487000 -- (-1639.994) [-1641.145] (-1639.268) (-1638.714) * (-1640.004) (-1641.330) (-1638.324) [-1638.803] -- 0:00:38
487500 -- (-1639.466) (-1641.943) (-1639.281) [-1638.662] * (-1639.638) [-1640.620] (-1639.224) (-1638.985) -- 0:00:38
488000 -- [-1639.691] (-1639.904) (-1640.077) (-1640.946) * (-1639.608) (-1638.433) (-1642.990) [-1639.300] -- 0:00:38
488500 -- [-1639.828] (-1640.787) (-1639.427) (-1640.362) * (-1639.954) (-1638.646) (-1641.838) [-1640.062] -- 0:00:38
489000 -- (-1641.106) (-1640.440) (-1639.546) [-1639.889] * (-1639.522) (-1640.097) (-1640.599) [-1639.385] -- 0:00:38
489500 -- [-1640.980] (-1641.396) (-1641.539) (-1639.268) * [-1639.650] (-1639.902) (-1641.451) (-1641.770) -- 0:00:38
490000 -- (-1639.736) [-1638.950] (-1640.896) (-1639.005) * [-1639.196] (-1639.882) (-1639.877) (-1642.738) -- 0:00:38
Average standard deviation of split frequencies: 0.009928
490500 -- [-1638.208] (-1640.297) (-1641.793) (-1639.719) * (-1639.196) (-1639.596) [-1640.866] (-1646.786) -- 0:00:38
491000 -- (-1639.546) (-1642.085) [-1640.941] (-1644.010) * (-1638.761) (-1639.480) (-1638.523) [-1639.408] -- 0:00:38
491500 -- (-1639.540) [-1639.941] (-1640.895) (-1643.520) * (-1640.494) (-1645.044) [-1638.195] (-1638.963) -- 0:00:38
492000 -- (-1638.946) [-1639.457] (-1641.178) (-1644.328) * (-1640.432) (-1639.475) [-1638.800] (-1639.413) -- 0:00:38
492500 -- (-1639.483) (-1639.457) (-1639.540) [-1641.141] * (-1641.214) [-1638.773] (-1638.125) (-1642.173) -- 0:00:38
493000 -- (-1643.026) (-1643.885) [-1642.243] (-1641.742) * (-1642.718) [-1639.521] (-1639.714) (-1642.462) -- 0:00:38
493500 -- (-1639.622) [-1642.270] (-1640.100) (-1642.844) * (-1644.889) (-1644.925) (-1643.318) [-1643.024] -- 0:00:37
494000 -- (-1639.399) (-1643.404) [-1639.271] (-1641.946) * [-1642.420] (-1645.215) (-1640.521) (-1643.296) -- 0:00:37
494500 -- (-1640.120) (-1641.378) (-1639.636) [-1639.176] * (-1640.116) (-1641.518) (-1638.995) [-1640.659] -- 0:00:37
495000 -- (-1640.048) [-1639.451] (-1639.024) (-1642.219) * (-1638.486) (-1638.862) [-1641.777] (-1640.410) -- 0:00:37
Average standard deviation of split frequencies: 0.010514
495500 -- (-1643.725) [-1638.968] (-1639.262) (-1641.809) * [-1638.258] (-1640.257) (-1639.668) (-1638.578) -- 0:00:37
496000 -- (-1640.893) (-1638.357) (-1638.856) [-1639.099] * (-1638.314) [-1640.560] (-1639.693) (-1642.034) -- 0:00:37
496500 -- (-1641.316) [-1638.067] (-1638.928) (-1642.416) * [-1639.767] (-1639.223) (-1639.956) (-1638.689) -- 0:00:37
497000 -- (-1641.063) (-1639.294) [-1639.600] (-1641.463) * (-1639.008) [-1639.226] (-1639.479) (-1639.219) -- 0:00:37
497500 -- (-1637.968) (-1639.279) [-1639.320] (-1644.325) * (-1640.523) (-1641.412) (-1639.142) [-1639.491] -- 0:00:37
498000 -- (-1638.626) (-1641.006) (-1639.047) [-1645.267] * [-1640.250] (-1639.286) (-1639.925) (-1644.134) -- 0:00:37
498500 -- (-1640.368) [-1641.558] (-1639.392) (-1641.025) * [-1640.981] (-1639.519) (-1639.095) (-1638.739) -- 0:00:37
499000 -- (-1640.562) [-1641.263] (-1640.984) (-1638.911) * (-1646.052) [-1639.914] (-1640.269) (-1643.224) -- 0:00:37
499500 -- [-1642.095] (-1645.275) (-1639.084) (-1639.133) * (-1641.865) (-1639.944) [-1639.409] (-1643.266) -- 0:00:37
500000 -- (-1640.041) (-1641.612) (-1645.319) [-1639.335] * (-1644.660) [-1640.328] (-1641.434) (-1641.856) -- 0:00:37
Average standard deviation of split frequencies: 0.011122
500500 -- [-1640.936] (-1640.944) (-1640.564) (-1639.223) * (-1642.663) (-1641.190) [-1640.392] (-1640.157) -- 0:00:37
501000 -- [-1638.762] (-1641.252) (-1642.138) (-1639.603) * (-1646.230) [-1643.167] (-1638.080) (-1642.717) -- 0:00:37
501500 -- (-1639.239) [-1638.268] (-1639.226) (-1640.776) * (-1639.124) (-1642.597) [-1638.480] (-1638.411) -- 0:00:37
502000 -- [-1638.285] (-1641.740) (-1639.151) (-1640.488) * (-1639.596) (-1642.367) [-1638.705] (-1641.268) -- 0:00:37
502500 -- (-1641.421) [-1641.207] (-1640.430) (-1641.493) * (-1640.919) (-1639.396) [-1639.327] (-1639.918) -- 0:00:37
503000 -- [-1639.371] (-1640.441) (-1640.006) (-1640.935) * (-1644.464) (-1644.603) (-1639.176) [-1640.489] -- 0:00:37
503500 -- (-1640.311) (-1638.851) [-1638.656] (-1639.618) * (-1641.769) (-1641.685) [-1638.346] (-1646.827) -- 0:00:37
504000 -- (-1641.183) (-1644.378) (-1641.779) [-1643.322] * [-1641.183] (-1644.125) (-1639.993) (-1639.123) -- 0:00:37
504500 -- (-1640.988) [-1639.672] (-1641.500) (-1641.734) * (-1639.397) (-1640.825) (-1641.404) [-1639.737] -- 0:00:37
505000 -- (-1640.734) (-1644.776) (-1641.423) [-1640.696] * (-1639.930) (-1640.071) (-1638.055) [-1638.845] -- 0:00:37
Average standard deviation of split frequencies: 0.010772
505500 -- [-1641.259] (-1642.603) (-1643.740) (-1639.596) * [-1639.500] (-1641.356) (-1640.384) (-1638.038) -- 0:00:37
506000 -- (-1638.880) [-1639.932] (-1640.055) (-1641.002) * (-1640.148) [-1639.951] (-1641.923) (-1641.997) -- 0:00:37
506500 -- (-1641.143) (-1639.439) (-1642.633) [-1641.075] * [-1641.207] (-1638.934) (-1643.798) (-1643.867) -- 0:00:37
507000 -- [-1638.933] (-1639.915) (-1639.041) (-1639.901) * [-1643.527] (-1638.826) (-1639.903) (-1645.508) -- 0:00:36
507500 -- (-1639.466) [-1642.059] (-1645.406) (-1640.302) * (-1641.389) (-1639.817) (-1643.094) [-1639.464] -- 0:00:36
508000 -- [-1641.327] (-1642.356) (-1640.659) (-1638.887) * [-1639.915] (-1639.457) (-1641.336) (-1640.548) -- 0:00:36
508500 -- [-1642.467] (-1638.930) (-1639.137) (-1640.195) * (-1641.593) (-1639.830) (-1643.040) [-1640.509] -- 0:00:36
509000 -- (-1639.520) (-1640.535) [-1638.613] (-1639.790) * (-1642.751) (-1639.049) (-1644.723) [-1642.400] -- 0:00:36
509500 -- (-1640.902) [-1640.488] (-1642.761) (-1642.929) * (-1639.978) (-1638.785) (-1643.270) [-1638.764] -- 0:00:36
510000 -- (-1641.586) (-1640.497) [-1645.446] (-1639.352) * [-1638.731] (-1643.119) (-1642.632) (-1639.626) -- 0:00:36
Average standard deviation of split frequencies: 0.010500
510500 -- (-1642.735) (-1640.710) (-1643.173) [-1638.993] * (-1642.131) [-1643.325] (-1643.831) (-1640.926) -- 0:00:36
511000 -- (-1638.636) (-1643.613) [-1639.656] (-1640.168) * (-1639.245) (-1639.448) [-1639.362] (-1641.817) -- 0:00:36
511500 -- (-1641.306) [-1640.683] (-1639.805) (-1641.058) * (-1639.122) (-1640.980) (-1639.276) [-1638.540] -- 0:00:36
512000 -- (-1640.948) (-1641.181) (-1643.128) [-1639.364] * [-1639.349] (-1639.588) (-1639.271) (-1640.547) -- 0:00:36
512500 -- [-1640.316] (-1642.345) (-1644.735) (-1639.318) * (-1639.198) (-1639.587) [-1639.080] (-1642.658) -- 0:00:36
513000 -- (-1640.661) [-1639.475] (-1638.811) (-1641.678) * [-1641.018] (-1640.506) (-1642.561) (-1644.318) -- 0:00:36
513500 -- [-1640.514] (-1638.801) (-1641.864) (-1642.210) * [-1639.756] (-1639.014) (-1642.862) (-1645.739) -- 0:00:36
514000 -- (-1638.492) (-1640.049) [-1639.561] (-1640.896) * (-1639.980) [-1641.597] (-1640.666) (-1638.417) -- 0:00:35
514500 -- (-1639.953) (-1638.571) (-1638.531) [-1637.961] * (-1639.536) [-1639.839] (-1639.117) (-1638.902) -- 0:00:36
515000 -- (-1642.629) [-1638.584] (-1641.247) (-1642.875) * (-1638.712) (-1640.847) (-1640.119) [-1638.896] -- 0:00:36
Average standard deviation of split frequencies: 0.010735
515500 -- (-1642.459) (-1639.026) [-1638.922] (-1642.159) * [-1640.293] (-1640.970) (-1639.337) (-1639.356) -- 0:00:36
516000 -- (-1640.160) (-1639.344) [-1639.109] (-1640.805) * (-1640.405) [-1640.077] (-1639.895) (-1640.143) -- 0:00:36
516500 -- [-1641.847] (-1646.038) (-1639.146) (-1640.489) * (-1640.998) [-1642.046] (-1639.359) (-1640.726) -- 0:00:36
517000 -- (-1641.158) (-1642.291) (-1639.528) [-1640.031] * (-1642.846) [-1643.244] (-1638.533) (-1642.290) -- 0:00:36
517500 -- (-1641.898) (-1639.243) (-1639.676) [-1640.316] * (-1640.508) (-1638.738) [-1640.426] (-1638.864) -- 0:00:36
518000 -- [-1641.429] (-1638.107) (-1638.708) (-1639.915) * (-1641.813) (-1638.425) (-1645.102) [-1641.511] -- 0:00:36
518500 -- (-1639.806) [-1638.516] (-1641.336) (-1640.783) * (-1641.328) [-1639.745] (-1647.369) (-1641.347) -- 0:00:36
519000 -- (-1638.749) (-1638.982) (-1642.799) [-1640.296] * (-1641.064) (-1639.111) (-1643.374) [-1639.591] -- 0:00:36
519500 -- (-1639.590) (-1639.720) [-1644.047] (-1639.226) * [-1640.726] (-1638.246) (-1641.808) (-1641.214) -- 0:00:36
520000 -- (-1640.320) (-1639.149) (-1641.669) [-1638.906] * (-1639.828) (-1642.752) (-1639.813) [-1641.344] -- 0:00:36
Average standard deviation of split frequencies: 0.010865
520500 -- (-1640.626) (-1639.840) (-1640.367) [-1639.213] * (-1642.471) (-1644.459) (-1643.345) [-1639.619] -- 0:00:35
521000 -- (-1638.875) (-1638.476) (-1639.576) [-1638.748] * [-1641.569] (-1641.422) (-1643.745) (-1639.403) -- 0:00:35
521500 -- (-1638.655) [-1638.554] (-1639.121) (-1640.469) * (-1643.016) [-1641.422] (-1638.547) (-1641.676) -- 0:00:35
522000 -- (-1639.379) (-1641.175) (-1639.970) [-1638.871] * (-1643.010) (-1640.300) [-1642.578] (-1638.525) -- 0:00:35
522500 -- [-1639.504] (-1641.016) (-1641.531) (-1641.172) * [-1640.500] (-1641.644) (-1645.389) (-1640.467) -- 0:00:35
523000 -- (-1640.536) (-1639.608) [-1639.500] (-1642.992) * (-1641.660) [-1641.229] (-1646.827) (-1639.596) -- 0:00:35
523500 -- (-1640.189) [-1639.540] (-1639.172) (-1642.949) * [-1639.792] (-1638.617) (-1640.296) (-1644.847) -- 0:00:35
524000 -- [-1639.870] (-1639.187) (-1639.482) (-1644.355) * (-1640.510) (-1640.536) (-1643.200) [-1638.752] -- 0:00:35
524500 -- (-1648.762) (-1639.870) (-1640.609) [-1642.533] * (-1640.488) [-1639.611] (-1641.929) (-1639.859) -- 0:00:35
525000 -- (-1639.530) (-1639.637) [-1641.153] (-1642.272) * [-1640.674] (-1642.135) (-1640.290) (-1641.109) -- 0:00:35
Average standard deviation of split frequencies: 0.010979
525500 -- [-1639.318] (-1639.286) (-1642.819) (-1641.117) * [-1640.812] (-1639.550) (-1640.097) (-1639.005) -- 0:00:35
526000 -- (-1638.411) (-1641.534) [-1638.472] (-1643.641) * (-1641.593) [-1639.322] (-1640.120) (-1639.865) -- 0:00:35
526500 -- (-1638.739) [-1642.538] (-1638.936) (-1642.648) * [-1642.242] (-1639.581) (-1644.916) (-1640.153) -- 0:00:35
527000 -- [-1638.734] (-1645.338) (-1639.774) (-1640.676) * [-1639.215] (-1639.442) (-1641.205) (-1638.652) -- 0:00:35
527500 -- (-1638.772) (-1639.616) [-1639.370] (-1640.419) * (-1640.752) [-1646.971] (-1642.890) (-1642.324) -- 0:00:34
528000 -- (-1638.373) [-1641.778] (-1642.446) (-1639.723) * (-1638.921) (-1641.691) [-1643.441] (-1641.249) -- 0:00:35
528500 -- (-1639.590) (-1639.615) (-1640.038) [-1642.003] * (-1640.315) [-1641.882] (-1638.922) (-1645.203) -- 0:00:35
529000 -- [-1640.519] (-1638.436) (-1638.399) (-1645.962) * (-1638.568) [-1647.210] (-1638.737) (-1645.951) -- 0:00:35
529500 -- (-1643.478) (-1641.367) [-1638.862] (-1642.210) * (-1639.783) (-1639.164) (-1639.431) [-1639.988] -- 0:00:35
530000 -- (-1639.354) [-1640.367] (-1638.810) (-1641.009) * (-1640.216) (-1641.193) (-1640.960) [-1639.010] -- 0:00:35
Average standard deviation of split frequencies: 0.010660
530500 -- (-1640.859) (-1643.294) (-1638.422) [-1639.418] * (-1638.491) [-1639.839] (-1640.123) (-1638.367) -- 0:00:35
531000 -- (-1639.833) [-1639.912] (-1638.129) (-1639.586) * (-1638.593) (-1641.707) (-1639.299) [-1638.443] -- 0:00:35
531500 -- (-1640.017) (-1640.410) [-1641.128] (-1644.485) * [-1638.910] (-1641.110) (-1642.457) (-1639.070) -- 0:00:35
532000 -- (-1640.106) [-1639.817] (-1640.875) (-1639.793) * (-1638.887) (-1641.616) [-1641.637] (-1639.044) -- 0:00:35
532500 -- (-1640.901) (-1644.224) [-1639.748] (-1642.747) * (-1640.683) (-1640.772) [-1639.490] (-1639.234) -- 0:00:35
533000 -- (-1641.707) [-1639.966] (-1638.670) (-1643.090) * (-1638.670) (-1641.209) [-1639.682] (-1638.871) -- 0:00:35
533500 -- (-1641.201) (-1641.276) [-1638.811] (-1641.350) * [-1640.315] (-1641.196) (-1639.682) (-1643.603) -- 0:00:34
534000 -- (-1642.437) (-1639.418) (-1640.136) [-1640.265] * [-1642.278] (-1639.988) (-1639.438) (-1641.697) -- 0:00:34
534500 -- [-1641.756] (-1639.294) (-1638.590) (-1639.400) * (-1640.554) (-1639.434) [-1639.097] (-1640.516) -- 0:00:34
535000 -- (-1638.626) [-1642.591] (-1639.759) (-1640.839) * [-1639.660] (-1639.227) (-1639.256) (-1639.847) -- 0:00:34
Average standard deviation of split frequencies: 0.010774
535500 -- [-1639.059] (-1643.203) (-1639.391) (-1640.037) * (-1639.449) (-1638.828) [-1638.529] (-1642.178) -- 0:00:34
536000 -- (-1638.605) (-1644.618) (-1643.195) [-1642.991] * (-1639.640) (-1638.146) [-1640.400] (-1640.219) -- 0:00:34
536500 -- (-1639.723) (-1640.256) (-1642.595) [-1639.658] * (-1643.103) [-1641.947] (-1640.222) (-1641.372) -- 0:00:34
537000 -- (-1641.612) (-1638.894) [-1640.645] (-1641.060) * (-1643.515) (-1641.488) (-1639.448) [-1639.012] -- 0:00:34
537500 -- (-1638.091) (-1642.476) (-1640.529) [-1643.238] * [-1641.420] (-1640.825) (-1641.056) (-1640.687) -- 0:00:34
538000 -- (-1639.239) (-1641.663) [-1640.901] (-1649.397) * (-1644.713) (-1640.719) (-1647.943) [-1643.323] -- 0:00:34
538500 -- (-1639.542) (-1640.768) [-1639.456] (-1644.784) * (-1641.743) (-1639.858) (-1641.882) [-1641.607] -- 0:00:34
539000 -- (-1638.519) (-1644.549) (-1640.496) [-1640.769] * [-1639.782] (-1640.405) (-1641.969) (-1641.434) -- 0:00:34
539500 -- [-1640.904] (-1641.782) (-1647.166) (-1639.933) * [-1640.762] (-1639.809) (-1643.292) (-1641.875) -- 0:00:34
540000 -- (-1638.493) (-1643.464) (-1642.580) [-1642.450] * (-1642.058) (-1640.083) [-1639.024] (-1640.212) -- 0:00:34
Average standard deviation of split frequencies: 0.010953
540500 -- (-1638.454) (-1641.923) (-1643.250) [-1644.355] * (-1647.377) (-1641.221) (-1639.263) [-1639.753] -- 0:00:34
541000 -- (-1641.097) (-1641.635) (-1640.237) [-1640.345] * (-1651.098) (-1640.954) [-1638.255] (-1638.713) -- 0:00:33
541500 -- (-1644.310) [-1641.252] (-1638.066) (-1638.907) * (-1644.773) (-1639.651) (-1641.794) [-1639.015] -- 0:00:34
542000 -- (-1640.800) (-1640.536) [-1639.513] (-1638.951) * (-1645.262) (-1642.008) (-1638.500) [-1640.607] -- 0:00:34
542500 -- (-1642.114) (-1641.444) [-1641.224] (-1639.084) * [-1638.695] (-1643.204) (-1638.029) (-1639.509) -- 0:00:34
543000 -- (-1638.800) [-1639.963] (-1639.444) (-1638.564) * (-1640.294) [-1638.910] (-1638.545) (-1638.096) -- 0:00:34
543500 -- (-1640.290) (-1640.025) (-1643.660) [-1640.482] * (-1639.250) (-1639.100) (-1639.364) [-1639.506] -- 0:00:34
544000 -- [-1638.786] (-1642.910) (-1639.239) (-1641.050) * (-1640.125) (-1643.203) [-1638.790] (-1639.082) -- 0:00:34
544500 -- (-1642.326) [-1642.781] (-1642.031) (-1642.007) * (-1639.784) (-1639.266) [-1640.132] (-1638.780) -- 0:00:34
545000 -- (-1644.442) [-1639.492] (-1639.321) (-1643.793) * [-1638.930] (-1638.630) (-1639.415) (-1640.184) -- 0:00:34
Average standard deviation of split frequencies: 0.011224
545500 -- (-1640.150) (-1645.137) [-1639.611] (-1640.422) * [-1638.930] (-1641.782) (-1639.556) (-1638.072) -- 0:00:34
546000 -- (-1641.128) (-1642.965) (-1641.988) [-1640.990] * (-1639.262) (-1644.744) [-1639.415] (-1638.621) -- 0:00:34
546500 -- [-1639.872] (-1644.139) (-1640.518) (-1639.983) * [-1640.772] (-1640.919) (-1639.105) (-1639.066) -- 0:00:34
547000 -- (-1640.377) [-1639.086] (-1639.169) (-1641.059) * (-1640.752) (-1639.156) [-1639.842] (-1639.304) -- 0:00:33
547500 -- [-1640.594] (-1639.191) (-1642.002) (-1642.507) * (-1640.591) (-1640.001) [-1639.954] (-1640.562) -- 0:00:33
548000 -- (-1639.615) [-1639.480] (-1641.282) (-1641.504) * [-1639.099] (-1638.695) (-1639.870) (-1640.443) -- 0:00:33
548500 -- (-1642.582) (-1640.769) (-1642.035) [-1640.740] * [-1639.374] (-1639.406) (-1639.781) (-1640.351) -- 0:00:33
549000 -- [-1639.511] (-1639.835) (-1639.964) (-1639.484) * (-1642.816) [-1639.281] (-1641.892) (-1641.003) -- 0:00:33
549500 -- (-1638.816) (-1640.131) [-1640.892] (-1642.204) * (-1642.408) (-1640.429) (-1641.878) [-1638.798] -- 0:00:33
550000 -- (-1641.735) [-1638.600] (-1640.687) (-1640.608) * (-1640.089) (-1645.508) (-1638.429) [-1640.709] -- 0:00:33
Average standard deviation of split frequencies: 0.011610
550500 -- (-1642.244) (-1638.648) [-1639.178] (-1639.036) * (-1639.079) (-1640.990) [-1638.066] (-1642.383) -- 0:00:33
551000 -- (-1640.281) (-1638.847) (-1642.483) [-1639.318] * (-1639.993) (-1640.245) (-1638.284) [-1641.828] -- 0:00:33
551500 -- [-1639.472] (-1642.165) (-1639.883) (-1640.540) * (-1639.818) (-1640.212) [-1640.407] (-1641.007) -- 0:00:33
552000 -- (-1639.127) (-1639.503) [-1641.072] (-1642.494) * [-1645.675] (-1640.158) (-1640.963) (-1639.570) -- 0:00:33
552500 -- (-1640.600) [-1640.168] (-1640.597) (-1639.540) * (-1639.594) [-1640.783] (-1644.264) (-1639.651) -- 0:00:33
553000 -- [-1639.662] (-1639.664) (-1642.100) (-1639.010) * (-1639.560) (-1640.246) (-1641.454) [-1638.919] -- 0:00:33
553500 -- (-1643.776) (-1640.279) [-1642.946] (-1639.347) * [-1640.698] (-1640.307) (-1641.478) (-1641.306) -- 0:00:33
554000 -- (-1641.340) (-1639.362) [-1638.616] (-1638.345) * [-1638.380] (-1641.526) (-1644.828) (-1641.480) -- 0:00:33
554500 -- (-1642.019) [-1638.690] (-1642.520) (-1641.467) * [-1639.260] (-1643.586) (-1641.073) (-1640.200) -- 0:00:32
555000 -- (-1640.488) [-1638.248] (-1642.240) (-1639.805) * (-1639.302) [-1640.572] (-1638.503) (-1642.358) -- 0:00:33
Average standard deviation of split frequencies: 0.011393
555500 -- (-1642.260) [-1638.441] (-1639.487) (-1641.357) * (-1640.020) (-1639.673) [-1642.726] (-1639.387) -- 0:00:33
556000 -- [-1640.703] (-1637.956) (-1639.285) (-1641.134) * (-1647.639) [-1640.834] (-1650.682) (-1642.546) -- 0:00:33
556500 -- (-1639.699) [-1641.589] (-1641.102) (-1645.586) * [-1640.045] (-1642.252) (-1641.612) (-1643.846) -- 0:00:33
557000 -- [-1638.637] (-1639.348) (-1639.592) (-1640.732) * (-1640.565) (-1646.295) (-1640.933) [-1639.018] -- 0:00:33
557500 -- (-1638.599) [-1638.969] (-1649.331) (-1641.118) * (-1645.965) (-1640.722) (-1642.653) [-1639.083] -- 0:00:33
558000 -- [-1639.426] (-1638.289) (-1645.798) (-1639.968) * [-1641.939] (-1641.143) (-1640.890) (-1639.451) -- 0:00:33
558500 -- (-1641.522) [-1642.921] (-1641.486) (-1639.140) * [-1641.709] (-1640.486) (-1639.616) (-1641.911) -- 0:00:33
559000 -- (-1643.940) [-1642.631] (-1642.188) (-1638.368) * [-1644.592] (-1639.817) (-1639.969) (-1643.122) -- 0:00:33
559500 -- (-1642.947) (-1642.253) [-1639.565] (-1638.680) * (-1640.165) [-1639.261] (-1638.293) (-1640.965) -- 0:00:33
560000 -- (-1639.476) [-1640.923] (-1640.524) (-1639.256) * (-1642.976) [-1640.475] (-1639.299) (-1644.097) -- 0:00:33
Average standard deviation of split frequencies: 0.010930
560500 -- (-1642.553) (-1640.406) [-1641.787] (-1638.220) * (-1643.444) (-1642.401) [-1639.653] (-1644.297) -- 0:00:32
561000 -- (-1639.502) [-1639.045] (-1640.560) (-1650.519) * (-1641.184) [-1640.272] (-1639.719) (-1640.193) -- 0:00:32
561500 -- (-1641.234) (-1639.985) (-1638.759) [-1646.115] * [-1640.408] (-1641.534) (-1640.780) (-1640.192) -- 0:00:32
562000 -- [-1638.581] (-1639.296) (-1638.503) (-1644.978) * [-1639.738] (-1641.453) (-1643.136) (-1641.158) -- 0:00:32
562500 -- (-1640.573) (-1639.088) (-1642.566) [-1644.427] * [-1641.475] (-1644.580) (-1640.595) (-1641.219) -- 0:00:32
563000 -- [-1642.433] (-1638.976) (-1640.801) (-1639.716) * (-1640.330) (-1641.148) [-1641.173] (-1640.297) -- 0:00:32
563500 -- (-1642.494) [-1638.781] (-1640.171) (-1641.114) * (-1641.671) (-1638.958) (-1642.192) [-1638.611] -- 0:00:32
564000 -- (-1639.085) (-1639.412) [-1638.497] (-1640.006) * [-1639.776] (-1639.369) (-1642.502) (-1640.307) -- 0:00:32
564500 -- (-1640.781) [-1638.904] (-1638.994) (-1641.194) * (-1642.456) (-1638.421) [-1640.941] (-1639.398) -- 0:00:32
565000 -- (-1640.560) [-1639.242] (-1638.382) (-1643.350) * (-1639.552) (-1640.787) [-1640.923] (-1644.196) -- 0:00:32
Average standard deviation of split frequencies: 0.011192
565500 -- (-1638.576) [-1639.207] (-1638.121) (-1641.290) * (-1639.281) [-1645.813] (-1641.042) (-1643.818) -- 0:00:32
566000 -- (-1639.081) [-1640.519] (-1641.195) (-1641.081) * (-1642.229) [-1640.255] (-1643.686) (-1639.876) -- 0:00:32
566500 -- (-1639.555) [-1641.186] (-1639.702) (-1642.676) * (-1639.675) (-1638.747) [-1638.519] (-1638.725) -- 0:00:32
567000 -- [-1638.716] (-1644.875) (-1644.423) (-1643.877) * (-1639.468) (-1641.665) [-1638.528] (-1641.571) -- 0:00:32
567500 -- (-1645.859) [-1640.965] (-1642.842) (-1645.516) * (-1639.959) [-1638.508] (-1638.312) (-1642.190) -- 0:00:32
568000 -- (-1639.412) [-1644.494] (-1639.883) (-1641.515) * (-1640.673) [-1640.333] (-1638.439) (-1638.821) -- 0:00:31
568500 -- (-1638.042) (-1640.708) (-1642.962) [-1641.515] * [-1641.368] (-1639.895) (-1639.763) (-1638.807) -- 0:00:32
569000 -- (-1638.116) (-1641.540) (-1642.196) [-1639.594] * (-1641.373) [-1639.882] (-1640.037) (-1640.544) -- 0:00:32
569500 -- (-1639.394) (-1646.832) [-1641.796] (-1639.223) * [-1639.004] (-1639.712) (-1639.454) (-1643.604) -- 0:00:32
570000 -- (-1638.093) (-1641.477) [-1640.800] (-1638.895) * (-1639.654) (-1643.161) (-1641.671) [-1638.855] -- 0:00:32
Average standard deviation of split frequencies: 0.010429
570500 -- (-1642.363) (-1638.844) [-1639.057] (-1640.242) * [-1639.270] (-1641.449) (-1642.602) (-1639.375) -- 0:00:32
571000 -- (-1640.873) (-1639.177) [-1639.704] (-1638.823) * (-1638.723) [-1641.407] (-1641.945) (-1638.578) -- 0:00:32
571500 -- (-1639.738) (-1639.711) [-1638.586] (-1638.052) * (-1642.439) (-1640.371) [-1638.986] (-1641.332) -- 0:00:32
572000 -- [-1641.306] (-1640.273) (-1639.956) (-1638.774) * (-1645.128) [-1639.646] (-1640.195) (-1640.451) -- 0:00:32
572500 -- [-1640.213] (-1639.486) (-1642.542) (-1640.265) * (-1642.445) [-1640.676] (-1639.807) (-1640.346) -- 0:00:32
573000 -- [-1639.980] (-1638.315) (-1644.613) (-1640.498) * (-1643.131) (-1639.810) (-1639.868) [-1641.737] -- 0:00:32
573500 -- (-1641.480) [-1640.821] (-1639.878) (-1639.242) * (-1642.397) (-1641.540) (-1641.469) [-1640.274] -- 0:00:31
574000 -- [-1642.152] (-1646.538) (-1641.748) (-1639.985) * (-1644.696) (-1642.439) (-1639.669) [-1640.258] -- 0:00:31
574500 -- (-1642.078) (-1640.483) (-1642.243) [-1640.767] * (-1641.817) [-1641.328] (-1643.615) (-1638.907) -- 0:00:31
575000 -- (-1642.478) (-1639.775) [-1647.450] (-1643.179) * (-1642.073) (-1640.823) [-1640.717] (-1638.834) -- 0:00:31
Average standard deviation of split frequencies: 0.010435
575500 -- (-1644.395) [-1638.951] (-1638.076) (-1639.543) * (-1639.788) [-1640.419] (-1640.016) (-1638.367) -- 0:00:31
576000 -- (-1639.824) (-1638.951) (-1638.076) [-1639.163] * (-1640.074) [-1638.657] (-1644.217) (-1643.789) -- 0:00:31
576500 -- (-1640.990) [-1639.999] (-1639.202) (-1640.976) * (-1638.574) [-1642.722] (-1639.088) (-1641.694) -- 0:00:31
577000 -- (-1642.796) (-1638.816) [-1640.866] (-1639.160) * [-1641.563] (-1639.953) (-1638.593) (-1640.951) -- 0:00:31
577500 -- (-1639.336) (-1643.543) [-1640.049] (-1639.756) * [-1640.713] (-1641.892) (-1638.086) (-1641.569) -- 0:00:31
578000 -- [-1638.913] (-1642.832) (-1640.633) (-1640.246) * (-1642.170) (-1640.442) [-1643.742] (-1641.183) -- 0:00:31
578500 -- (-1638.800) (-1639.835) (-1642.249) [-1641.444] * (-1639.624) (-1642.471) (-1640.214) [-1639.037] -- 0:00:31
579000 -- [-1638.998] (-1644.391) (-1638.325) (-1639.853) * (-1639.370) (-1640.314) (-1641.768) [-1642.979] -- 0:00:31
579500 -- (-1638.428) (-1639.609) [-1638.229] (-1638.549) * (-1639.137) (-1645.831) (-1640.942) [-1639.931] -- 0:00:31
580000 -- (-1638.762) [-1640.099] (-1639.339) (-1639.842) * [-1640.714] (-1639.126) (-1640.351) (-1640.854) -- 0:00:31
Average standard deviation of split frequencies: 0.010097
580500 -- (-1638.349) (-1642.212) [-1639.803] (-1638.881) * [-1639.225] (-1638.512) (-1640.108) (-1639.033) -- 0:00:31
581000 -- (-1641.622) (-1638.796) (-1640.202) [-1639.615] * (-1640.067) (-1642.222) [-1638.602] (-1639.862) -- 0:00:31
581500 -- (-1642.648) [-1641.948] (-1642.293) (-1639.356) * [-1643.374] (-1639.355) (-1643.108) (-1640.047) -- 0:00:30
582000 -- [-1638.786] (-1641.629) (-1640.610) (-1639.400) * [-1639.007] (-1638.997) (-1638.618) (-1638.732) -- 0:00:31
582500 -- (-1639.775) [-1642.491] (-1640.670) (-1639.667) * [-1641.972] (-1639.076) (-1640.616) (-1639.437) -- 0:00:31
583000 -- [-1638.415] (-1638.867) (-1638.017) (-1641.523) * (-1639.771) [-1642.553] (-1643.571) (-1638.783) -- 0:00:31
583500 -- [-1638.001] (-1642.899) (-1638.002) (-1639.456) * [-1639.045] (-1641.491) (-1640.229) (-1639.416) -- 0:00:31
584000 -- [-1637.939] (-1641.306) (-1639.885) (-1640.389) * (-1639.044) [-1643.178] (-1640.505) (-1641.221) -- 0:00:31
584500 -- (-1641.369) [-1643.533] (-1638.806) (-1641.037) * (-1638.221) (-1643.744) (-1639.610) [-1641.406] -- 0:00:31
585000 -- (-1642.331) (-1638.522) (-1638.804) [-1639.917] * (-1641.876) (-1641.173) (-1639.568) [-1645.434] -- 0:00:31
Average standard deviation of split frequencies: 0.009754
585500 -- [-1643.065] (-1639.118) (-1638.806) (-1639.083) * [-1638.720] (-1643.247) (-1639.137) (-1644.176) -- 0:00:31
586000 -- (-1640.144) (-1638.213) (-1652.688) [-1640.216] * (-1640.048) (-1639.560) (-1642.004) [-1639.967] -- 0:00:31
586500 -- (-1640.241) (-1642.649) (-1645.205) [-1640.195] * (-1639.703) (-1641.580) (-1640.424) [-1640.092] -- 0:00:31
587000 -- (-1640.150) (-1642.028) [-1641.680] (-1639.677) * (-1640.020) [-1639.191] (-1641.159) (-1639.968) -- 0:00:30
587500 -- (-1643.848) [-1639.223] (-1638.978) (-1640.194) * (-1640.048) (-1641.257) [-1642.032] (-1641.634) -- 0:00:30
588000 -- (-1640.458) (-1641.986) (-1639.943) [-1638.696] * [-1639.225] (-1639.833) (-1640.928) (-1640.320) -- 0:00:30
588500 -- (-1642.740) (-1641.178) [-1639.613] (-1638.841) * (-1638.789) [-1641.938] (-1641.093) (-1644.606) -- 0:00:30
589000 -- [-1639.089] (-1641.541) (-1638.948) (-1642.262) * (-1639.920) [-1641.234] (-1638.541) (-1639.004) -- 0:00:30
589500 -- (-1640.162) [-1640.126] (-1638.725) (-1640.119) * (-1639.978) [-1639.283] (-1638.536) (-1639.135) -- 0:00:30
590000 -- [-1638.451] (-1641.318) (-1639.458) (-1639.710) * [-1639.638] (-1639.078) (-1641.133) (-1640.576) -- 0:00:30
Average standard deviation of split frequencies: 0.010275
590500 -- (-1643.949) [-1640.284] (-1641.416) (-1642.282) * (-1640.164) (-1640.124) [-1640.732] (-1640.984) -- 0:00:30
591000 -- (-1642.231) [-1640.286] (-1643.111) (-1643.535) * [-1642.420] (-1642.405) (-1642.672) (-1640.731) -- 0:00:30
591500 -- (-1641.630) (-1640.236) (-1639.698) [-1640.493] * [-1644.181] (-1640.106) (-1639.724) (-1641.493) -- 0:00:30
592000 -- [-1639.775] (-1639.373) (-1638.654) (-1638.661) * [-1639.949] (-1639.721) (-1639.735) (-1641.797) -- 0:00:30
592500 -- (-1639.906) (-1640.431) [-1639.621] (-1639.009) * (-1639.589) [-1639.572] (-1640.605) (-1642.225) -- 0:00:30
593000 -- (-1640.004) (-1643.868) (-1638.741) [-1638.192] * (-1638.654) (-1638.929) [-1638.913] (-1642.854) -- 0:00:30
593500 -- (-1640.256) (-1643.028) [-1640.215] (-1640.005) * (-1644.469) [-1639.457] (-1640.026) (-1640.560) -- 0:00:30
594000 -- (-1639.643) (-1640.605) (-1640.314) [-1639.454] * [-1641.937] (-1642.239) (-1640.248) (-1643.477) -- 0:00:30
594500 -- (-1641.077) [-1639.693] (-1641.205) (-1641.130) * [-1639.395] (-1640.066) (-1639.636) (-1641.437) -- 0:00:30
595000 -- (-1640.706) (-1640.319) [-1644.497] (-1643.351) * (-1641.713) (-1647.060) (-1640.910) [-1640.639] -- 0:00:29
Average standard deviation of split frequencies: 0.009887
595500 -- (-1643.020) (-1645.195) (-1643.615) [-1638.882] * (-1641.416) (-1641.868) [-1640.754] (-1639.044) -- 0:00:30
596000 -- [-1641.480] (-1640.922) (-1643.643) (-1638.668) * [-1642.380] (-1640.873) (-1642.069) (-1638.387) -- 0:00:30
596500 -- (-1642.006) (-1639.919) [-1638.716] (-1640.579) * (-1640.779) (-1638.537) [-1639.067] (-1638.722) -- 0:00:30
597000 -- [-1645.274] (-1641.361) (-1638.849) (-1639.349) * [-1641.191] (-1639.931) (-1640.861) (-1639.312) -- 0:00:30
597500 -- (-1640.174) [-1639.812] (-1638.993) (-1640.585) * (-1640.845) (-1640.786) [-1643.931] (-1640.417) -- 0:00:30
598000 -- [-1640.858] (-1643.691) (-1644.212) (-1642.982) * (-1645.112) [-1639.274] (-1642.026) (-1640.109) -- 0:00:30
598500 -- [-1638.912] (-1640.165) (-1638.757) (-1639.770) * (-1640.662) (-1639.475) (-1647.234) [-1642.438] -- 0:00:30
599000 -- (-1638.292) [-1639.147] (-1637.901) (-1639.784) * (-1644.605) [-1638.342] (-1646.402) (-1639.038) -- 0:00:30
599500 -- (-1639.445) (-1640.334) [-1637.901] (-1641.343) * (-1639.933) [-1640.007] (-1643.870) (-1641.232) -- 0:00:30
600000 -- [-1639.803] (-1641.150) (-1645.391) (-1642.674) * [-1639.200] (-1639.230) (-1641.272) (-1640.989) -- 0:00:29
Average standard deviation of split frequencies: 0.010546
600500 -- (-1639.183) (-1638.660) [-1641.976] (-1640.682) * (-1641.499) (-1643.127) [-1641.530] (-1640.970) -- 0:00:29
601000 -- (-1643.832) (-1639.455) (-1643.911) [-1638.758] * (-1641.528) (-1638.591) [-1640.075] (-1643.524) -- 0:00:29
601500 -- (-1640.846) [-1640.412] (-1641.487) (-1639.022) * (-1645.966) (-1638.666) [-1640.422] (-1641.199) -- 0:00:29
602000 -- (-1642.233) [-1638.779] (-1640.882) (-1639.233) * (-1639.685) [-1640.560] (-1642.111) (-1640.409) -- 0:00:29
602500 -- (-1642.130) (-1640.007) (-1639.273) [-1639.795] * (-1640.077) (-1638.683) (-1640.465) [-1640.740] -- 0:00:29
603000 -- (-1640.016) [-1639.868] (-1640.338) (-1639.210) * [-1638.772] (-1639.287) (-1642.601) (-1643.224) -- 0:00:29
603500 -- (-1639.955) [-1639.963] (-1639.031) (-1639.124) * (-1640.027) (-1641.648) (-1641.198) [-1639.488] -- 0:00:29
604000 -- (-1638.570) [-1641.231] (-1642.337) (-1640.154) * [-1639.406] (-1644.165) (-1641.080) (-1641.685) -- 0:00:29
604500 -- (-1642.764) (-1640.221) (-1643.249) [-1640.328] * (-1639.076) (-1639.700) (-1639.386) [-1638.752] -- 0:00:29
605000 -- (-1644.855) (-1639.165) (-1642.409) [-1641.235] * (-1640.711) [-1640.672] (-1638.815) (-1638.805) -- 0:00:29
Average standard deviation of split frequencies: 0.010845
605500 -- [-1643.517] (-1638.432) (-1641.947) (-1639.045) * (-1643.169) (-1641.572) [-1639.489] (-1643.933) -- 0:00:29
606000 -- [-1639.972] (-1640.583) (-1641.753) (-1638.610) * (-1638.643) (-1640.155) [-1640.537] (-1640.751) -- 0:00:29
606500 -- (-1639.896) (-1639.846) (-1641.345) [-1639.340] * (-1639.916) (-1639.657) (-1640.153) [-1639.183] -- 0:00:29
607000 -- (-1638.818) [-1639.825] (-1641.042) (-1640.065) * [-1640.620] (-1640.483) (-1638.604) (-1639.184) -- 0:00:29
607500 -- (-1642.182) (-1642.840) (-1642.740) [-1641.711] * [-1639.220] (-1642.536) (-1638.891) (-1640.278) -- 0:00:29
608000 -- (-1640.884) [-1641.038] (-1640.906) (-1641.186) * (-1638.718) (-1638.162) [-1640.688] (-1638.848) -- 0:00:29
608500 -- (-1643.277) (-1640.243) [-1642.142] (-1641.390) * (-1639.085) [-1638.149] (-1640.771) (-1639.100) -- 0:00:28
609000 -- (-1641.498) (-1643.002) [-1638.988] (-1645.544) * [-1638.905] (-1638.049) (-1640.092) (-1641.231) -- 0:00:29
609500 -- [-1639.609] (-1641.838) (-1638.459) (-1639.630) * (-1639.491) (-1642.485) [-1641.466] (-1643.455) -- 0:00:29
610000 -- (-1639.088) (-1643.622) (-1638.661) [-1644.990] * (-1641.803) (-1642.660) (-1641.353) [-1639.933] -- 0:00:29
Average standard deviation of split frequencies: 0.010762
610500 -- (-1640.131) [-1640.179] (-1638.589) (-1639.177) * (-1641.709) [-1639.490] (-1640.220) (-1640.234) -- 0:00:29
611000 -- (-1639.779) (-1638.837) (-1642.684) [-1638.941] * (-1640.949) (-1641.382) (-1640.518) [-1641.980] -- 0:00:29
611500 -- (-1640.963) (-1639.359) (-1640.348) [-1639.470] * (-1642.255) (-1640.742) [-1639.255] (-1640.525) -- 0:00:29
612000 -- (-1640.508) (-1642.216) [-1640.848] (-1638.168) * (-1645.846) [-1642.152] (-1647.638) (-1640.787) -- 0:00:29
612500 -- (-1639.987) (-1638.566) [-1640.522] (-1645.721) * (-1643.114) [-1640.971] (-1644.030) (-1639.946) -- 0:00:29
613000 -- (-1638.875) (-1640.099) [-1640.116] (-1643.447) * (-1639.930) (-1642.239) (-1639.817) [-1639.085] -- 0:00:29
613500 -- [-1638.940] (-1642.618) (-1642.369) (-1642.094) * (-1641.474) [-1640.014] (-1638.428) (-1638.509) -- 0:00:28
614000 -- (-1641.313) (-1643.737) (-1639.125) [-1639.398] * (-1643.325) [-1641.934] (-1638.605) (-1639.154) -- 0:00:28
614500 -- (-1640.372) [-1641.202] (-1639.482) (-1637.974) * (-1643.623) [-1639.647] (-1645.512) (-1639.625) -- 0:00:28
615000 -- (-1639.723) (-1639.801) [-1638.805] (-1643.451) * [-1640.072] (-1640.526) (-1638.532) (-1638.535) -- 0:00:28
Average standard deviation of split frequencies: 0.011524
615500 -- (-1641.393) (-1641.547) [-1639.547] (-1639.148) * (-1639.381) (-1640.954) (-1638.854) [-1638.545] -- 0:00:28
616000 -- (-1638.138) (-1641.855) (-1639.423) [-1643.532] * (-1642.101) [-1641.078] (-1640.484) (-1639.912) -- 0:00:28
616500 -- (-1640.389) (-1642.907) (-1641.401) [-1642.944] * (-1641.014) (-1639.193) [-1639.256] (-1638.520) -- 0:00:28
617000 -- (-1639.064) (-1641.042) (-1646.989) [-1640.858] * (-1641.903) (-1642.065) (-1639.757) [-1640.848] -- 0:00:28
617500 -- [-1640.832] (-1640.492) (-1642.971) (-1640.452) * (-1641.485) (-1641.227) (-1640.256) [-1640.582] -- 0:00:28
618000 -- [-1646.046] (-1644.619) (-1646.166) (-1640.527) * [-1638.869] (-1640.818) (-1639.118) (-1640.195) -- 0:00:28
618500 -- [-1640.954] (-1641.357) (-1646.110) (-1641.381) * (-1638.869) (-1641.472) [-1638.433] (-1640.908) -- 0:00:28
619000 -- [-1642.041] (-1644.324) (-1644.249) (-1641.627) * (-1640.599) [-1639.669] (-1638.947) (-1641.653) -- 0:00:28
619500 -- (-1639.189) [-1639.630] (-1642.272) (-1643.073) * (-1640.037) [-1639.635] (-1639.562) (-1639.337) -- 0:00:28
620000 -- [-1641.665] (-1640.573) (-1640.719) (-1639.054) * (-1639.231) [-1639.400] (-1642.390) (-1640.045) -- 0:00:28
Average standard deviation of split frequencies: 0.011482
620500 -- [-1641.231] (-1639.063) (-1641.539) (-1646.771) * (-1640.408) (-1639.127) [-1638.778] (-1639.599) -- 0:00:28
621000 -- (-1641.624) [-1640.416] (-1639.347) (-1639.678) * (-1640.579) (-1639.392) [-1643.364] (-1640.428) -- 0:00:28
621500 -- (-1641.251) [-1639.668] (-1640.427) (-1643.895) * (-1639.388) [-1640.780] (-1638.697) (-1638.470) -- 0:00:28
622000 -- (-1640.392) (-1640.424) (-1638.416) [-1638.790] * (-1640.560) [-1640.109] (-1640.293) (-1641.949) -- 0:00:27
622500 -- (-1639.478) (-1640.203) (-1637.933) [-1641.567] * (-1640.333) (-1640.151) [-1638.938] (-1638.834) -- 0:00:28
623000 -- (-1638.582) (-1642.124) [-1642.933] (-1639.558) * (-1643.801) (-1639.434) [-1640.027] (-1639.292) -- 0:00:28
623500 -- (-1642.478) (-1641.859) [-1642.916] (-1641.545) * (-1641.285) (-1639.042) [-1640.075] (-1639.937) -- 0:00:28
624000 -- (-1640.537) [-1639.751] (-1640.950) (-1641.506) * (-1641.182) (-1638.642) (-1640.606) [-1641.907] -- 0:00:28
624500 -- (-1643.591) (-1639.529) [-1639.859] (-1643.330) * [-1639.603] (-1639.013) (-1643.323) (-1641.865) -- 0:00:28
625000 -- (-1645.205) (-1640.771) [-1642.315] (-1640.576) * (-1639.206) (-1639.009) [-1640.379] (-1641.546) -- 0:00:28
Average standard deviation of split frequencies: 0.011871
625500 -- (-1641.637) (-1640.310) (-1640.924) [-1640.550] * (-1639.918) (-1639.562) [-1641.206] (-1643.343) -- 0:00:28
626000 -- (-1642.362) (-1638.930) (-1639.731) [-1640.205] * (-1644.199) (-1638.870) [-1639.718] (-1641.113) -- 0:00:28
626500 -- [-1639.746] (-1639.350) (-1640.093) (-1640.929) * (-1640.207) (-1638.733) (-1638.867) [-1638.828] -- 0:00:28
627000 -- (-1640.865) (-1640.429) [-1638.639] (-1640.964) * [-1639.614] (-1640.063) (-1640.126) (-1638.466) -- 0:00:27
627500 -- (-1640.734) [-1641.634] (-1640.054) (-1639.613) * (-1641.367) [-1639.677] (-1641.283) (-1642.809) -- 0:00:27
628000 -- [-1639.867] (-1641.097) (-1642.177) (-1639.806) * (-1640.596) [-1640.881] (-1643.120) (-1642.140) -- 0:00:27
628500 -- [-1641.045] (-1642.669) (-1642.905) (-1640.332) * (-1643.909) [-1639.615] (-1642.111) (-1638.890) -- 0:00:27
629000 -- (-1640.679) [-1641.244] (-1639.658) (-1639.645) * (-1642.232) [-1638.623] (-1640.378) (-1639.491) -- 0:00:27
629500 -- [-1642.774] (-1639.275) (-1638.603) (-1641.429) * [-1639.721] (-1638.639) (-1639.426) (-1640.340) -- 0:00:27
630000 -- (-1644.077) [-1638.473] (-1638.610) (-1639.065) * [-1640.895] (-1638.455) (-1642.889) (-1640.804) -- 0:00:27
Average standard deviation of split frequencies: 0.011960
630500 -- [-1641.847] (-1639.154) (-1640.511) (-1639.581) * (-1638.881) [-1639.023] (-1641.389) (-1639.491) -- 0:00:27
631000 -- (-1639.607) [-1639.397] (-1641.866) (-1641.578) * [-1638.854] (-1640.280) (-1641.546) (-1646.617) -- 0:00:27
631500 -- (-1639.104) (-1638.994) (-1639.658) [-1639.120] * [-1638.776] (-1639.379) (-1638.303) (-1643.375) -- 0:00:27
632000 -- (-1646.237) (-1638.954) (-1639.727) [-1639.936] * (-1640.356) (-1639.332) [-1638.311] (-1640.721) -- 0:00:27
632500 -- [-1643.403] (-1641.661) (-1645.226) (-1638.975) * (-1640.171) (-1638.938) [-1640.331] (-1637.852) -- 0:00:27
633000 -- [-1642.940] (-1643.491) (-1641.610) (-1639.392) * (-1640.503) (-1641.572) (-1641.912) [-1639.004] -- 0:00:27
633500 -- (-1641.044) (-1641.696) [-1639.248] (-1641.746) * (-1640.527) (-1640.242) [-1638.788] (-1640.281) -- 0:00:27
634000 -- [-1639.487] (-1639.635) (-1639.122) (-1638.271) * (-1641.846) (-1641.750) [-1639.003] (-1641.533) -- 0:00:27
634500 -- [-1644.980] (-1641.488) (-1642.557) (-1640.259) * (-1640.612) (-1644.025) [-1640.598] (-1645.281) -- 0:00:27
635000 -- [-1644.602] (-1638.873) (-1641.772) (-1638.429) * (-1638.892) [-1640.037] (-1643.803) (-1640.919) -- 0:00:27
Average standard deviation of split frequencies: 0.011257
635500 -- (-1644.432) (-1639.101) (-1640.518) [-1639.412] * [-1641.474] (-1639.974) (-1641.068) (-1638.616) -- 0:00:26
636000 -- (-1639.194) (-1641.143) [-1638.182] (-1639.098) * [-1638.279] (-1639.007) (-1642.241) (-1639.145) -- 0:00:27
636500 -- [-1638.952] (-1638.775) (-1638.254) (-1638.904) * (-1639.621) (-1639.826) (-1653.085) [-1639.350] -- 0:00:27
637000 -- (-1639.652) (-1638.612) [-1638.343] (-1639.328) * (-1640.743) (-1640.052) (-1640.709) [-1640.641] -- 0:00:27
637500 -- (-1638.620) (-1640.978) (-1639.850) [-1638.547] * [-1641.150] (-1642.092) (-1642.028) (-1640.372) -- 0:00:27
638000 -- (-1639.306) [-1638.734] (-1638.843) (-1638.605) * [-1641.974] (-1640.941) (-1639.526) (-1639.205) -- 0:00:27
638500 -- (-1639.363) (-1639.751) (-1638.914) [-1638.969] * [-1639.451] (-1639.944) (-1639.201) (-1641.092) -- 0:00:27
639000 -- (-1645.891) [-1639.172] (-1640.280) (-1639.256) * (-1641.013) [-1641.896] (-1640.412) (-1638.275) -- 0:00:27
639500 -- (-1641.930) (-1640.670) [-1639.833] (-1643.067) * (-1640.198) (-1640.047) (-1646.002) [-1638.079] -- 0:00:27
640000 -- (-1643.972) (-1640.525) [-1639.498] (-1643.625) * (-1641.511) (-1639.620) (-1641.651) [-1638.078] -- 0:00:26
Average standard deviation of split frequencies: 0.011451
640500 -- [-1641.872] (-1641.912) (-1639.662) (-1638.510) * [-1640.220] (-1639.936) (-1644.476) (-1640.317) -- 0:00:26
641000 -- (-1641.450) (-1638.990) [-1639.344] (-1638.952) * (-1640.471) (-1640.870) [-1639.517] (-1640.865) -- 0:00:26
641500 -- (-1641.664) [-1639.321] (-1640.158) (-1643.469) * (-1640.664) (-1639.631) (-1639.701) [-1641.892] -- 0:00:26
642000 -- (-1640.106) (-1638.415) (-1640.580) [-1643.076] * (-1639.214) (-1639.054) [-1641.300] (-1643.508) -- 0:00:26
642500 -- (-1640.456) (-1640.387) [-1638.823] (-1640.189) * (-1640.403) (-1641.620) (-1642.059) [-1645.240] -- 0:00:26
643000 -- (-1639.457) (-1638.987) [-1641.076] (-1642.328) * (-1643.312) (-1643.051) [-1639.598] (-1643.171) -- 0:00:26
643500 -- (-1639.331) (-1646.049) (-1644.239) [-1639.970] * (-1640.949) (-1641.856) (-1639.737) [-1638.073] -- 0:00:26
644000 -- (-1641.349) (-1639.478) (-1638.587) [-1641.321] * (-1642.462) [-1638.179] (-1639.224) (-1639.021) -- 0:00:26
644500 -- (-1639.961) (-1643.609) (-1640.959) [-1642.535] * (-1642.927) (-1638.184) (-1641.221) [-1639.013] -- 0:00:26
645000 -- (-1643.094) (-1644.335) [-1641.007] (-1643.552) * (-1643.682) (-1638.321) [-1639.300] (-1640.156) -- 0:00:26
Average standard deviation of split frequencies: 0.011461
645500 -- (-1641.413) (-1641.778) [-1645.465] (-1644.724) * [-1639.789] (-1639.781) (-1642.962) (-1640.196) -- 0:00:26
646000 -- (-1644.976) [-1640.818] (-1650.060) (-1640.928) * (-1642.400) (-1641.988) [-1641.617] (-1641.369) -- 0:00:26
646500 -- (-1645.687) (-1638.324) (-1645.843) [-1641.905] * (-1641.492) [-1639.997] (-1641.588) (-1638.134) -- 0:00:26
647000 -- [-1640.927] (-1639.813) (-1640.308) (-1638.927) * (-1638.462) (-1639.971) [-1638.884] (-1640.411) -- 0:00:26
647500 -- (-1646.163) (-1640.911) [-1638.479] (-1639.692) * (-1643.102) [-1639.279] (-1640.707) (-1639.733) -- 0:00:26
648000 -- [-1646.587] (-1641.755) (-1638.848) (-1641.830) * [-1638.497] (-1640.418) (-1642.130) (-1640.155) -- 0:00:26
648500 -- [-1642.200] (-1640.593) (-1640.155) (-1641.035) * (-1641.624) (-1642.398) (-1640.696) [-1639.333] -- 0:00:26
649000 -- (-1642.867) [-1639.142] (-1639.424) (-1641.478) * (-1639.522) (-1641.481) (-1644.843) [-1639.210] -- 0:00:25
649500 -- (-1638.556) [-1641.288] (-1640.478) (-1640.646) * (-1640.501) (-1642.145) (-1642.847) [-1639.586] -- 0:00:26
650000 -- (-1639.579) (-1641.006) (-1638.820) [-1639.728] * (-1639.030) [-1638.576] (-1639.467) (-1638.372) -- 0:00:26
Average standard deviation of split frequencies: 0.011464
650500 -- (-1638.052) (-1639.579) (-1640.827) [-1640.135] * (-1640.957) [-1638.542] (-1638.729) (-1641.488) -- 0:00:26
651000 -- (-1640.230) (-1641.306) (-1645.263) [-1642.092] * [-1638.610] (-1640.714) (-1638.813) (-1640.486) -- 0:00:26
651500 -- [-1642.429] (-1643.748) (-1641.408) (-1642.923) * (-1639.006) [-1641.530] (-1639.164) (-1640.088) -- 0:00:26
652000 -- (-1640.241) [-1641.328] (-1641.770) (-1644.582) * (-1639.487) (-1640.271) (-1638.771) [-1642.304] -- 0:00:26
652500 -- (-1642.363) (-1639.088) (-1644.007) [-1640.241] * (-1640.550) [-1640.394] (-1638.952) (-1643.675) -- 0:00:26
653000 -- [-1640.001] (-1639.230) (-1640.319) (-1640.028) * (-1638.574) (-1641.303) (-1638.749) [-1641.493] -- 0:00:26
653500 -- (-1639.682) [-1639.489] (-1639.772) (-1642.991) * [-1638.814] (-1641.841) (-1638.279) (-1640.979) -- 0:00:25
654000 -- (-1638.898) (-1639.999) [-1639.209] (-1642.887) * (-1641.241) [-1638.719] (-1638.995) (-1641.645) -- 0:00:25
654500 -- [-1641.157] (-1638.875) (-1639.674) (-1640.944) * [-1641.814] (-1641.057) (-1642.130) (-1639.375) -- 0:00:25
655000 -- (-1638.150) (-1639.089) [-1639.829] (-1639.836) * (-1641.676) (-1642.263) (-1641.250) [-1639.667] -- 0:00:25
Average standard deviation of split frequencies: 0.011371
655500 -- (-1639.449) [-1639.632] (-1639.537) (-1641.973) * (-1639.462) (-1641.220) [-1643.903] (-1640.843) -- 0:00:25
656000 -- (-1638.990) [-1639.347] (-1639.083) (-1639.037) * [-1640.754] (-1642.923) (-1638.158) (-1641.300) -- 0:00:25
656500 -- [-1639.325] (-1639.378) (-1639.876) (-1640.255) * (-1640.663) (-1639.822) [-1638.142] (-1639.950) -- 0:00:25
657000 -- (-1642.217) [-1640.314] (-1643.044) (-1640.515) * (-1642.158) (-1641.946) [-1640.675] (-1642.250) -- 0:00:25
657500 -- (-1639.232) (-1640.087) [-1639.138] (-1640.147) * [-1640.326] (-1640.929) (-1639.552) (-1640.672) -- 0:00:25
658000 -- (-1640.022) [-1641.407] (-1642.447) (-1641.115) * [-1641.015] (-1640.845) (-1638.923) (-1642.621) -- 0:00:25
658500 -- [-1638.814] (-1640.958) (-1640.148) (-1639.774) * (-1640.894) [-1640.408] (-1641.738) (-1642.523) -- 0:00:25
659000 -- (-1642.531) (-1643.100) (-1639.635) [-1639.355] * [-1640.162] (-1641.264) (-1642.106) (-1644.405) -- 0:00:25
659500 -- (-1640.235) [-1643.912] (-1641.238) (-1643.673) * [-1642.081] (-1640.453) (-1641.167) (-1642.956) -- 0:00:25
660000 -- (-1639.877) (-1640.691) [-1638.580] (-1641.862) * (-1638.969) (-1642.573) [-1638.696] (-1640.897) -- 0:00:25
Average standard deviation of split frequencies: 0.011165
660500 -- (-1640.616) (-1641.353) (-1640.494) [-1639.745] * (-1638.924) [-1640.179] (-1641.501) (-1638.927) -- 0:00:25
661000 -- (-1640.686) (-1644.363) [-1639.801] (-1639.710) * (-1642.112) (-1640.154) (-1640.650) [-1639.473] -- 0:00:25
661500 -- (-1640.880) (-1640.290) [-1638.818] (-1639.128) * [-1640.617] (-1639.643) (-1640.174) (-1638.359) -- 0:00:25
662000 -- (-1639.717) (-1639.103) (-1643.387) [-1641.774] * (-1640.234) (-1640.661) [-1640.446] (-1638.788) -- 0:00:25
662500 -- (-1638.617) [-1642.088] (-1638.411) (-1645.457) * (-1640.509) [-1640.857] (-1640.684) (-1638.864) -- 0:00:24
663000 -- (-1640.172) (-1640.164) [-1638.662] (-1638.925) * (-1639.683) (-1640.166) [-1639.106] (-1640.398) -- 0:00:25
663500 -- (-1641.128) (-1639.426) [-1639.475] (-1639.286) * (-1638.860) [-1638.776] (-1641.813) (-1642.788) -- 0:00:25
664000 -- (-1638.972) [-1641.033] (-1643.165) (-1639.608) * [-1639.110] (-1642.650) (-1641.810) (-1640.885) -- 0:00:25
664500 -- [-1640.822] (-1639.126) (-1640.078) (-1639.360) * (-1641.198) (-1646.207) [-1643.651] (-1639.652) -- 0:00:25
665000 -- (-1639.149) [-1638.970] (-1641.704) (-1642.969) * [-1639.934] (-1642.664) (-1641.849) (-1639.847) -- 0:00:25
Average standard deviation of split frequencies: 0.010700
665500 -- (-1641.128) (-1640.664) [-1641.692] (-1640.602) * (-1639.749) (-1638.533) (-1641.893) [-1641.629] -- 0:00:25
666000 -- [-1639.384] (-1641.648) (-1640.422) (-1640.457) * (-1639.335) (-1645.037) (-1638.509) [-1640.993] -- 0:00:25
666500 -- (-1639.915) [-1640.364] (-1638.846) (-1643.564) * (-1638.953) (-1640.159) (-1641.091) [-1639.803] -- 0:00:25
667000 -- (-1641.911) [-1641.252] (-1639.874) (-1641.256) * [-1643.151] (-1639.361) (-1640.922) (-1639.558) -- 0:00:24
667500 -- [-1638.235] (-1641.396) (-1648.928) (-1639.991) * (-1645.454) (-1640.311) [-1642.168] (-1643.502) -- 0:00:24
668000 -- (-1640.883) (-1644.169) [-1640.156] (-1640.012) * (-1642.514) (-1641.046) (-1641.270) [-1641.593] -- 0:00:24
668500 -- (-1641.978) (-1639.877) (-1640.274) [-1642.465] * [-1640.961] (-1641.029) (-1639.346) (-1640.364) -- 0:00:24
669000 -- (-1641.946) [-1640.570] (-1639.956) (-1639.664) * (-1643.578) [-1640.129] (-1640.136) (-1638.984) -- 0:00:24
669500 -- (-1640.817) [-1641.467] (-1639.503) (-1639.827) * [-1639.434] (-1640.707) (-1639.241) (-1640.031) -- 0:00:24
670000 -- [-1640.667] (-1640.388) (-1638.478) (-1641.628) * (-1643.143) (-1639.377) (-1641.029) [-1639.593] -- 0:00:24
Average standard deviation of split frequencies: 0.010295
670500 -- (-1645.819) (-1640.832) (-1641.151) [-1642.705] * (-1642.969) (-1640.626) [-1638.687] (-1641.296) -- 0:00:24
671000 -- [-1639.117] (-1641.701) (-1641.191) (-1639.875) * [-1641.554] (-1641.328) (-1639.054) (-1638.381) -- 0:00:24
671500 -- [-1644.765] (-1641.030) (-1639.377) (-1638.436) * [-1640.175] (-1643.806) (-1640.858) (-1639.136) -- 0:00:24
672000 -- (-1640.004) [-1641.494] (-1643.962) (-1638.523) * (-1640.080) [-1640.896] (-1641.491) (-1640.767) -- 0:00:24
672500 -- (-1640.629) (-1639.065) [-1640.634] (-1639.219) * [-1640.416] (-1641.378) (-1645.944) (-1641.902) -- 0:00:24
673000 -- (-1640.713) (-1640.253) (-1640.455) [-1644.482] * [-1639.654] (-1642.428) (-1641.356) (-1641.228) -- 0:00:24
673500 -- (-1645.151) (-1639.842) [-1639.516] (-1642.574) * (-1642.235) (-1640.330) [-1639.216] (-1641.084) -- 0:00:24
674000 -- (-1643.911) (-1639.870) [-1641.905] (-1641.751) * (-1641.182) [-1640.974] (-1638.850) (-1639.193) -- 0:00:24
674500 -- (-1639.524) (-1638.212) [-1638.516] (-1642.311) * (-1639.218) [-1638.832] (-1639.710) (-1642.606) -- 0:00:24
675000 -- (-1640.975) [-1642.143] (-1642.296) (-1641.267) * (-1639.578) (-1640.631) [-1639.148] (-1641.130) -- 0:00:24
Average standard deviation of split frequencies: 0.009894
675500 -- (-1639.679) (-1641.442) [-1642.421] (-1640.235) * (-1638.777) (-1640.951) [-1639.630] (-1640.913) -- 0:00:24
676000 -- (-1639.591) (-1640.934) [-1640.895] (-1642.021) * [-1640.215] (-1639.373) (-1641.292) (-1640.879) -- 0:00:23
676500 -- (-1640.704) (-1638.570) (-1638.829) [-1639.761] * (-1642.072) (-1641.831) (-1640.347) [-1640.974] -- 0:00:24
677000 -- (-1639.835) (-1642.707) [-1639.427] (-1641.119) * (-1643.796) (-1643.072) [-1639.831] (-1642.144) -- 0:00:24
677500 -- (-1640.820) [-1640.340] (-1640.946) (-1638.585) * (-1639.948) [-1640.602] (-1638.469) (-1642.793) -- 0:00:24
678000 -- [-1641.270] (-1638.516) (-1640.093) (-1638.544) * (-1641.394) (-1638.517) [-1640.673] (-1642.666) -- 0:00:24
678500 -- (-1643.094) (-1638.516) [-1639.575] (-1639.414) * [-1639.783] (-1638.740) (-1640.258) (-1642.543) -- 0:00:24
679000 -- (-1639.375) (-1640.390) [-1640.989] (-1640.124) * [-1643.864] (-1638.519) (-1639.256) (-1641.255) -- 0:00:24
679500 -- (-1638.477) (-1640.031) (-1639.377) [-1639.895] * [-1643.030] (-1642.611) (-1640.662) (-1643.590) -- 0:00:24
680000 -- (-1638.477) (-1642.190) [-1640.436] (-1644.836) * (-1640.114) [-1639.171] (-1639.409) (-1638.738) -- 0:00:23
Average standard deviation of split frequencies: 0.009869
680500 -- (-1640.330) (-1641.876) (-1639.446) [-1640.857] * (-1640.011) (-1638.507) (-1640.830) [-1640.318] -- 0:00:23
681000 -- (-1639.600) [-1640.567] (-1639.671) (-1640.871) * (-1640.938) (-1638.507) [-1640.661] (-1639.646) -- 0:00:23
681500 -- (-1640.219) (-1642.753) [-1639.115] (-1640.589) * (-1643.310) (-1638.178) (-1640.923) [-1640.627] -- 0:00:23
682000 -- (-1638.931) [-1639.200] (-1638.919) (-1640.538) * (-1641.462) (-1643.151) [-1641.119] (-1643.892) -- 0:00:23
682500 -- (-1640.426) [-1639.817] (-1638.919) (-1639.365) * (-1642.721) (-1639.472) (-1641.427) [-1642.640] -- 0:00:23
683000 -- (-1640.367) (-1641.510) [-1639.527] (-1644.729) * [-1639.775] (-1642.092) (-1638.692) (-1641.953) -- 0:00:23
683500 -- (-1640.710) (-1639.365) (-1639.008) [-1641.911] * (-1642.730) [-1639.310] (-1641.064) (-1642.494) -- 0:00:23
684000 -- (-1639.304) (-1638.544) [-1639.336] (-1639.464) * [-1639.880] (-1638.737) (-1643.385) (-1640.947) -- 0:00:23
684500 -- (-1639.554) [-1639.465] (-1640.684) (-1640.681) * (-1638.790) (-1638.026) (-1640.151) [-1639.635] -- 0:00:23
685000 -- (-1641.169) (-1640.615) [-1638.348] (-1640.761) * (-1642.613) (-1639.824) (-1639.456) [-1644.568] -- 0:00:23
Average standard deviation of split frequencies: 0.010065
685500 -- (-1648.219) [-1639.344] (-1638.224) (-1640.419) * (-1639.220) [-1638.901] (-1639.415) (-1638.230) -- 0:00:23
686000 -- (-1643.039) [-1638.963] (-1638.884) (-1641.545) * [-1638.731] (-1639.041) (-1640.192) (-1641.139) -- 0:00:23
686500 -- (-1640.670) [-1638.568] (-1642.347) (-1641.207) * [-1641.999] (-1641.467) (-1642.633) (-1640.433) -- 0:00:23
687000 -- (-1639.910) [-1640.554] (-1641.032) (-1638.829) * (-1639.242) [-1641.510] (-1642.804) (-1640.527) -- 0:00:23
687500 -- (-1640.658) (-1640.477) [-1640.080] (-1641.395) * (-1639.378) [-1638.771] (-1639.101) (-1641.073) -- 0:00:23
688000 -- (-1641.265) (-1643.048) (-1640.045) [-1639.504] * (-1641.113) (-1639.768) (-1640.773) [-1643.228] -- 0:00:23
688500 -- (-1639.943) (-1639.851) [-1640.075] (-1646.449) * (-1640.792) [-1641.268] (-1638.598) (-1644.821) -- 0:00:23
689000 -- (-1640.351) (-1640.615) (-1638.425) [-1640.751] * (-1638.536) (-1638.340) [-1639.604] (-1641.769) -- 0:00:23
689500 -- (-1641.412) (-1643.886) [-1641.306] (-1643.121) * (-1638.147) (-1641.170) (-1639.678) [-1642.916] -- 0:00:22
690000 -- (-1640.225) [-1643.109] (-1643.074) (-1638.840) * [-1638.138] (-1641.031) (-1639.566) (-1641.313) -- 0:00:23
Average standard deviation of split frequencies: 0.009957
690500 -- (-1639.699) (-1638.986) [-1639.608] (-1641.352) * (-1640.861) (-1640.613) [-1638.850] (-1642.529) -- 0:00:23
691000 -- (-1639.899) (-1644.192) [-1640.290] (-1641.222) * (-1638.539) (-1639.941) (-1642.293) [-1643.996] -- 0:00:23
691500 -- (-1640.598) (-1642.077) [-1638.747] (-1639.140) * (-1641.967) (-1639.610) [-1640.292] (-1645.382) -- 0:00:23
692000 -- (-1639.248) (-1640.380) (-1638.516) [-1641.543] * (-1641.547) (-1639.708) (-1641.078) [-1641.351] -- 0:00:23
692500 -- (-1642.410) (-1638.479) (-1640.952) [-1642.371] * (-1642.537) [-1639.640] (-1640.412) (-1638.949) -- 0:00:23
693000 -- (-1640.527) (-1638.156) (-1639.934) [-1642.348] * (-1646.189) (-1639.302) [-1640.052] (-1644.883) -- 0:00:23
693500 -- (-1641.008) (-1639.730) [-1639.144] (-1640.169) * (-1639.322) (-1641.138) [-1640.381] (-1639.945) -- 0:00:22
694000 -- [-1639.483] (-1645.746) (-1641.264) (-1638.508) * [-1641.086] (-1641.202) (-1642.239) (-1638.389) -- 0:00:22
694500 -- (-1639.224) (-1640.945) (-1639.489) [-1638.471] * [-1645.347] (-1642.365) (-1638.545) (-1641.636) -- 0:00:22
695000 -- [-1645.349] (-1641.626) (-1641.191) (-1637.992) * (-1641.936) (-1639.630) (-1640.629) [-1638.952] -- 0:00:22
Average standard deviation of split frequencies: 0.009821
695500 -- (-1640.135) (-1638.183) [-1640.199] (-1639.254) * [-1639.727] (-1638.624) (-1641.437) (-1642.504) -- 0:00:22
696000 -- (-1638.495) (-1641.487) [-1640.604] (-1641.377) * (-1639.598) (-1638.571) [-1639.710] (-1643.525) -- 0:00:22
696500 -- [-1639.472] (-1645.164) (-1639.332) (-1639.504) * (-1639.141) (-1640.870) [-1641.787] (-1641.272) -- 0:00:22
697000 -- (-1638.648) (-1641.536) (-1638.778) [-1639.300] * (-1638.983) (-1649.223) (-1642.244) [-1638.574] -- 0:00:22
697500 -- [-1640.797] (-1640.427) (-1640.216) (-1641.549) * (-1640.248) (-1642.109) (-1641.066) [-1639.150] -- 0:00:22
698000 -- (-1640.787) (-1641.009) (-1640.266) [-1643.129] * (-1642.349) [-1640.318] (-1640.880) (-1640.575) -- 0:00:22
698500 -- (-1639.070) (-1638.996) (-1639.105) [-1640.002] * [-1642.565] (-1639.773) (-1641.851) (-1639.131) -- 0:00:22
699000 -- (-1639.853) (-1638.416) (-1640.117) [-1638.707] * (-1641.201) (-1639.187) [-1643.929] (-1639.593) -- 0:00:22
699500 -- [-1639.061] (-1638.466) (-1640.549) (-1638.850) * (-1642.970) (-1639.698) [-1642.043] (-1642.203) -- 0:00:22
700000 -- (-1641.039) (-1639.845) [-1641.934] (-1638.588) * (-1639.642) [-1639.654] (-1641.846) (-1640.472) -- 0:00:22
Average standard deviation of split frequencies: 0.009924
700500 -- (-1639.048) (-1640.483) (-1640.447) [-1638.810] * (-1641.563) (-1639.672) [-1641.335] (-1646.883) -- 0:00:22
701000 -- (-1639.279) [-1638.685] (-1641.377) (-1642.048) * (-1641.568) [-1639.512] (-1639.413) (-1644.380) -- 0:00:22
701500 -- [-1642.622] (-1642.929) (-1642.335) (-1640.650) * [-1643.728] (-1638.718) (-1639.149) (-1642.037) -- 0:00:22
702000 -- (-1640.929) [-1641.762] (-1639.477) (-1640.038) * (-1638.704) (-1638.652) [-1641.871] (-1640.785) -- 0:00:22
702500 -- (-1640.866) (-1644.387) [-1641.520] (-1641.258) * (-1641.496) (-1641.054) (-1640.274) [-1644.013] -- 0:00:22
703000 -- (-1644.760) (-1644.523) [-1640.395] (-1641.704) * (-1639.537) (-1639.897) [-1640.122] (-1645.920) -- 0:00:21
703500 -- [-1642.488] (-1640.090) (-1641.486) (-1639.104) * (-1640.384) [-1641.379] (-1642.322) (-1642.485) -- 0:00:22
704000 -- (-1639.160) (-1640.375) [-1641.998] (-1638.846) * (-1639.762) [-1639.678] (-1639.424) (-1639.189) -- 0:00:22
704500 -- (-1638.612) [-1641.346] (-1640.403) (-1641.021) * (-1638.894) (-1638.399) (-1639.994) [-1639.325] -- 0:00:22
705000 -- [-1639.165] (-1640.229) (-1639.801) (-1640.067) * [-1639.150] (-1638.542) (-1638.513) (-1640.868) -- 0:00:22
Average standard deviation of split frequencies: 0.009937
705500 -- (-1639.934) (-1641.120) (-1639.897) [-1638.780] * (-1643.671) (-1638.029) [-1639.752] (-1641.512) -- 0:00:22
706000 -- (-1642.588) [-1640.131] (-1640.685) (-1639.639) * (-1640.217) (-1638.038) (-1640.383) [-1641.560] -- 0:00:22
706500 -- (-1641.302) (-1639.083) (-1642.509) [-1638.363] * (-1640.455) [-1639.048] (-1643.743) (-1638.177) -- 0:00:22
707000 -- (-1643.243) (-1641.389) [-1638.612] (-1640.653) * (-1641.851) (-1640.127) [-1641.331] (-1640.172) -- 0:00:21
707500 -- (-1638.883) (-1640.416) (-1639.635) [-1637.882] * (-1640.336) [-1642.689] (-1640.259) (-1640.737) -- 0:00:21
708000 -- (-1640.947) [-1640.353] (-1638.946) (-1639.314) * (-1640.748) [-1639.062] (-1643.402) (-1641.065) -- 0:00:21
708500 -- (-1639.392) (-1639.650) (-1643.032) [-1640.647] * (-1638.834) (-1640.021) [-1640.443] (-1640.485) -- 0:00:21
709000 -- (-1643.986) (-1638.350) [-1643.034] (-1640.291) * [-1638.846] (-1638.561) (-1642.168) (-1642.267) -- 0:00:21
709500 -- [-1639.217] (-1641.053) (-1641.263) (-1640.063) * [-1639.194] (-1638.648) (-1640.744) (-1641.442) -- 0:00:21
710000 -- (-1640.120) (-1640.572) [-1638.842] (-1643.038) * [-1640.558] (-1639.317) (-1639.334) (-1642.894) -- 0:00:21
Average standard deviation of split frequencies: 0.010145
710500 -- (-1638.604) [-1640.270] (-1642.580) (-1642.480) * (-1639.389) [-1640.181] (-1639.169) (-1641.445) -- 0:00:21
711000 -- (-1639.087) [-1639.733] (-1639.746) (-1640.162) * (-1642.345) (-1640.093) (-1639.466) [-1640.841] -- 0:00:21
711500 -- (-1639.650) (-1638.255) [-1639.100] (-1639.402) * (-1644.033) (-1640.390) [-1642.471] (-1640.641) -- 0:00:21
712000 -- (-1640.467) [-1638.563] (-1637.953) (-1639.862) * [-1640.621] (-1640.947) (-1638.296) (-1639.854) -- 0:00:21
712500 -- (-1639.896) (-1639.350) [-1639.139] (-1642.395) * (-1640.589) (-1642.583) [-1639.140] (-1639.284) -- 0:00:21
713000 -- [-1639.345] (-1638.354) (-1640.358) (-1640.153) * [-1642.138] (-1640.043) (-1638.338) (-1641.533) -- 0:00:21
713500 -- (-1642.077) (-1639.841) (-1640.956) [-1639.596] * [-1639.934] (-1638.950) (-1638.562) (-1641.223) -- 0:00:21
714000 -- [-1638.908] (-1639.344) (-1640.183) (-1638.878) * [-1638.337] (-1640.930) (-1640.845) (-1639.664) -- 0:00:21
714500 -- (-1641.500) (-1638.899) [-1641.762] (-1639.421) * [-1638.849] (-1642.832) (-1649.566) (-1639.501) -- 0:00:21
715000 -- (-1640.249) (-1642.998) [-1638.862] (-1639.042) * (-1642.290) (-1639.932) [-1641.251] (-1639.846) -- 0:00:21
Average standard deviation of split frequencies: 0.009953
715500 -- [-1639.981] (-1638.331) (-1639.660) (-1638.929) * [-1640.586] (-1642.113) (-1641.504) (-1638.540) -- 0:00:21
716000 -- [-1639.116] (-1639.031) (-1640.798) (-1641.772) * [-1640.867] (-1640.918) (-1640.611) (-1638.731) -- 0:00:21
716500 -- (-1639.107) (-1640.343) [-1640.995] (-1640.283) * (-1642.235) (-1641.589) [-1641.403] (-1640.249) -- 0:00:20
717000 -- (-1640.207) (-1640.936) [-1639.180] (-1639.630) * [-1638.209] (-1641.741) (-1642.202) (-1640.249) -- 0:00:21
717500 -- [-1640.981] (-1640.562) (-1639.024) (-1639.632) * (-1639.200) (-1639.449) (-1640.599) [-1641.132] -- 0:00:21
718000 -- (-1646.051) [-1639.472] (-1639.036) (-1641.388) * (-1641.765) (-1638.953) [-1643.587] (-1638.444) -- 0:00:21
718500 -- (-1640.708) (-1639.070) [-1638.524] (-1640.655) * (-1641.396) (-1638.956) [-1641.188] (-1640.437) -- 0:00:21
719000 -- [-1638.648] (-1640.892) (-1638.961) (-1639.096) * [-1643.881] (-1638.369) (-1644.558) (-1639.439) -- 0:00:21
719500 -- (-1641.548) (-1641.613) [-1641.425] (-1638.755) * [-1639.735] (-1640.941) (-1642.287) (-1641.535) -- 0:00:21
720000 -- [-1640.516] (-1639.535) (-1642.387) (-1638.486) * (-1638.872) (-1642.671) [-1639.406] (-1640.347) -- 0:00:20
Average standard deviation of split frequencies: 0.009350
720500 -- (-1640.627) [-1638.933] (-1639.783) (-1640.843) * [-1638.901] (-1638.225) (-1638.804) (-1640.581) -- 0:00:20
721000 -- (-1641.144) [-1639.804] (-1638.854) (-1641.065) * [-1641.139] (-1642.123) (-1640.075) (-1639.205) -- 0:00:20
721500 -- (-1642.510) (-1640.957) (-1638.784) [-1638.657] * (-1640.548) [-1640.730] (-1641.279) (-1639.537) -- 0:00:20
722000 -- [-1639.904] (-1639.398) (-1642.860) (-1639.098) * (-1639.329) (-1642.363) [-1639.730] (-1639.741) -- 0:00:20
722500 -- (-1639.327) (-1639.446) (-1640.507) [-1641.125] * (-1638.908) [-1641.038] (-1643.235) (-1643.433) -- 0:00:20
723000 -- (-1641.430) (-1639.939) (-1639.876) [-1641.329] * (-1640.750) (-1638.595) (-1643.814) [-1639.507] -- 0:00:20
723500 -- [-1641.723] (-1640.157) (-1640.096) (-1639.486) * [-1640.489] (-1638.144) (-1639.006) (-1642.252) -- 0:00:20
724000 -- (-1640.351) (-1638.459) (-1643.262) [-1643.269] * [-1640.881] (-1641.196) (-1641.301) (-1639.679) -- 0:00:20
724500 -- (-1641.494) (-1643.849) (-1646.067) [-1640.923] * (-1641.633) [-1640.054] (-1639.812) (-1642.371) -- 0:00:20
725000 -- (-1642.433) (-1642.132) (-1641.339) [-1638.807] * (-1641.062) (-1639.709) (-1640.052) [-1640.166] -- 0:00:20
Average standard deviation of split frequencies: 0.009893
725500 -- (-1643.391) (-1643.664) (-1643.770) [-1638.578] * (-1641.850) (-1640.792) [-1640.609] (-1641.598) -- 0:00:20
726000 -- (-1640.639) (-1642.075) [-1638.309] (-1640.148) * (-1640.561) (-1643.591) (-1638.624) [-1642.344] -- 0:00:20
726500 -- (-1639.303) (-1640.042) [-1638.249] (-1639.695) * [-1641.362] (-1643.574) (-1639.903) (-1640.546) -- 0:00:20
727000 -- (-1642.998) (-1641.516) [-1643.112] (-1642.299) * (-1640.128) [-1639.375] (-1639.903) (-1640.819) -- 0:00:20
727500 -- [-1642.312] (-1639.075) (-1641.617) (-1641.766) * (-1640.640) (-1640.569) [-1640.106] (-1641.663) -- 0:00:20
728000 -- [-1640.772] (-1639.658) (-1638.898) (-1641.094) * (-1640.702) (-1638.218) (-1639.548) [-1641.412] -- 0:00:20
728500 -- (-1639.120) (-1639.732) (-1640.994) [-1641.747] * (-1641.987) [-1638.419] (-1639.354) (-1639.389) -- 0:00:20
729000 -- (-1638.979) (-1638.473) [-1638.884] (-1641.124) * (-1642.347) [-1639.856] (-1638.880) (-1640.422) -- 0:00:20
729500 -- (-1642.855) (-1641.326) (-1638.925) [-1638.919] * (-1641.825) (-1639.268) (-1638.448) [-1640.363] -- 0:00:20
730000 -- [-1640.989] (-1644.330) (-1638.446) (-1641.073) * (-1638.213) (-1640.149) [-1640.306] (-1642.824) -- 0:00:19
Average standard deviation of split frequencies: 0.009753
730500 -- (-1639.573) (-1641.446) (-1639.118) [-1639.009] * (-1638.791) [-1640.380] (-1640.961) (-1640.445) -- 0:00:20
731000 -- (-1639.366) (-1644.649) (-1639.513) [-1641.519] * (-1638.547) (-1640.377) [-1641.623] (-1639.785) -- 0:00:20
731500 -- (-1638.905) [-1640.758] (-1640.346) (-1640.539) * (-1638.723) (-1638.722) (-1647.921) [-1639.781] -- 0:00:20
732000 -- (-1640.386) [-1638.734] (-1639.170) (-1642.995) * (-1640.182) (-1638.781) [-1639.530] (-1639.002) -- 0:00:20
732500 -- (-1639.518) [-1638.691] (-1640.994) (-1642.576) * (-1642.232) (-1640.031) (-1640.232) [-1643.062] -- 0:00:20
733000 -- (-1638.914) [-1642.491] (-1642.158) (-1640.827) * (-1641.475) [-1640.817] (-1640.759) (-1649.398) -- 0:00:20
733500 -- (-1638.564) (-1643.014) (-1642.485) [-1644.260] * [-1641.634] (-1640.382) (-1638.635) (-1641.284) -- 0:00:19
734000 -- (-1638.662) (-1639.271) [-1644.661] (-1639.095) * (-1643.214) (-1639.420) [-1641.653] (-1642.631) -- 0:00:19
734500 -- [-1638.279] (-1639.075) (-1641.679) (-1642.943) * [-1638.397] (-1639.717) (-1639.852) (-1640.061) -- 0:00:19
735000 -- (-1638.726) (-1642.931) (-1641.059) [-1639.431] * (-1643.508) (-1641.133) (-1640.089) [-1641.506] -- 0:00:19
Average standard deviation of split frequencies: 0.010097
735500 -- [-1638.365] (-1642.310) (-1638.995) (-1639.119) * (-1640.911) [-1639.973] (-1641.241) (-1640.066) -- 0:00:19
736000 -- (-1640.228) (-1641.682) (-1640.052) [-1638.215] * (-1642.105) (-1639.569) [-1638.945] (-1641.702) -- 0:00:19
736500 -- [-1640.490] (-1638.956) (-1640.453) (-1638.564) * (-1640.947) (-1638.724) [-1641.875] (-1642.208) -- 0:00:19
737000 -- (-1641.297) [-1640.263] (-1642.993) (-1642.710) * (-1639.047) (-1640.335) (-1638.567) [-1640.066] -- 0:00:19
737500 -- [-1640.098] (-1639.007) (-1641.075) (-1641.293) * (-1638.270) [-1642.488] (-1640.955) (-1643.035) -- 0:00:19
738000 -- (-1639.941) (-1641.603) [-1640.819] (-1638.980) * (-1639.090) (-1641.113) [-1640.911] (-1639.053) -- 0:00:19
738500 -- (-1643.831) (-1640.298) (-1639.645) [-1640.207] * (-1640.299) [-1640.711] (-1639.377) (-1642.470) -- 0:00:19
739000 -- (-1641.361) (-1642.425) [-1641.125] (-1638.867) * (-1642.862) [-1639.998] (-1638.845) (-1640.627) -- 0:00:19
739500 -- (-1638.959) (-1639.965) (-1641.399) [-1639.376] * (-1640.185) (-1638.865) [-1638.700] (-1641.209) -- 0:00:19
740000 -- [-1641.042] (-1639.999) (-1646.080) (-1639.468) * (-1640.185) [-1642.790] (-1638.271) (-1639.929) -- 0:00:19
Average standard deviation of split frequencies: 0.010183
740500 -- (-1642.073) (-1646.269) (-1641.996) [-1638.336] * (-1639.558) [-1638.167] (-1638.180) (-1640.167) -- 0:00:19
741000 -- (-1645.168) (-1640.881) [-1640.678] (-1639.659) * (-1639.780) [-1639.434] (-1638.822) (-1641.543) -- 0:00:19
741500 -- (-1640.820) (-1642.999) (-1640.287) [-1639.434] * (-1638.865) (-1638.874) (-1639.452) [-1641.418] -- 0:00:19
742000 -- (-1643.564) (-1640.135) (-1643.669) [-1641.816] * [-1640.604] (-1638.548) (-1639.623) (-1640.465) -- 0:00:19
742500 -- (-1641.531) (-1640.232) (-1642.023) [-1643.296] * (-1638.760) (-1641.453) (-1639.563) [-1639.706] -- 0:00:19
743000 -- (-1648.377) (-1641.913) [-1640.223] (-1645.010) * (-1642.986) (-1645.612) [-1641.569] (-1638.276) -- 0:00:19
743500 -- [-1642.358] (-1640.950) (-1641.163) (-1639.851) * (-1640.811) (-1643.947) (-1642.120) [-1638.608] -- 0:00:18
744000 -- (-1639.725) (-1639.011) [-1642.297] (-1639.794) * (-1641.482) [-1638.819] (-1642.120) (-1639.047) -- 0:00:19
744500 -- [-1644.407] (-1645.423) (-1642.553) (-1641.477) * (-1644.510) (-1639.793) [-1644.638] (-1640.970) -- 0:00:19
745000 -- (-1640.678) [-1643.625] (-1640.508) (-1644.340) * [-1643.099] (-1642.839) (-1644.028) (-1645.764) -- 0:00:19
Average standard deviation of split frequencies: 0.009888
745500 -- (-1642.702) (-1642.114) [-1639.317] (-1640.713) * (-1641.742) [-1641.602] (-1638.954) (-1640.050) -- 0:00:19
746000 -- (-1641.533) (-1642.279) [-1638.987] (-1640.178) * [-1643.711] (-1639.877) (-1640.469) (-1640.570) -- 0:00:19
746500 -- (-1639.278) (-1644.101) (-1642.042) [-1638.729] * (-1643.640) (-1640.682) (-1643.725) [-1639.549] -- 0:00:19
747000 -- (-1641.351) (-1639.978) (-1639.554) [-1638.215] * (-1642.277) (-1639.294) [-1642.173] (-1640.319) -- 0:00:18
747500 -- (-1644.007) [-1640.609] (-1643.971) (-1641.549) * [-1638.682] (-1641.544) (-1639.279) (-1638.563) -- 0:00:18
748000 -- [-1641.411] (-1641.397) (-1648.630) (-1638.280) * [-1638.909] (-1639.476) (-1640.070) (-1638.998) -- 0:00:18
748500 -- (-1642.806) (-1642.744) [-1642.901] (-1638.298) * (-1639.648) (-1641.056) [-1638.670] (-1642.448) -- 0:00:18
749000 -- (-1640.888) [-1639.632] (-1639.059) (-1640.706) * (-1639.533) (-1640.727) (-1638.262) [-1639.607] -- 0:00:18
749500 -- (-1644.082) (-1642.046) (-1638.546) [-1639.731] * (-1638.993) (-1641.370) (-1640.065) [-1640.085] -- 0:00:18
750000 -- (-1639.879) [-1644.309] (-1641.811) (-1639.582) * [-1639.157] (-1640.418) (-1638.578) (-1639.755) -- 0:00:18
Average standard deviation of split frequencies: 0.010085
750500 -- (-1640.349) (-1642.345) [-1642.999] (-1639.315) * (-1639.216) (-1643.226) [-1638.554] (-1641.802) -- 0:00:18
751000 -- (-1639.669) (-1639.947) (-1646.635) [-1641.517] * (-1639.066) (-1645.356) (-1641.081) [-1640.096] -- 0:00:18
751500 -- (-1639.351) (-1645.439) [-1638.960] (-1640.536) * (-1640.528) (-1645.925) (-1640.986) [-1639.655] -- 0:00:18
752000 -- (-1643.683) (-1639.767) (-1639.830) [-1639.383] * (-1640.407) (-1647.153) (-1645.432) [-1643.060] -- 0:00:18
752500 -- (-1641.847) (-1639.749) [-1638.950] (-1639.447) * (-1640.959) [-1641.044] (-1645.315) (-1639.728) -- 0:00:18
753000 -- (-1645.762) (-1639.699) (-1638.153) [-1640.658] * (-1640.234) (-1639.406) (-1642.838) [-1639.162] -- 0:00:18
753500 -- (-1643.184) [-1639.990] (-1639.062) (-1641.751) * [-1638.803] (-1638.795) (-1639.478) (-1640.214) -- 0:00:18
754000 -- (-1641.634) [-1640.036] (-1640.840) (-1643.776) * (-1639.274) [-1639.897] (-1639.329) (-1640.064) -- 0:00:18
754500 -- (-1641.773) (-1639.704) [-1639.274] (-1640.379) * [-1639.571] (-1640.102) (-1642.930) (-1641.053) -- 0:00:18
755000 -- (-1640.638) (-1640.654) (-1641.551) [-1638.997] * (-1642.721) (-1641.361) (-1643.803) [-1639.212] -- 0:00:18
Average standard deviation of split frequencies: 0.010344
755500 -- (-1640.089) [-1639.275] (-1640.607) (-1638.726) * [-1640.565] (-1638.803) (-1643.436) (-1640.603) -- 0:00:18
756000 -- (-1638.847) [-1639.299] (-1641.675) (-1645.689) * [-1639.156] (-1646.147) (-1641.438) (-1639.386) -- 0:00:18
756500 -- (-1639.932) [-1640.067] (-1642.641) (-1641.175) * (-1638.541) (-1640.083) [-1638.830] (-1639.033) -- 0:00:18
757000 -- (-1639.057) [-1638.709] (-1641.989) (-1640.810) * (-1639.095) [-1641.893] (-1640.324) (-1640.919) -- 0:00:17
757500 -- (-1638.712) [-1638.857] (-1645.353) (-1638.546) * [-1640.644] (-1639.497) (-1639.321) (-1642.572) -- 0:00:18
758000 -- (-1640.892) (-1642.388) (-1641.112) [-1639.945] * [-1640.529] (-1639.602) (-1640.061) (-1641.189) -- 0:00:18
758500 -- (-1646.436) (-1639.399) (-1641.351) [-1640.214] * (-1642.366) (-1639.909) [-1640.613] (-1642.450) -- 0:00:18
759000 -- (-1640.467) [-1641.184] (-1646.680) (-1640.364) * (-1641.539) [-1639.627] (-1639.520) (-1645.154) -- 0:00:18
759500 -- (-1643.590) [-1639.712] (-1638.890) (-1640.000) * [-1643.777] (-1638.838) (-1639.347) (-1641.262) -- 0:00:18
760000 -- [-1639.749] (-1640.245) (-1639.716) (-1640.096) * (-1640.105) (-1639.761) (-1642.420) [-1640.861] -- 0:00:18
Average standard deviation of split frequencies: 0.010207
760500 -- [-1639.358] (-1641.408) (-1643.027) (-1641.382) * (-1639.461) [-1639.541] (-1640.182) (-1642.306) -- 0:00:17
761000 -- (-1641.413) (-1640.657) (-1643.354) [-1640.250] * [-1639.394] (-1640.649) (-1639.005) (-1639.198) -- 0:00:17
761500 -- (-1641.174) (-1640.047) (-1641.805) [-1639.131] * (-1643.254) [-1643.376] (-1638.997) (-1639.059) -- 0:00:17
762000 -- (-1638.107) [-1639.216] (-1643.236) (-1639.340) * (-1643.045) (-1639.169) [-1639.299] (-1639.571) -- 0:00:17
762500 -- (-1638.868) (-1647.524) (-1639.657) [-1640.519] * (-1639.948) (-1640.257) [-1639.344] (-1644.181) -- 0:00:17
763000 -- (-1643.052) (-1641.431) (-1639.094) [-1639.327] * (-1641.780) (-1638.185) (-1640.434) [-1641.918] -- 0:00:17
763500 -- (-1639.758) [-1639.330] (-1639.707) (-1642.180) * (-1638.901) [-1638.357] (-1641.063) (-1640.763) -- 0:00:17
764000 -- (-1641.570) (-1639.972) [-1641.822] (-1640.291) * (-1640.052) [-1638.969] (-1640.246) (-1642.729) -- 0:00:17
764500 -- [-1640.279] (-1643.558) (-1638.982) (-1640.191) * (-1639.324) (-1639.380) (-1638.938) [-1638.896] -- 0:00:17
765000 -- (-1639.661) (-1643.609) [-1641.775] (-1641.267) * (-1643.369) [-1638.843] (-1639.011) (-1643.820) -- 0:00:17
Average standard deviation of split frequencies: 0.009738
765500 -- (-1639.967) (-1640.004) (-1641.044) [-1640.412] * (-1641.675) (-1640.180) (-1638.623) [-1638.955] -- 0:00:17
766000 -- (-1639.896) (-1642.218) (-1639.817) [-1639.934] * [-1640.473] (-1643.748) (-1640.558) (-1640.908) -- 0:00:17
766500 -- (-1639.441) (-1641.640) [-1643.522] (-1642.548) * (-1641.891) (-1643.191) (-1642.306) [-1641.813] -- 0:00:17
767000 -- [-1641.635] (-1641.446) (-1639.535) (-1640.829) * (-1643.435) (-1642.557) [-1638.819] (-1644.298) -- 0:00:17
767500 -- (-1641.522) (-1643.512) [-1642.572] (-1640.256) * (-1639.355) (-1639.064) [-1638.217] (-1645.182) -- 0:00:17
768000 -- (-1641.502) (-1640.426) [-1641.780] (-1642.531) * [-1638.317] (-1639.553) (-1639.238) (-1641.987) -- 0:00:17
768500 -- [-1641.279] (-1642.041) (-1639.033) (-1640.497) * (-1639.470) (-1639.182) (-1640.981) [-1638.791] -- 0:00:17
769000 -- (-1639.226) (-1649.314) (-1638.630) [-1638.963] * (-1640.928) [-1640.873] (-1639.393) (-1640.920) -- 0:00:17
769500 -- (-1639.669) [-1641.566] (-1640.353) (-1637.973) * (-1642.151) (-1638.696) (-1641.075) [-1639.104] -- 0:00:17
770000 -- (-1639.732) (-1638.266) (-1640.312) [-1638.946] * [-1639.533] (-1639.561) (-1640.302) (-1640.749) -- 0:00:17
Average standard deviation of split frequencies: 0.009634
770500 -- (-1639.096) [-1641.332] (-1640.297) (-1640.653) * (-1641.960) (-1639.164) (-1642.130) [-1642.288] -- 0:00:16
771000 -- (-1640.407) (-1641.800) [-1641.059] (-1638.279) * [-1640.475] (-1641.083) (-1645.846) (-1642.052) -- 0:00:17
771500 -- [-1639.279] (-1640.326) (-1641.018) (-1639.998) * (-1639.395) [-1641.686] (-1645.216) (-1639.181) -- 0:00:17
772000 -- (-1641.105) (-1639.516) [-1639.865] (-1641.541) * (-1644.604) (-1639.363) (-1645.451) [-1639.383] -- 0:00:17
772500 -- (-1641.658) (-1641.804) (-1639.296) [-1644.169] * (-1641.730) [-1638.973] (-1639.405) (-1637.980) -- 0:00:17
773000 -- [-1639.013] (-1642.044) (-1642.120) (-1639.976) * (-1643.220) (-1639.021) [-1642.262] (-1638.180) -- 0:00:17
773500 -- (-1639.533) (-1639.560) (-1639.620) [-1642.916] * (-1643.391) (-1639.078) (-1641.548) [-1639.489] -- 0:00:16
774000 -- [-1641.684] (-1639.070) (-1638.705) (-1639.349) * [-1642.783] (-1647.366) (-1639.208) (-1639.941) -- 0:00:16
774500 -- (-1641.646) [-1641.950] (-1641.978) (-1640.336) * (-1641.982) [-1647.462] (-1639.446) (-1639.735) -- 0:00:16
775000 -- (-1639.996) (-1640.290) [-1638.628] (-1640.084) * [-1641.032] (-1644.649) (-1639.334) (-1640.653) -- 0:00:16
Average standard deviation of split frequencies: 0.009644
775500 -- (-1638.982) [-1640.623] (-1640.625) (-1640.036) * (-1640.200) (-1641.647) [-1642.259] (-1641.341) -- 0:00:16
776000 -- (-1639.105) (-1639.762) [-1642.863] (-1639.219) * (-1639.723) (-1640.283) (-1638.582) [-1642.050] -- 0:00:16
776500 -- (-1638.659) [-1640.437] (-1641.604) (-1639.948) * (-1642.756) [-1643.773] (-1639.322) (-1639.852) -- 0:00:16
777000 -- [-1639.137] (-1639.388) (-1638.907) (-1639.940) * (-1640.926) (-1643.650) [-1639.116] (-1640.419) -- 0:00:16
777500 -- (-1640.223) (-1645.434) (-1640.089) [-1638.938] * (-1640.050) (-1642.972) (-1638.291) [-1640.235] -- 0:00:16
778000 -- (-1640.201) [-1640.232] (-1640.223) (-1639.514) * [-1638.137] (-1642.505) (-1639.889) (-1639.918) -- 0:00:16
778500 -- (-1638.593) [-1640.393] (-1639.861) (-1639.514) * [-1641.291] (-1641.900) (-1641.325) (-1638.877) -- 0:00:16
779000 -- [-1638.714] (-1641.090) (-1641.612) (-1639.419) * [-1639.500] (-1640.840) (-1639.064) (-1641.341) -- 0:00:16
779500 -- (-1639.415) [-1640.936] (-1643.186) (-1638.645) * [-1640.251] (-1641.145) (-1645.431) (-1639.658) -- 0:00:16
780000 -- (-1642.958) [-1638.007] (-1640.943) (-1639.916) * (-1638.841) (-1639.708) (-1638.334) [-1638.977] -- 0:00:16
Average standard deviation of split frequencies: 0.009624
780500 -- [-1640.570] (-1639.611) (-1638.990) (-1639.791) * [-1639.724] (-1640.100) (-1640.002) (-1640.114) -- 0:00:16
781000 -- [-1639.386] (-1643.375) (-1640.077) (-1640.499) * (-1640.558) (-1639.928) [-1642.730] (-1639.819) -- 0:00:16
781500 -- [-1639.561] (-1641.535) (-1640.695) (-1644.120) * (-1645.663) (-1639.910) (-1638.335) [-1638.158] -- 0:00:16
782000 -- (-1640.779) (-1642.213) [-1639.909] (-1638.508) * (-1640.072) (-1639.509) [-1642.899] (-1640.747) -- 0:00:16
782500 -- (-1638.912) [-1639.731] (-1639.777) (-1639.417) * (-1641.232) (-1638.897) (-1640.834) [-1638.793] -- 0:00:16
783000 -- (-1642.758) (-1644.188) (-1643.153) [-1640.955] * [-1640.197] (-1639.287) (-1639.050) (-1643.346) -- 0:00:16
783500 -- [-1641.212] (-1641.027) (-1642.827) (-1638.693) * (-1641.688) (-1646.213) (-1638.695) [-1642.461] -- 0:00:16
784000 -- [-1642.150] (-1643.092) (-1640.146) (-1638.947) * (-1641.852) [-1639.872] (-1640.942) (-1641.505) -- 0:00:15
784500 -- (-1643.876) (-1640.916) [-1640.636] (-1639.466) * (-1642.246) (-1643.712) [-1640.099] (-1646.570) -- 0:00:15
785000 -- (-1639.812) (-1647.386) [-1641.817] (-1640.278) * (-1643.698) [-1639.366] (-1641.480) (-1641.082) -- 0:00:16
Average standard deviation of split frequencies: 0.009746
785500 -- (-1645.090) (-1641.116) (-1638.632) [-1642.598] * [-1639.259] (-1640.182) (-1643.396) (-1641.224) -- 0:00:16
786000 -- (-1638.556) (-1640.061) [-1638.701] (-1641.016) * [-1638.453] (-1640.182) (-1641.313) (-1639.637) -- 0:00:16
786500 -- (-1639.858) (-1641.104) [-1640.106] (-1639.280) * (-1640.817) (-1641.155) [-1639.741] (-1641.091) -- 0:00:16
787000 -- (-1639.780) (-1641.886) [-1641.259] (-1638.988) * (-1640.746) (-1639.742) [-1642.343] (-1639.114) -- 0:00:15
787500 -- (-1641.282) [-1641.634] (-1640.993) (-1638.583) * [-1640.161] (-1638.513) (-1640.700) (-1638.992) -- 0:00:15
788000 -- [-1640.528] (-1642.629) (-1640.703) (-1638.991) * (-1641.175) [-1641.399] (-1640.393) (-1643.991) -- 0:00:15
788500 -- (-1644.805) (-1642.162) [-1641.272] (-1641.025) * (-1641.384) (-1644.823) (-1643.193) [-1638.400] -- 0:00:15
789000 -- (-1641.268) [-1641.452] (-1639.414) (-1640.652) * (-1641.616) (-1645.209) (-1640.743) [-1638.705] -- 0:00:15
789500 -- (-1639.655) (-1639.672) (-1644.370) [-1640.967] * [-1640.461] (-1639.198) (-1641.103) (-1641.866) -- 0:00:15
790000 -- (-1642.909) [-1641.359] (-1645.900) (-1639.570) * (-1640.573) (-1640.632) [-1640.106] (-1641.109) -- 0:00:15
Average standard deviation of split frequencies: 0.010434
790500 -- (-1639.981) (-1639.688) (-1647.269) [-1640.153] * [-1638.793] (-1639.829) (-1639.809) (-1641.453) -- 0:00:15
791000 -- (-1640.726) [-1640.106] (-1640.245) (-1639.046) * (-1642.133) (-1638.729) [-1640.523] (-1640.787) -- 0:00:15
791500 -- [-1643.523] (-1644.031) (-1644.684) (-1639.653) * (-1641.986) (-1640.954) [-1640.533] (-1640.786) -- 0:00:15
792000 -- (-1638.778) [-1646.442] (-1643.834) (-1639.124) * (-1640.129) (-1640.358) (-1640.536) [-1638.970] -- 0:00:15
792500 -- (-1638.379) (-1646.955) [-1639.189] (-1640.457) * [-1639.155] (-1640.721) (-1639.639) (-1639.770) -- 0:00:15
793000 -- (-1638.130) [-1641.972] (-1639.391) (-1640.914) * (-1639.621) (-1641.584) (-1640.310) [-1638.676] -- 0:00:15
793500 -- [-1638.510] (-1642.330) (-1639.704) (-1644.473) * (-1639.338) (-1640.689) [-1640.557] (-1641.781) -- 0:00:15
794000 -- [-1640.982] (-1642.019) (-1640.506) (-1643.388) * (-1638.836) [-1641.119] (-1638.966) (-1640.593) -- 0:00:15
794500 -- (-1638.258) (-1640.087) [-1639.140] (-1645.559) * (-1639.020) (-1642.966) (-1641.359) [-1639.076] -- 0:00:15
795000 -- [-1639.490] (-1639.437) (-1638.490) (-1640.704) * (-1639.993) (-1645.202) [-1639.825] (-1642.631) -- 0:00:15
Average standard deviation of split frequencies: 0.010734
795500 -- [-1640.266] (-1642.569) (-1638.919) (-1640.275) * [-1638.567] (-1639.584) (-1638.738) (-1640.871) -- 0:00:15
796000 -- (-1640.039) (-1639.989) (-1639.690) [-1640.460] * [-1639.219] (-1640.886) (-1638.706) (-1644.903) -- 0:00:15
796500 -- [-1638.162] (-1643.162) (-1640.157) (-1639.693) * (-1639.197) (-1643.868) [-1641.221] (-1640.950) -- 0:00:15
797000 -- (-1639.586) (-1639.615) (-1640.893) [-1638.832] * (-1638.710) (-1644.014) (-1642.944) [-1643.616] -- 0:00:15
797500 -- (-1638.788) (-1639.485) [-1639.255] (-1638.866) * (-1639.328) [-1640.586] (-1638.955) (-1643.089) -- 0:00:14
798000 -- [-1638.243] (-1638.677) (-1638.696) (-1639.290) * [-1638.428] (-1640.593) (-1639.488) (-1638.642) -- 0:00:14
798500 -- [-1638.272] (-1645.317) (-1638.882) (-1639.235) * (-1644.355) (-1640.997) (-1639.484) [-1639.933] -- 0:00:15
799000 -- (-1641.471) [-1640.509] (-1638.442) (-1639.276) * (-1639.780) (-1640.602) (-1644.034) [-1640.981] -- 0:00:15
799500 -- (-1641.553) (-1642.270) [-1640.681] (-1638.632) * [-1644.346] (-1641.138) (-1643.551) (-1639.729) -- 0:00:15
800000 -- (-1645.830) (-1641.083) [-1642.676] (-1638.648) * (-1646.483) [-1641.083] (-1642.946) (-1639.632) -- 0:00:14
Average standard deviation of split frequencies: 0.010598
800500 -- (-1640.100) [-1641.339] (-1641.979) (-1640.106) * (-1644.157) (-1639.317) [-1640.686] (-1641.293) -- 0:00:14
801000 -- [-1638.505] (-1641.382) (-1644.422) (-1638.438) * (-1640.323) [-1639.284] (-1641.941) (-1641.570) -- 0:00:14
801500 -- [-1638.918] (-1640.660) (-1643.415) (-1640.786) * (-1641.642) (-1641.383) (-1641.659) [-1643.589] -- 0:00:14
802000 -- (-1638.105) (-1641.242) [-1645.811] (-1638.475) * (-1641.981) [-1641.265] (-1638.978) (-1642.244) -- 0:00:14
802500 -- [-1641.764] (-1640.025) (-1640.359) (-1638.161) * (-1640.585) [-1643.490] (-1639.886) (-1638.479) -- 0:00:14
803000 -- (-1645.145) [-1639.030] (-1638.983) (-1639.385) * [-1639.200] (-1640.357) (-1641.250) (-1638.671) -- 0:00:14
803500 -- (-1646.814) [-1638.764] (-1638.956) (-1641.856) * [-1639.074] (-1642.010) (-1642.520) (-1640.445) -- 0:00:14
804000 -- (-1638.359) (-1639.164) (-1638.277) [-1639.371] * (-1639.121) (-1642.272) [-1640.762] (-1641.669) -- 0:00:14
804500 -- [-1638.656] (-1639.037) (-1639.091) (-1642.391) * (-1638.749) [-1642.188] (-1641.329) (-1640.927) -- 0:00:14
805000 -- (-1641.971) [-1638.782] (-1640.806) (-1645.603) * (-1639.627) (-1639.839) (-1640.641) [-1641.051] -- 0:00:14
Average standard deviation of split frequencies: 0.010308
805500 -- (-1644.486) [-1639.796] (-1639.545) (-1641.968) * (-1643.707) (-1638.541) (-1638.196) [-1641.193] -- 0:00:14
806000 -- [-1642.662] (-1639.797) (-1640.702) (-1640.627) * [-1638.817] (-1638.598) (-1639.724) (-1639.804) -- 0:00:14
806500 -- (-1641.227) [-1638.443] (-1641.437) (-1639.949) * (-1640.425) [-1638.427] (-1641.018) (-1640.703) -- 0:00:14
807000 -- [-1640.412] (-1639.558) (-1643.188) (-1640.395) * (-1639.753) [-1638.436] (-1640.359) (-1641.165) -- 0:00:14
807500 -- [-1639.918] (-1638.020) (-1640.828) (-1641.736) * (-1642.307) [-1638.555] (-1640.408) (-1639.299) -- 0:00:14
808000 -- (-1639.402) [-1640.111] (-1641.593) (-1639.024) * [-1640.575] (-1638.806) (-1641.220) (-1640.339) -- 0:00:14
808500 -- (-1641.313) (-1642.798) (-1641.300) [-1640.058] * [-1640.048] (-1641.441) (-1640.680) (-1647.078) -- 0:00:14
809000 -- (-1639.949) (-1642.593) (-1641.087) [-1639.114] * (-1638.248) (-1640.297) [-1640.678] (-1642.016) -- 0:00:14
809500 -- (-1638.890) [-1642.009] (-1643.083) (-1642.110) * (-1638.895) [-1639.280] (-1638.962) (-1640.809) -- 0:00:14
810000 -- (-1641.201) [-1642.401] (-1639.121) (-1639.154) * [-1641.051] (-1643.594) (-1639.291) (-1641.105) -- 0:00:14
Average standard deviation of split frequencies: 0.010576
810500 -- (-1640.115) (-1638.806) (-1641.011) [-1639.426] * (-1638.922) (-1646.451) (-1639.561) [-1640.438] -- 0:00:14
811000 -- [-1639.576] (-1642.096) (-1640.023) (-1639.487) * (-1641.650) (-1640.789) (-1643.213) [-1642.300] -- 0:00:13
811500 -- (-1641.359) (-1642.493) [-1639.362] (-1639.626) * (-1640.928) (-1639.275) [-1639.966] (-1643.696) -- 0:00:14
812000 -- [-1640.097] (-1640.889) (-1638.767) (-1642.862) * (-1640.418) [-1641.460] (-1639.891) (-1639.296) -- 0:00:14
812500 -- (-1641.163) (-1640.374) [-1638.762] (-1639.406) * (-1640.246) (-1639.535) [-1639.935] (-1638.939) -- 0:00:14
813000 -- (-1640.042) [-1641.578] (-1640.397) (-1639.230) * (-1642.692) (-1640.365) [-1641.695] (-1638.983) -- 0:00:14
813500 -- (-1639.456) (-1642.309) (-1638.040) [-1640.816] * (-1641.013) [-1640.563] (-1640.683) (-1639.626) -- 0:00:13
814000 -- (-1640.468) [-1641.255] (-1640.685) (-1639.275) * (-1639.688) (-1642.970) [-1642.436] (-1639.121) -- 0:00:13
814500 -- (-1640.608) (-1640.314) (-1638.392) [-1638.916] * (-1640.580) [-1638.829] (-1638.073) (-1639.375) -- 0:00:13
815000 -- (-1644.908) (-1640.401) [-1642.123] (-1641.982) * [-1638.752] (-1640.606) (-1639.094) (-1643.301) -- 0:00:13
Average standard deviation of split frequencies: 0.010543
815500 -- (-1639.823) [-1641.408] (-1642.724) (-1641.382) * (-1646.061) [-1638.456] (-1640.027) (-1640.808) -- 0:00:13
816000 -- (-1642.419) (-1639.261) [-1640.257] (-1639.270) * (-1640.737) (-1639.325) (-1638.340) [-1639.564] -- 0:00:13
816500 -- (-1638.342) (-1638.838) [-1639.044] (-1638.805) * (-1642.840) (-1640.732) (-1642.527) [-1641.875] -- 0:00:13
817000 -- (-1639.219) (-1639.311) [-1639.515] (-1640.348) * [-1639.276] (-1640.315) (-1640.947) (-1641.535) -- 0:00:13
817500 -- (-1639.087) (-1640.569) [-1638.477] (-1642.767) * (-1645.571) (-1638.693) (-1641.841) [-1639.642] -- 0:00:13
818000 -- (-1639.720) [-1640.315] (-1640.248) (-1639.908) * [-1640.528] (-1641.534) (-1643.430) (-1638.263) -- 0:00:13
818500 -- (-1639.190) [-1641.619] (-1643.435) (-1641.401) * (-1639.845) (-1641.679) (-1643.934) [-1638.611] -- 0:00:13
819000 -- (-1638.494) [-1640.095] (-1640.782) (-1641.726) * [-1645.011] (-1639.597) (-1639.835) (-1639.056) -- 0:00:13
819500 -- (-1639.384) (-1642.177) (-1639.348) [-1642.430] * (-1643.137) [-1640.001] (-1644.465) (-1639.610) -- 0:00:13
820000 -- (-1641.461) (-1641.211) [-1640.920] (-1639.013) * (-1640.278) (-1640.909) [-1639.592] (-1642.144) -- 0:00:13
Average standard deviation of split frequencies: 0.010483
820500 -- (-1641.099) (-1638.268) (-1638.936) [-1640.284] * (-1640.278) (-1639.313) (-1639.408) [-1639.097] -- 0:00:13
821000 -- [-1638.258] (-1640.274) (-1638.947) (-1637.973) * (-1641.465) (-1641.113) [-1640.924] (-1637.952) -- 0:00:13
821500 -- [-1638.259] (-1643.181) (-1639.512) (-1642.541) * (-1642.893) [-1639.806] (-1641.109) (-1640.233) -- 0:00:13
822000 -- (-1639.146) [-1645.159] (-1639.596) (-1640.263) * (-1638.231) (-1638.537) (-1641.050) [-1641.312] -- 0:00:13
822500 -- (-1641.673) (-1640.710) (-1645.399) [-1641.562] * (-1640.809) [-1640.974] (-1639.704) (-1640.008) -- 0:00:13
823000 -- (-1641.355) (-1638.543) [-1642.810] (-1640.282) * (-1639.804) (-1640.622) [-1639.201] (-1640.933) -- 0:00:13
823500 -- (-1639.694) (-1643.343) [-1641.626] (-1640.113) * (-1639.214) (-1641.335) [-1639.800] (-1638.851) -- 0:00:13
824000 -- (-1640.214) [-1642.728] (-1641.335) (-1643.130) * [-1640.752] (-1640.994) (-1643.600) (-1640.198) -- 0:00:13
824500 -- (-1640.826) (-1640.663) (-1641.294) [-1640.645] * (-1638.980) [-1642.860] (-1640.870) (-1639.756) -- 0:00:12
825000 -- (-1641.164) [-1638.457] (-1640.917) (-1639.714) * (-1639.177) (-1642.022) [-1643.248] (-1641.345) -- 0:00:12
Average standard deviation of split frequencies: 0.010308
825500 -- [-1639.567] (-1639.418) (-1642.425) (-1640.143) * (-1639.205) (-1641.533) (-1640.667) [-1641.872] -- 0:00:13
826000 -- (-1640.173) (-1641.495) (-1642.825) [-1639.750] * (-1641.543) (-1640.035) (-1638.122) [-1640.566] -- 0:00:13
826500 -- (-1640.394) (-1639.888) (-1639.855) [-1640.607] * (-1640.219) (-1640.750) [-1639.033] (-1643.102) -- 0:00:13
827000 -- (-1640.237) (-1640.383) (-1640.677) [-1638.161] * (-1641.871) [-1640.295] (-1639.202) (-1640.363) -- 0:00:12
827500 -- (-1639.217) (-1639.766) [-1642.039] (-1642.737) * (-1639.491) [-1638.751] (-1639.284) (-1638.661) -- 0:00:12
828000 -- (-1640.727) (-1641.332) [-1641.063] (-1640.432) * (-1640.452) (-1643.262) (-1639.447) [-1643.400] -- 0:00:12
828500 -- (-1641.350) [-1641.665] (-1640.304) (-1641.869) * (-1640.401) (-1640.218) [-1639.039] (-1640.321) -- 0:00:12
829000 -- (-1643.683) (-1640.593) [-1641.751] (-1639.838) * (-1645.517) [-1640.418] (-1638.122) (-1640.404) -- 0:00:12
829500 -- (-1638.969) (-1640.720) (-1639.629) [-1639.321] * (-1639.030) [-1639.131] (-1637.924) (-1641.243) -- 0:00:12
830000 -- (-1639.875) (-1642.207) [-1640.475] (-1639.708) * (-1640.762) [-1641.011] (-1638.445) (-1641.688) -- 0:00:12
Average standard deviation of split frequencies: 0.010038
830500 -- (-1645.201) (-1638.470) [-1641.902] (-1638.556) * (-1640.187) (-1641.208) (-1638.395) [-1640.693] -- 0:00:12
831000 -- [-1642.462] (-1639.325) (-1641.050) (-1638.358) * [-1639.505] (-1639.803) (-1640.555) (-1640.593) -- 0:00:12
831500 -- (-1640.547) [-1640.899] (-1641.673) (-1640.545) * (-1640.582) [-1640.402] (-1640.290) (-1641.657) -- 0:00:12
832000 -- (-1640.336) [-1643.964] (-1639.282) (-1640.498) * (-1639.953) [-1639.168] (-1641.672) (-1640.744) -- 0:00:12
832500 -- [-1641.864] (-1641.554) (-1638.672) (-1640.456) * (-1638.362) (-1642.235) [-1638.754] (-1642.244) -- 0:00:12
833000 -- [-1640.655] (-1639.938) (-1640.835) (-1641.988) * (-1641.500) (-1643.912) [-1639.782] (-1647.926) -- 0:00:12
833500 -- (-1640.621) [-1640.648] (-1641.923) (-1644.670) * (-1641.176) (-1641.915) (-1638.769) [-1639.069] -- 0:00:12
834000 -- [-1639.699] (-1639.933) (-1640.914) (-1642.173) * (-1639.054) (-1642.040) (-1639.626) [-1639.759] -- 0:00:12
834500 -- (-1642.779) (-1640.942) (-1643.421) [-1640.085] * (-1639.269) (-1641.205) (-1638.173) [-1638.910] -- 0:00:12
835000 -- (-1644.525) (-1640.229) (-1641.135) [-1641.300] * (-1640.613) [-1640.413] (-1639.595) (-1638.889) -- 0:00:12
Average standard deviation of split frequencies: 0.010185
835500 -- [-1640.340] (-1640.771) (-1639.309) (-1640.702) * (-1638.557) (-1639.335) [-1638.835] (-1641.786) -- 0:00:12
836000 -- (-1638.667) (-1639.973) (-1641.615) [-1640.423] * [-1640.623] (-1642.487) (-1642.128) (-1642.430) -- 0:00:12
836500 -- (-1640.084) (-1642.753) (-1641.736) [-1640.794] * (-1641.644) (-1639.326) [-1638.003] (-1642.749) -- 0:00:12
837000 -- [-1639.026] (-1641.087) (-1643.021) (-1641.790) * (-1645.577) (-1640.624) [-1641.363] (-1641.403) -- 0:00:12
837500 -- (-1640.805) (-1641.708) (-1641.399) [-1640.587] * [-1640.791] (-1641.241) (-1639.238) (-1642.847) -- 0:00:12
838000 -- (-1641.309) (-1639.375) (-1640.646) [-1640.827] * (-1642.055) (-1638.882) [-1639.434] (-1643.093) -- 0:00:11
838500 -- (-1641.674) (-1640.449) (-1638.554) [-1639.295] * (-1638.994) (-1641.052) (-1641.553) [-1641.304] -- 0:00:11
839000 -- [-1643.433] (-1639.399) (-1644.400) (-1640.993) * (-1641.585) [-1640.141] (-1639.885) (-1639.471) -- 0:00:12
839500 -- (-1640.165) [-1639.172] (-1638.577) (-1639.321) * (-1642.531) [-1640.389] (-1640.039) (-1640.375) -- 0:00:12
840000 -- (-1640.049) (-1640.053) (-1638.665) [-1638.673] * (-1642.077) [-1641.917] (-1639.379) (-1645.754) -- 0:00:11
Average standard deviation of split frequencies: 0.010199
840500 -- (-1644.590) (-1639.655) (-1639.385) [-1639.862] * (-1646.160) [-1646.413] (-1639.270) (-1639.517) -- 0:00:11
841000 -- (-1644.084) [-1641.199] (-1639.941) (-1639.299) * (-1641.784) (-1639.696) [-1637.971] (-1639.799) -- 0:00:11
841500 -- (-1637.909) [-1639.471] (-1640.124) (-1638.373) * (-1640.958) [-1641.080] (-1643.591) (-1639.949) -- 0:00:11
842000 -- [-1639.819] (-1642.462) (-1640.143) (-1640.531) * (-1640.119) [-1639.389] (-1643.387) (-1639.306) -- 0:00:11
842500 -- [-1639.987] (-1641.560) (-1640.037) (-1640.869) * [-1640.662] (-1641.055) (-1640.941) (-1639.567) -- 0:00:11
843000 -- (-1639.884) [-1641.652] (-1641.109) (-1639.200) * (-1643.702) [-1643.791] (-1640.266) (-1642.115) -- 0:00:11
843500 -- (-1641.323) (-1639.666) (-1640.108) [-1641.706] * (-1642.151) [-1639.522] (-1645.129) (-1640.019) -- 0:00:11
844000 -- [-1640.779] (-1639.737) (-1639.825) (-1642.330) * (-1640.122) [-1638.481] (-1640.464) (-1642.969) -- 0:00:11
844500 -- (-1639.571) (-1644.141) [-1639.012] (-1640.945) * (-1641.360) [-1639.801] (-1638.702) (-1641.968) -- 0:00:11
845000 -- [-1640.056] (-1639.831) (-1648.467) (-1639.208) * (-1641.843) [-1639.342] (-1640.395) (-1638.444) -- 0:00:11
Average standard deviation of split frequencies: 0.010100
845500 -- (-1642.357) (-1639.227) [-1641.104] (-1640.828) * (-1640.063) (-1642.195) (-1642.100) [-1638.445] -- 0:00:11
846000 -- (-1639.708) (-1640.905) (-1639.311) [-1641.473] * (-1638.844) [-1640.166] (-1640.862) (-1640.146) -- 0:00:11
846500 -- (-1641.055) [-1641.900] (-1638.623) (-1638.799) * (-1639.354) (-1642.909) [-1641.705] (-1640.622) -- 0:00:11
847000 -- [-1640.567] (-1647.000) (-1640.668) (-1640.944) * [-1641.896] (-1640.249) (-1643.731) (-1640.818) -- 0:00:11
847500 -- (-1639.836) (-1642.227) [-1641.113] (-1640.134) * (-1642.587) (-1641.340) (-1638.832) [-1639.865] -- 0:00:11
848000 -- (-1643.901) (-1640.121) (-1639.772) [-1640.075] * [-1638.255] (-1640.023) (-1642.552) (-1639.635) -- 0:00:11
848500 -- [-1640.404] (-1639.033) (-1641.554) (-1641.214) * (-1638.323) (-1639.873) [-1639.613] (-1642.832) -- 0:00:11
849000 -- (-1638.787) (-1640.298) (-1639.149) [-1641.309] * [-1638.567] (-1639.770) (-1638.855) (-1641.898) -- 0:00:11
849500 -- (-1638.673) [-1640.753] (-1640.459) (-1639.266) * (-1640.086) [-1641.126] (-1641.015) (-1638.728) -- 0:00:11
850000 -- [-1639.300] (-1638.562) (-1639.225) (-1640.728) * (-1639.421) (-1643.349) (-1639.042) [-1638.557] -- 0:00:11
Average standard deviation of split frequencies: 0.009975
850500 -- (-1641.659) (-1640.743) (-1639.362) [-1641.226] * (-1638.946) [-1638.611] (-1638.623) (-1641.576) -- 0:00:11
851000 -- (-1641.645) (-1640.508) (-1638.890) [-1640.060] * (-1640.411) [-1639.155] (-1640.443) (-1640.834) -- 0:00:11
851500 -- (-1642.829) (-1644.880) (-1639.770) [-1639.777] * (-1645.011) [-1638.734] (-1641.320) (-1641.457) -- 0:00:10
852000 -- (-1644.130) (-1643.325) (-1643.843) [-1639.975] * (-1639.603) (-1638.464) [-1641.205] (-1639.305) -- 0:00:11
852500 -- (-1638.464) (-1644.211) (-1643.047) [-1641.334] * (-1638.930) [-1640.136] (-1647.811) (-1639.728) -- 0:00:11
853000 -- [-1641.106] (-1641.984) (-1643.264) (-1638.586) * (-1639.641) (-1641.006) (-1643.031) [-1639.439] -- 0:00:11
853500 -- (-1639.328) [-1639.904] (-1643.479) (-1638.785) * (-1641.936) [-1639.823] (-1642.336) (-1638.472) -- 0:00:10
854000 -- [-1638.415] (-1639.087) (-1641.995) (-1639.327) * (-1640.359) [-1638.144] (-1640.658) (-1640.408) -- 0:00:10
854500 -- [-1642.318] (-1643.985) (-1642.334) (-1642.152) * (-1639.812) [-1640.338] (-1640.367) (-1643.245) -- 0:00:10
855000 -- (-1642.216) [-1637.977] (-1639.190) (-1638.899) * (-1640.309) [-1642.041] (-1638.663) (-1641.899) -- 0:00:10
Average standard deviation of split frequencies: 0.009878
855500 -- [-1641.205] (-1641.859) (-1639.519) (-1641.693) * (-1642.399) (-1638.130) (-1640.081) [-1641.906] -- 0:00:10
856000 -- (-1639.307) (-1640.064) [-1641.442] (-1641.358) * (-1638.927) [-1638.288] (-1639.831) (-1640.271) -- 0:00:10
856500 -- (-1639.742) (-1640.633) [-1638.555] (-1640.773) * (-1642.901) (-1639.261) [-1641.914] (-1640.764) -- 0:00:10
857000 -- (-1640.231) (-1641.433) [-1640.510] (-1640.357) * (-1640.158) (-1640.560) (-1641.662) [-1638.451] -- 0:00:10
857500 -- [-1638.646] (-1641.161) (-1639.593) (-1643.968) * (-1639.707) [-1640.369] (-1643.083) (-1638.987) -- 0:00:10
858000 -- (-1639.849) (-1639.460) (-1643.953) [-1643.297] * [-1639.642] (-1643.229) (-1640.208) (-1639.800) -- 0:00:10
858500 -- (-1642.862) (-1639.476) (-1644.971) [-1640.588] * (-1640.511) (-1641.538) (-1639.179) [-1638.850] -- 0:00:10
859000 -- (-1639.905) [-1639.302] (-1641.987) (-1639.335) * (-1641.429) (-1645.227) (-1640.621) [-1638.414] -- 0:00:10
859500 -- (-1639.481) (-1639.554) [-1640.247] (-1639.442) * (-1638.078) (-1640.175) [-1640.491] (-1641.920) -- 0:00:10
860000 -- (-1638.893) (-1640.677) [-1641.247] (-1639.374) * (-1638.553) [-1638.571] (-1640.562) (-1642.957) -- 0:00:10
Average standard deviation of split frequencies: 0.010064
860500 -- [-1639.226] (-1641.991) (-1639.740) (-1640.411) * (-1638.552) [-1639.024] (-1639.197) (-1647.946) -- 0:00:10
861000 -- (-1639.459) (-1642.161) (-1639.515) [-1640.114] * (-1639.350) (-1638.411) [-1641.056] (-1643.545) -- 0:00:10
861500 -- (-1639.955) [-1638.080] (-1638.923) (-1641.794) * (-1639.192) [-1638.638] (-1639.869) (-1645.212) -- 0:00:10
862000 -- [-1638.952] (-1639.389) (-1640.191) (-1644.257) * (-1640.457) (-1640.566) (-1641.121) [-1640.309] -- 0:00:10
862500 -- (-1638.605) (-1640.407) (-1639.680) [-1644.513] * (-1639.495) (-1640.003) (-1639.764) [-1637.967] -- 0:00:10
863000 -- [-1639.597] (-1639.968) (-1640.515) (-1643.981) * (-1647.037) (-1641.086) (-1642.998) [-1638.597] -- 0:00:10
863500 -- [-1643.744] (-1642.287) (-1640.061) (-1640.092) * (-1643.453) (-1640.581) [-1639.533] (-1639.419) -- 0:00:10
864000 -- (-1641.084) [-1638.930] (-1640.024) (-1640.061) * (-1638.488) (-1640.863) [-1640.985] (-1640.392) -- 0:00:10
864500 -- (-1640.571) [-1639.052] (-1641.751) (-1643.995) * (-1639.530) [-1639.493] (-1639.792) (-1638.530) -- 0:00:10
865000 -- (-1640.287) [-1639.956] (-1638.171) (-1639.473) * (-1638.499) (-1639.500) (-1640.684) [-1640.268] -- 0:00:10
Average standard deviation of split frequencies: 0.010104
865500 -- (-1639.170) [-1639.760] (-1642.356) (-1641.094) * (-1638.297) (-1639.697) [-1640.804] (-1639.626) -- 0:00:10
866000 -- (-1639.542) [-1638.803] (-1641.232) (-1645.290) * (-1637.981) [-1639.989] (-1641.160) (-1641.986) -- 0:00:10
866500 -- (-1639.199) (-1641.090) (-1640.561) [-1640.844] * (-1640.791) (-1639.613) [-1641.292] (-1647.163) -- 0:00:10
867000 -- (-1641.509) (-1642.091) (-1639.146) [-1640.092] * (-1642.290) (-1645.190) [-1639.426] (-1641.478) -- 0:00:09
867500 -- (-1641.379) (-1640.951) [-1640.748] (-1640.942) * (-1640.154) [-1640.581] (-1639.564) (-1641.886) -- 0:00:09
868000 -- (-1642.078) (-1639.715) (-1638.841) [-1639.228] * (-1641.792) [-1647.277] (-1643.544) (-1643.901) -- 0:00:09
868500 -- (-1639.690) (-1639.469) (-1639.991) [-1638.853] * (-1639.923) [-1645.927] (-1640.782) (-1643.628) -- 0:00:09
869000 -- (-1639.581) (-1638.376) [-1638.165] (-1641.928) * (-1638.570) (-1641.834) (-1641.778) [-1641.962] -- 0:00:09
869500 -- (-1641.743) [-1639.637] (-1640.751) (-1638.862) * [-1641.033] (-1641.386) (-1644.972) (-1639.106) -- 0:00:09
870000 -- (-1639.826) (-1638.860) (-1638.792) [-1638.900] * (-1642.341) (-1638.959) (-1645.306) [-1641.362] -- 0:00:09
Average standard deviation of split frequencies: 0.010219
870500 -- (-1638.122) (-1639.741) [-1639.727] (-1640.246) * [-1639.578] (-1639.555) (-1643.595) (-1639.378) -- 0:00:09
871000 -- (-1640.642) (-1643.016) [-1640.014] (-1640.745) * (-1644.469) (-1640.562) (-1641.341) [-1639.992] -- 0:00:09
871500 -- (-1640.137) (-1639.654) [-1639.307] (-1639.557) * [-1639.890] (-1639.677) (-1638.482) (-1639.446) -- 0:00:09
872000 -- (-1641.469) (-1642.915) (-1640.148) [-1640.253] * [-1643.583] (-1642.169) (-1638.834) (-1639.670) -- 0:00:09
872500 -- (-1641.952) [-1645.474] (-1643.076) (-1639.616) * (-1641.483) (-1641.254) (-1641.370) [-1639.766] -- 0:00:09
873000 -- (-1642.579) (-1642.458) [-1643.127] (-1639.905) * (-1639.768) [-1639.994] (-1642.476) (-1639.194) -- 0:00:09
873500 -- (-1640.116) [-1639.601] (-1641.790) (-1640.882) * (-1642.733) (-1639.431) (-1640.399) [-1640.580] -- 0:00:09
874000 -- (-1640.036) [-1643.499] (-1639.376) (-1639.610) * [-1640.425] (-1639.759) (-1641.882) (-1645.055) -- 0:00:09
874500 -- (-1639.842) [-1639.726] (-1640.633) (-1642.716) * (-1643.003) (-1642.368) [-1640.459] (-1639.553) -- 0:00:09
875000 -- (-1638.455) (-1639.144) [-1639.558] (-1639.477) * (-1638.930) (-1640.562) (-1639.371) [-1639.221] -- 0:00:09
Average standard deviation of split frequencies: 0.009653
875500 -- (-1641.104) (-1645.703) (-1641.557) [-1640.548] * [-1639.795] (-1639.734) (-1643.176) (-1641.657) -- 0:00:09
876000 -- (-1641.865) (-1640.448) (-1640.607) [-1640.734] * (-1639.639) (-1639.981) [-1639.559] (-1638.853) -- 0:00:09
876500 -- (-1640.863) [-1640.514] (-1639.313) (-1641.081) * (-1640.788) (-1639.144) (-1640.986) [-1640.438] -- 0:00:09
877000 -- (-1641.978) (-1640.452) (-1640.511) [-1639.523] * (-1639.544) [-1638.810] (-1639.250) (-1640.936) -- 0:00:09
877500 -- (-1643.421) [-1640.032] (-1641.015) (-1642.789) * (-1641.324) (-1642.468) [-1642.067] (-1638.462) -- 0:00:09
878000 -- [-1641.119] (-1641.847) (-1640.479) (-1640.215) * (-1639.292) (-1639.960) [-1641.139] (-1645.885) -- 0:00:09
878500 -- [-1638.665] (-1641.256) (-1641.172) (-1639.844) * (-1640.116) [-1639.784] (-1638.146) (-1638.780) -- 0:00:09
879000 -- (-1640.396) [-1639.974] (-1639.943) (-1640.936) * [-1639.676] (-1638.320) (-1638.114) (-1640.650) -- 0:00:09
879500 -- [-1640.023] (-1639.417) (-1640.086) (-1644.326) * (-1641.575) [-1639.537] (-1639.441) (-1639.479) -- 0:00:09
880000 -- (-1638.985) (-1639.747) [-1639.240] (-1642.807) * (-1642.531) [-1641.729] (-1639.725) (-1644.366) -- 0:00:09
Average standard deviation of split frequencies: 0.009064
880500 -- (-1641.557) (-1640.712) (-1639.287) [-1641.712] * (-1642.381) (-1640.673) [-1641.405] (-1638.687) -- 0:00:08
881000 -- (-1639.404) [-1638.526] (-1640.683) (-1641.916) * (-1645.380) (-1643.112) [-1640.684] (-1639.534) -- 0:00:08
881500 -- [-1639.978] (-1642.036) (-1642.549) (-1641.063) * [-1640.511] (-1644.145) (-1645.560) (-1644.038) -- 0:00:08
882000 -- (-1638.275) (-1643.782) [-1640.245] (-1639.316) * [-1638.107] (-1640.609) (-1642.079) (-1640.415) -- 0:00:08
882500 -- (-1643.385) (-1644.061) (-1639.160) [-1641.826] * [-1638.039] (-1643.012) (-1647.050) (-1641.677) -- 0:00:08
883000 -- (-1644.997) (-1642.004) [-1638.620] (-1639.904) * [-1639.725] (-1639.871) (-1641.326) (-1641.739) -- 0:00:08
883500 -- (-1644.913) [-1638.900] (-1639.478) (-1639.942) * (-1641.584) [-1638.261] (-1640.043) (-1640.425) -- 0:00:08
884000 -- (-1645.919) [-1638.358] (-1641.241) (-1639.616) * [-1638.914] (-1638.717) (-1639.044) (-1639.203) -- 0:00:08
884500 -- (-1643.195) [-1639.706] (-1640.570) (-1639.538) * (-1640.181) (-1640.190) (-1639.042) [-1645.739] -- 0:00:08
885000 -- [-1639.115] (-1640.390) (-1640.901) (-1640.540) * (-1639.225) (-1641.366) [-1639.577] (-1640.931) -- 0:00:08
Average standard deviation of split frequencies: 0.008974
885500 -- (-1640.459) [-1641.245] (-1641.760) (-1639.529) * (-1639.111) (-1639.624) [-1643.555] (-1640.021) -- 0:00:08
886000 -- (-1638.778) (-1643.693) [-1640.446] (-1642.751) * (-1640.360) (-1641.863) (-1640.433) [-1639.453] -- 0:00:08
886500 -- (-1640.117) (-1640.308) [-1642.405] (-1638.720) * (-1641.199) [-1639.435] (-1641.588) (-1646.504) -- 0:00:08
887000 -- (-1643.905) (-1639.639) (-1640.358) [-1638.919] * [-1640.594] (-1638.549) (-1643.539) (-1649.241) -- 0:00:08
887500 -- (-1639.501) [-1642.326] (-1640.589) (-1644.832) * [-1640.153] (-1641.102) (-1641.040) (-1644.008) -- 0:00:08
888000 -- (-1640.382) (-1647.684) [-1640.945] (-1639.036) * (-1640.787) (-1646.005) (-1639.528) [-1640.427] -- 0:00:08
888500 -- (-1639.918) (-1643.730) [-1638.113] (-1639.975) * [-1638.353] (-1641.041) (-1640.353) (-1639.765) -- 0:00:08
889000 -- (-1639.859) (-1641.706) (-1639.101) [-1641.662] * (-1642.348) [-1641.885] (-1639.286) (-1638.567) -- 0:00:08
889500 -- (-1638.951) [-1641.668] (-1641.492) (-1640.115) * [-1639.452] (-1640.462) (-1640.050) (-1639.760) -- 0:00:08
890000 -- (-1638.068) [-1638.675] (-1639.032) (-1639.270) * (-1640.938) [-1638.840] (-1642.019) (-1641.493) -- 0:00:08
Average standard deviation of split frequencies: 0.008645
890500 -- (-1638.090) (-1639.542) [-1640.632] (-1639.581) * [-1642.826] (-1639.081) (-1639.704) (-1640.044) -- 0:00:08
891000 -- (-1639.744) [-1639.733] (-1639.021) (-1646.759) * (-1639.706) [-1641.932] (-1638.943) (-1640.026) -- 0:00:08
891500 -- (-1641.808) (-1641.306) [-1641.815] (-1641.857) * (-1641.788) (-1641.511) [-1639.808] (-1639.743) -- 0:00:08
892000 -- (-1640.875) [-1640.918] (-1642.470) (-1640.916) * (-1644.958) [-1639.688] (-1640.549) (-1640.204) -- 0:00:08
892500 -- (-1640.040) [-1640.420] (-1641.857) (-1643.093) * (-1646.201) (-1639.984) (-1639.854) [-1642.745] -- 0:00:08
893000 -- (-1640.400) (-1640.962) (-1640.344) [-1642.313] * [-1638.720] (-1641.322) (-1639.717) (-1638.385) -- 0:00:08
893500 -- [-1640.005] (-1640.133) (-1640.529) (-1639.091) * (-1642.835) (-1644.456) [-1639.239] (-1638.266) -- 0:00:07
894000 -- (-1638.710) (-1641.363) (-1643.089) [-1644.008] * (-1639.293) [-1640.453] (-1639.107) (-1639.972) -- 0:00:07
894500 -- (-1642.331) (-1639.794) [-1639.924] (-1640.983) * (-1638.811) (-1643.741) [-1641.696] (-1638.695) -- 0:00:07
895000 -- (-1639.897) (-1638.173) [-1639.588] (-1643.061) * [-1638.125] (-1644.898) (-1644.423) (-1639.946) -- 0:00:07
Average standard deviation of split frequencies: 0.009190
895500 -- (-1640.440) [-1638.183] (-1641.147) (-1641.064) * (-1640.654) (-1642.149) (-1639.929) [-1638.886] -- 0:00:07
896000 -- [-1641.004] (-1639.181) (-1641.422) (-1640.538) * (-1639.000) (-1643.317) (-1646.196) [-1641.364] -- 0:00:07
896500 -- (-1641.688) (-1642.002) (-1641.887) [-1639.353] * (-1638.989) (-1641.985) (-1642.812) [-1640.477] -- 0:00:07
897000 -- (-1638.721) [-1640.743] (-1641.926) (-1638.799) * (-1641.034) (-1641.268) (-1640.153) [-1638.905] -- 0:00:07
897500 -- (-1639.921) [-1638.881] (-1642.752) (-1638.841) * (-1641.246) (-1640.078) [-1640.747] (-1642.182) -- 0:00:07
898000 -- (-1638.339) (-1639.632) (-1640.101) [-1639.640] * [-1641.101] (-1639.370) (-1638.954) (-1642.925) -- 0:00:07
898500 -- (-1637.999) [-1640.032] (-1640.713) (-1638.959) * (-1648.033) [-1640.301] (-1639.175) (-1641.382) -- 0:00:07
899000 -- (-1637.999) (-1641.922) [-1640.982] (-1641.607) * (-1643.403) [-1640.899] (-1639.392) (-1641.868) -- 0:00:07
899500 -- (-1640.348) (-1639.983) [-1639.865] (-1640.201) * (-1641.094) (-1643.107) (-1638.340) [-1638.725] -- 0:00:07
900000 -- (-1642.128) (-1642.180) (-1641.515) [-1638.591] * (-1641.078) (-1642.611) [-1638.624] (-1647.346) -- 0:00:07
Average standard deviation of split frequencies: 0.009526
900500 -- [-1641.027] (-1639.082) (-1642.685) (-1641.748) * (-1638.445) (-1639.825) (-1639.774) [-1639.256] -- 0:00:07
901000 -- (-1643.992) [-1638.927] (-1639.366) (-1643.238) * (-1640.844) (-1639.615) [-1641.782] (-1639.612) -- 0:00:07
901500 -- (-1640.859) (-1638.666) [-1640.076] (-1643.404) * (-1641.113) (-1639.303) [-1641.324] (-1639.662) -- 0:00:07
902000 -- [-1639.473] (-1639.821) (-1640.463) (-1639.157) * (-1641.197) (-1645.496) (-1638.721) [-1639.847] -- 0:00:07
902500 -- [-1641.886] (-1639.110) (-1648.092) (-1639.070) * (-1639.876) (-1641.051) (-1639.950) [-1643.950] -- 0:00:07
903000 -- (-1640.526) [-1640.982] (-1645.622) (-1641.374) * (-1642.006) (-1639.519) (-1639.696) [-1638.709] -- 0:00:07
903500 -- (-1640.523) (-1639.436) (-1643.933) [-1639.818] * [-1639.959] (-1645.711) (-1638.182) (-1639.976) -- 0:00:07
904000 -- (-1639.097) (-1641.942) (-1646.174) [-1641.398] * (-1641.339) (-1641.222) [-1639.279] (-1638.873) -- 0:00:07
904500 -- [-1640.052] (-1641.015) (-1640.491) (-1642.049) * (-1638.785) (-1643.090) [-1644.561] (-1641.496) -- 0:00:07
905000 -- (-1642.015) [-1639.486] (-1642.059) (-1639.946) * (-1638.673) (-1641.249) [-1639.317] (-1640.369) -- 0:00:07
Average standard deviation of split frequencies: 0.009504
905500 -- [-1639.357] (-1641.300) (-1642.168) (-1645.377) * (-1638.099) [-1639.198] (-1641.238) (-1640.608) -- 0:00:07
906000 -- (-1639.463) (-1641.200) [-1638.843] (-1638.681) * (-1639.597) (-1639.989) (-1640.851) [-1640.724] -- 0:00:07
906500 -- (-1642.367) (-1646.569) (-1639.889) [-1639.697] * (-1643.654) (-1643.209) (-1639.160) [-1641.739] -- 0:00:07
907000 -- (-1642.838) (-1639.756) [-1641.807] (-1641.299) * (-1640.405) [-1640.028] (-1640.408) (-1641.521) -- 0:00:06
907500 -- [-1640.023] (-1640.340) (-1644.162) (-1640.900) * (-1639.752) (-1641.612) [-1640.376] (-1641.092) -- 0:00:06
908000 -- (-1640.472) (-1641.452) [-1640.896] (-1641.303) * (-1639.493) (-1640.470) [-1638.539] (-1639.882) -- 0:00:06
908500 -- (-1638.905) (-1640.292) (-1639.190) [-1640.775] * (-1639.771) [-1638.848] (-1639.158) (-1639.156) -- 0:00:06
909000 -- [-1639.894] (-1638.996) (-1644.263) (-1640.565) * (-1639.089) (-1640.630) (-1639.218) [-1643.840] -- 0:00:06
909500 -- (-1640.473) (-1638.407) [-1640.675] (-1639.178) * (-1639.280) (-1643.889) [-1639.481] (-1642.194) -- 0:00:06
910000 -- (-1638.682) (-1641.667) [-1638.789] (-1643.481) * [-1640.921] (-1639.132) (-1640.817) (-1646.507) -- 0:00:06
Average standard deviation of split frequencies: 0.010008
910500 -- (-1639.158) (-1644.309) [-1640.192] (-1640.051) * [-1640.494] (-1641.085) (-1642.514) (-1640.853) -- 0:00:06
911000 -- (-1639.033) (-1641.399) [-1639.024] (-1639.357) * [-1642.048] (-1644.511) (-1640.593) (-1643.672) -- 0:00:06
911500 -- [-1638.964] (-1640.267) (-1638.849) (-1642.373) * [-1639.594] (-1640.130) (-1640.516) (-1639.187) -- 0:00:06
912000 -- (-1639.384) (-1641.947) [-1640.142] (-1641.640) * (-1643.464) [-1642.217] (-1639.381) (-1640.699) -- 0:00:06
912500 -- (-1640.315) (-1643.172) (-1642.193) [-1639.437] * (-1642.022) (-1642.423) [-1638.670] (-1647.317) -- 0:00:06
913000 -- (-1641.054) (-1643.077) (-1639.304) [-1641.057] * [-1643.161] (-1638.144) (-1642.631) (-1643.012) -- 0:00:06
913500 -- (-1644.864) (-1642.008) [-1640.671] (-1640.398) * (-1642.237) (-1638.882) (-1639.951) [-1640.253] -- 0:00:06
914000 -- (-1647.464) (-1639.151) (-1639.215) [-1639.532] * [-1639.243] (-1643.606) (-1638.541) (-1641.931) -- 0:00:06
914500 -- (-1640.600) [-1638.647] (-1638.206) (-1639.419) * [-1642.212] (-1640.328) (-1638.517) (-1643.160) -- 0:00:06
915000 -- [-1643.328] (-1639.075) (-1638.148) (-1639.604) * (-1640.268) (-1640.874) [-1638.591] (-1644.461) -- 0:00:06
Average standard deviation of split frequencies: 0.009915
915500 -- (-1638.782) [-1638.383] (-1639.913) (-1643.148) * [-1639.529] (-1640.493) (-1640.184) (-1641.485) -- 0:00:06
916000 -- (-1641.585) [-1638.383] (-1640.490) (-1641.088) * (-1638.320) (-1640.298) [-1641.184] (-1640.358) -- 0:00:06
916500 -- (-1640.851) (-1640.707) [-1639.756] (-1640.585) * (-1640.140) [-1641.700] (-1639.701) (-1641.734) -- 0:00:06
917000 -- (-1640.516) (-1641.438) (-1640.559) [-1639.816] * (-1643.321) (-1642.407) [-1641.474] (-1643.241) -- 0:00:06
917500 -- [-1638.917] (-1638.786) (-1644.868) (-1639.431) * (-1640.185) [-1640.351] (-1639.321) (-1639.654) -- 0:00:06
918000 -- [-1638.901] (-1638.627) (-1641.704) (-1640.123) * (-1640.430) [-1640.510] (-1642.944) (-1641.720) -- 0:00:06
918500 -- [-1639.651] (-1638.465) (-1641.239) (-1641.450) * (-1639.783) (-1643.826) (-1638.679) [-1640.869] -- 0:00:06
919000 -- (-1640.385) (-1638.000) (-1641.173) [-1639.951] * (-1640.389) (-1641.440) [-1639.323] (-1640.410) -- 0:00:06
919500 -- [-1642.390] (-1639.659) (-1646.166) (-1640.265) * [-1643.152] (-1639.326) (-1638.920) (-1642.654) -- 0:00:06
920000 -- (-1640.775) (-1639.482) (-1639.348) [-1640.568] * (-1639.345) [-1640.166] (-1639.895) (-1638.890) -- 0:00:05
Average standard deviation of split frequencies: 0.010401
920500 -- (-1640.163) (-1638.373) [-1638.521] (-1639.308) * (-1640.160) (-1640.219) [-1640.399] (-1641.183) -- 0:00:05
921000 -- (-1640.017) [-1638.420] (-1639.593) (-1638.744) * (-1638.639) (-1642.526) [-1642.340] (-1639.361) -- 0:00:05
921500 -- (-1640.353) (-1638.950) (-1642.560) [-1639.935] * (-1639.638) [-1641.543] (-1643.881) (-1639.714) -- 0:00:05
922000 -- (-1645.787) (-1638.616) [-1645.960] (-1640.123) * (-1643.383) (-1641.958) (-1640.513) [-1642.065] -- 0:00:05
922500 -- (-1644.785) [-1638.720] (-1646.712) (-1638.405) * [-1641.057] (-1640.463) (-1641.755) (-1644.884) -- 0:00:05
923000 -- (-1640.019) (-1639.366) [-1642.854] (-1638.213) * [-1638.896] (-1639.132) (-1645.107) (-1639.371) -- 0:00:05
923500 -- (-1640.557) (-1640.269) (-1643.190) [-1639.063] * (-1640.158) (-1639.557) (-1641.135) [-1642.774] -- 0:00:05
924000 -- (-1638.229) (-1639.426) [-1640.585] (-1641.040) * (-1642.750) [-1638.065] (-1641.699) (-1643.140) -- 0:00:05
924500 -- (-1638.444) (-1639.850) (-1639.622) [-1640.326] * [-1642.226] (-1641.026) (-1638.967) (-1643.175) -- 0:00:05
925000 -- (-1638.256) (-1639.724) [-1641.381] (-1640.790) * (-1640.692) [-1640.337] (-1639.782) (-1643.871) -- 0:00:05
Average standard deviation of split frequencies: 0.010436
925500 -- [-1638.473] (-1638.097) (-1640.530) (-1642.722) * (-1639.400) [-1638.852] (-1639.589) (-1640.600) -- 0:00:05
926000 -- [-1638.087] (-1638.563) (-1640.596) (-1639.540) * (-1639.639) [-1639.449] (-1640.714) (-1642.986) -- 0:00:05
926500 -- (-1638.392) (-1639.466) (-1639.505) [-1639.390] * (-1640.852) (-1643.857) [-1640.116] (-1641.061) -- 0:00:05
927000 -- [-1640.311] (-1641.541) (-1639.017) (-1639.294) * (-1639.017) [-1639.811] (-1638.836) (-1639.933) -- 0:00:05
927500 -- [-1638.763] (-1643.087) (-1641.056) (-1643.741) * (-1643.770) [-1642.034] (-1639.622) (-1640.214) -- 0:00:05
928000 -- (-1642.881) (-1639.408) (-1647.120) [-1642.618] * (-1644.272) (-1640.420) (-1641.494) [-1641.149] -- 0:00:05
928500 -- (-1639.834) (-1638.618) [-1645.481] (-1640.436) * [-1640.136] (-1640.045) (-1638.305) (-1643.681) -- 0:00:05
929000 -- [-1638.394] (-1639.346) (-1642.589) (-1639.953) * (-1640.484) (-1639.099) (-1638.631) [-1641.525] -- 0:00:05
929500 -- (-1640.497) (-1640.189) [-1643.656] (-1638.259) * (-1640.243) (-1640.268) (-1639.767) [-1641.632] -- 0:00:05
930000 -- (-1638.814) (-1640.315) [-1642.823] (-1638.706) * (-1639.214) [-1639.187] (-1639.824) (-1644.588) -- 0:00:05
Average standard deviation of split frequencies: 0.010415
930500 -- (-1639.311) (-1641.800) [-1641.954] (-1639.922) * (-1640.675) (-1640.939) (-1641.315) [-1638.288] -- 0:00:05
931000 -- (-1638.964) [-1641.907] (-1640.282) (-1644.700) * (-1639.192) (-1640.328) [-1638.262] (-1638.892) -- 0:00:05
931500 -- (-1641.767) [-1641.445] (-1644.020) (-1644.537) * [-1639.059] (-1640.191) (-1644.223) (-1640.073) -- 0:00:05
932000 -- (-1638.893) (-1639.065) (-1642.290) [-1638.770] * (-1638.435) (-1638.845) (-1640.828) [-1642.381] -- 0:00:05
932500 -- (-1639.809) (-1640.012) (-1639.237) [-1640.004] * [-1637.980] (-1641.802) (-1639.329) (-1642.561) -- 0:00:05
933000 -- [-1640.700] (-1639.235) (-1641.768) (-1639.757) * (-1638.466) [-1638.163] (-1639.203) (-1638.717) -- 0:00:05
933500 -- (-1639.372) (-1643.837) [-1644.564] (-1639.941) * (-1638.462) (-1639.591) (-1639.494) [-1638.956] -- 0:00:04
934000 -- (-1639.602) (-1642.955) (-1638.698) [-1642.184] * (-1642.374) [-1640.139] (-1642.589) (-1639.267) -- 0:00:04
934500 -- (-1641.738) [-1645.276] (-1638.290) (-1640.147) * (-1639.471) (-1639.711) [-1640.993] (-1641.009) -- 0:00:04
935000 -- (-1638.406) (-1642.351) (-1639.095) [-1641.259] * (-1640.280) (-1638.569) [-1639.494] (-1641.714) -- 0:00:04
Average standard deviation of split frequencies: 0.010199
935500 -- (-1640.554) (-1639.571) (-1638.957) [-1641.718] * (-1640.683) (-1638.727) (-1640.735) [-1643.459] -- 0:00:04
936000 -- (-1639.303) (-1639.140) (-1642.694) [-1642.457] * (-1638.606) [-1639.071] (-1640.021) (-1639.371) -- 0:00:04
936500 -- (-1638.640) (-1639.831) [-1639.016] (-1638.621) * (-1640.599) (-1639.873) (-1638.858) [-1638.110] -- 0:00:04
937000 -- (-1639.722) (-1639.327) [-1640.725] (-1638.279) * [-1640.298] (-1642.726) (-1638.647) (-1641.857) -- 0:00:04
937500 -- (-1639.535) (-1640.041) (-1643.762) [-1640.207] * (-1639.615) (-1638.705) [-1638.831] (-1641.003) -- 0:00:04
938000 -- (-1639.138) [-1639.349] (-1646.351) (-1641.480) * (-1640.348) (-1638.829) [-1638.791] (-1639.985) -- 0:00:04
938500 -- (-1639.539) (-1638.567) (-1647.045) [-1640.840] * [-1639.845] (-1638.566) (-1640.239) (-1641.315) -- 0:00:04
939000 -- [-1638.434] (-1639.449) (-1638.943) (-1639.940) * [-1638.915] (-1639.990) (-1640.634) (-1643.578) -- 0:00:04
939500 -- (-1638.436) (-1641.137) [-1639.192] (-1640.457) * (-1638.752) [-1640.741] (-1639.586) (-1638.969) -- 0:00:04
940000 -- [-1641.882] (-1640.609) (-1640.862) (-1643.035) * (-1640.480) (-1641.800) [-1639.133] (-1639.242) -- 0:00:04
Average standard deviation of split frequencies: 0.009835
940500 -- (-1640.910) (-1639.549) (-1642.515) [-1638.383] * [-1645.776] (-1644.155) (-1643.689) (-1638.207) -- 0:00:04
941000 -- (-1642.600) (-1639.947) [-1639.393] (-1639.572) * (-1641.236) (-1639.761) (-1638.468) [-1640.208] -- 0:00:04
941500 -- (-1640.123) [-1638.995] (-1638.970) (-1638.540) * (-1639.431) (-1638.788) [-1638.626] (-1639.486) -- 0:00:04
942000 -- (-1642.230) [-1639.887] (-1644.917) (-1638.928) * [-1638.894] (-1639.165) (-1640.404) (-1644.705) -- 0:00:04
942500 -- (-1639.590) (-1641.076) [-1639.095] (-1641.042) * (-1638.234) [-1644.001] (-1638.950) (-1640.116) -- 0:00:04
943000 -- (-1638.788) (-1640.488) [-1639.092] (-1638.493) * (-1644.951) [-1648.186] (-1641.587) (-1640.105) -- 0:00:04
943500 -- (-1640.176) [-1640.775] (-1639.248) (-1640.176) * (-1641.638) [-1641.168] (-1639.138) (-1641.352) -- 0:00:04
944000 -- (-1638.682) [-1643.427] (-1640.131) (-1640.223) * [-1639.348] (-1639.284) (-1642.237) (-1640.168) -- 0:00:04
944500 -- (-1641.474) (-1639.588) (-1642.282) [-1639.987] * (-1641.941) (-1639.595) (-1639.675) [-1640.801] -- 0:00:04
945000 -- [-1641.126] (-1638.121) (-1639.912) (-1638.298) * (-1639.747) (-1645.671) [-1641.300] (-1641.439) -- 0:00:04
Average standard deviation of split frequencies: 0.009873
945500 -- (-1641.374) [-1638.095] (-1641.006) (-1638.578) * (-1638.514) (-1647.610) (-1638.313) [-1642.456] -- 0:00:04
946000 -- [-1640.141] (-1639.175) (-1640.783) (-1639.680) * (-1640.139) [-1640.529] (-1642.944) (-1641.300) -- 0:00:04
946500 -- [-1640.045] (-1638.563) (-1639.308) (-1640.079) * (-1639.194) (-1643.129) [-1638.194] (-1639.766) -- 0:00:04
947000 -- (-1639.737) [-1647.105] (-1640.622) (-1640.031) * (-1644.105) [-1639.629] (-1640.290) (-1643.200) -- 0:00:03
947500 -- (-1638.193) [-1638.667] (-1646.000) (-1638.967) * [-1642.625] (-1646.337) (-1642.152) (-1646.505) -- 0:00:03
948000 -- (-1638.852) [-1638.772] (-1640.247) (-1639.916) * (-1642.053) [-1640.547] (-1638.622) (-1640.262) -- 0:00:03
948500 -- [-1638.835] (-1640.073) (-1641.968) (-1647.172) * (-1640.580) (-1638.610) [-1638.196] (-1639.990) -- 0:00:03
949000 -- (-1643.109) [-1641.725] (-1640.413) (-1639.063) * [-1640.063] (-1642.643) (-1640.151) (-1641.531) -- 0:00:03
949500 -- (-1640.881) [-1639.939] (-1640.615) (-1641.530) * [-1639.764] (-1640.514) (-1638.219) (-1641.035) -- 0:00:03
950000 -- (-1642.911) [-1638.965] (-1643.338) (-1639.009) * (-1640.769) (-1641.222) (-1639.130) [-1639.757] -- 0:00:03
Average standard deviation of split frequencies: 0.009607
950500 -- (-1638.518) [-1638.583] (-1643.413) (-1639.719) * (-1639.870) [-1639.681] (-1639.909) (-1640.161) -- 0:00:03
951000 -- (-1640.695) (-1638.936) [-1640.546] (-1643.929) * [-1641.235] (-1641.967) (-1641.809) (-1639.326) -- 0:00:03
951500 -- (-1643.765) [-1638.534] (-1640.184) (-1644.379) * (-1640.128) [-1638.704] (-1642.139) (-1642.423) -- 0:00:03
952000 -- (-1638.574) [-1640.456] (-1639.718) (-1646.955) * (-1644.468) (-1638.958) [-1641.487] (-1643.136) -- 0:00:03
952500 -- [-1638.568] (-1642.537) (-1641.248) (-1641.431) * (-1641.195) (-1642.296) [-1639.460] (-1642.088) -- 0:00:03
953000 -- (-1639.248) (-1639.456) [-1641.449] (-1641.176) * [-1644.283] (-1642.481) (-1640.376) (-1641.235) -- 0:00:03
953500 -- [-1640.049] (-1642.743) (-1639.809) (-1641.140) * [-1640.049] (-1640.284) (-1641.523) (-1641.632) -- 0:00:03
954000 -- [-1641.449] (-1640.081) (-1646.398) (-1639.725) * (-1644.657) (-1639.151) [-1639.342] (-1638.932) -- 0:00:03
954500 -- (-1640.023) (-1638.747) (-1640.164) [-1639.303] * (-1644.156) (-1638.878) [-1639.387] (-1639.650) -- 0:00:03
955000 -- (-1647.789) [-1640.839] (-1639.285) (-1638.226) * [-1641.728] (-1640.855) (-1641.583) (-1639.792) -- 0:00:03
Average standard deviation of split frequencies: 0.009270
955500 -- (-1642.443) [-1640.499] (-1642.045) (-1646.272) * (-1642.375) (-1639.920) [-1641.791] (-1639.944) -- 0:00:03
956000 -- (-1639.286) (-1642.011) [-1639.542] (-1641.771) * (-1641.523) (-1644.402) [-1639.181] (-1640.805) -- 0:00:03
956500 -- (-1639.580) (-1639.595) (-1640.940) [-1639.948] * (-1643.359) (-1638.749) (-1645.538) [-1640.096] -- 0:00:03
957000 -- [-1638.658] (-1640.948) (-1644.617) (-1640.799) * (-1640.632) (-1638.462) [-1639.535] (-1641.139) -- 0:00:03
957500 -- (-1638.958) (-1638.098) (-1643.577) [-1640.153] * (-1641.393) (-1639.630) [-1641.527] (-1639.285) -- 0:00:03
958000 -- (-1638.573) (-1640.672) (-1640.565) [-1640.187] * (-1639.836) (-1639.122) (-1642.531) [-1638.881] -- 0:00:03
958500 -- [-1640.143] (-1639.387) (-1642.200) (-1644.802) * [-1641.796] (-1638.711) (-1640.243) (-1639.140) -- 0:00:03
959000 -- (-1639.463) (-1640.500) [-1642.173] (-1642.217) * (-1640.500) (-1638.983) (-1640.424) [-1638.533] -- 0:00:03
959500 -- [-1638.929] (-1640.868) (-1641.184) (-1641.089) * (-1643.302) (-1638.895) (-1639.056) [-1640.082] -- 0:00:03
960000 -- [-1640.885] (-1640.428) (-1639.767) (-1641.898) * [-1642.291] (-1640.521) (-1641.414) (-1642.244) -- 0:00:02
Average standard deviation of split frequencies: 0.009127
960500 -- (-1644.484) (-1641.048) [-1638.816] (-1640.000) * (-1639.630) (-1640.796) [-1639.550] (-1640.166) -- 0:00:02
961000 -- (-1640.180) (-1644.714) [-1642.536] (-1641.146) * [-1639.323] (-1643.948) (-1638.975) (-1639.055) -- 0:00:02
961500 -- [-1639.402] (-1639.195) (-1640.589) (-1642.161) * (-1641.168) [-1639.646] (-1641.820) (-1640.862) -- 0:00:02
962000 -- (-1639.222) (-1639.321) [-1638.754] (-1640.455) * (-1642.527) (-1638.973) [-1642.561] (-1644.259) -- 0:00:02
962500 -- (-1640.700) [-1640.092] (-1638.763) (-1639.527) * (-1639.760) (-1644.657) (-1640.332) [-1640.566] -- 0:00:02
963000 -- (-1639.610) (-1643.961) (-1642.638) [-1639.480] * (-1638.600) (-1638.808) (-1641.014) [-1640.074] -- 0:00:02
963500 -- (-1642.280) (-1639.379) (-1639.752) [-1639.158] * (-1641.368) [-1640.653] (-1642.172) (-1641.666) -- 0:00:02
964000 -- [-1639.253] (-1638.546) (-1641.100) (-1642.033) * (-1639.400) (-1640.350) [-1640.300] (-1640.497) -- 0:00:02
964500 -- (-1640.798) [-1640.484] (-1640.858) (-1646.868) * (-1640.190) [-1642.522] (-1639.648) (-1640.671) -- 0:00:02
965000 -- (-1640.748) [-1644.744] (-1638.513) (-1641.624) * [-1640.206] (-1640.285) (-1639.683) (-1639.690) -- 0:00:02
Average standard deviation of split frequencies: 0.008882
965500 -- [-1642.219] (-1640.910) (-1641.129) (-1640.186) * (-1640.558) (-1640.987) (-1639.871) [-1639.034] -- 0:00:02
966000 -- (-1638.623) (-1640.416) (-1642.908) [-1638.255] * [-1640.126] (-1640.760) (-1639.536) (-1640.630) -- 0:00:02
966500 -- (-1638.747) [-1638.356] (-1644.974) (-1642.708) * [-1641.490] (-1641.728) (-1640.284) (-1638.076) -- 0:00:02
967000 -- (-1639.816) (-1638.977) (-1639.975) [-1641.755] * (-1639.149) [-1640.801] (-1640.034) (-1639.800) -- 0:00:02
967500 -- (-1639.048) (-1640.136) (-1638.998) [-1639.863] * (-1638.179) (-1639.990) (-1641.804) [-1639.796] -- 0:00:02
968000 -- [-1641.913] (-1642.292) (-1641.336) (-1638.517) * [-1638.934] (-1642.279) (-1642.075) (-1639.550) -- 0:00:02
968500 -- (-1639.665) [-1639.879] (-1642.838) (-1639.606) * [-1638.838] (-1641.454) (-1641.856) (-1641.048) -- 0:00:02
969000 -- [-1640.928] (-1641.312) (-1639.153) (-1642.467) * (-1640.262) [-1640.370] (-1638.688) (-1639.805) -- 0:00:02
969500 -- (-1639.831) [-1640.883] (-1640.816) (-1640.341) * (-1642.189) (-1639.039) [-1638.747] (-1645.808) -- 0:00:02
970000 -- [-1639.115] (-1644.474) (-1641.794) (-1639.592) * (-1640.766) (-1643.939) [-1638.009] (-1639.469) -- 0:00:02
Average standard deviation of split frequencies: 0.008677
970500 -- (-1644.297) [-1641.409] (-1641.725) (-1638.857) * (-1643.607) [-1644.950] (-1639.590) (-1638.674) -- 0:00:02
971000 -- (-1640.645) (-1639.888) [-1639.864] (-1641.840) * (-1639.985) [-1640.349] (-1639.311) (-1638.082) -- 0:00:02
971500 -- (-1642.019) (-1639.098) [-1638.456] (-1645.221) * (-1641.247) [-1640.505] (-1638.760) (-1638.299) -- 0:00:02
972000 -- (-1641.580) (-1640.962) [-1640.664] (-1638.913) * (-1638.082) (-1641.527) [-1638.384] (-1638.823) -- 0:00:02
972500 -- (-1639.008) (-1639.336) [-1639.412] (-1641.839) * (-1644.640) (-1639.966) [-1638.476] (-1639.364) -- 0:00:02
973000 -- (-1639.428) (-1638.633) (-1639.180) [-1639.734] * (-1640.473) (-1641.754) (-1638.322) [-1640.934] -- 0:00:02
973500 -- (-1643.059) (-1638.420) (-1639.781) [-1638.992] * (-1640.026) (-1642.143) [-1643.427] (-1639.558) -- 0:00:01
974000 -- (-1638.583) (-1638.448) [-1639.967] (-1638.535) * (-1640.759) (-1640.894) [-1639.622] (-1639.032) -- 0:00:01
974500 -- (-1641.740) [-1638.306] (-1639.599) (-1640.643) * [-1643.324] (-1641.664) (-1638.960) (-1640.545) -- 0:00:01
975000 -- (-1641.365) (-1639.358) [-1638.966] (-1641.626) * (-1641.566) (-1641.287) (-1641.646) [-1644.385] -- 0:00:01
Average standard deviation of split frequencies: 0.008855
975500 -- (-1641.990) [-1642.884] (-1639.932) (-1642.056) * [-1644.199] (-1643.018) (-1640.461) (-1642.298) -- 0:00:01
976000 -- (-1641.134) [-1639.807] (-1639.804) (-1638.503) * [-1640.980] (-1638.449) (-1643.800) (-1640.240) -- 0:00:01
976500 -- (-1640.509) [-1640.403] (-1639.984) (-1642.777) * [-1641.177] (-1642.092) (-1639.618) (-1640.652) -- 0:00:01
977000 -- (-1645.959) (-1638.903) [-1639.827] (-1644.125) * (-1640.639) (-1642.115) (-1642.333) [-1638.397] -- 0:00:01
977500 -- (-1643.676) (-1638.860) [-1639.115] (-1640.424) * [-1641.303] (-1645.431) (-1640.021) (-1639.558) -- 0:00:01
978000 -- (-1645.222) (-1639.884) [-1642.615] (-1639.177) * (-1640.538) (-1641.523) (-1639.310) [-1645.802] -- 0:00:01
978500 -- (-1639.795) [-1640.763] (-1640.582) (-1641.258) * (-1640.729) (-1638.550) [-1640.312] (-1639.153) -- 0:00:01
979000 -- (-1641.793) (-1640.980) [-1639.931] (-1639.804) * (-1641.312) [-1640.315] (-1643.689) (-1638.514) -- 0:00:01
979500 -- (-1639.384) (-1642.006) [-1641.281] (-1638.524) * (-1639.909) (-1638.974) (-1642.263) [-1641.608] -- 0:00:01
980000 -- (-1642.353) (-1640.867) (-1638.537) [-1640.618] * (-1639.878) (-1638.578) (-1640.873) [-1638.010] -- 0:00:01
Average standard deviation of split frequencies: 0.008909
980500 -- (-1641.393) [-1639.225] (-1638.528) (-1638.570) * (-1640.870) (-1639.845) [-1639.044] (-1645.014) -- 0:00:01
981000 -- [-1638.866] (-1638.311) (-1639.080) (-1639.233) * [-1639.401] (-1639.876) (-1640.665) (-1639.441) -- 0:00:01
981500 -- [-1640.577] (-1642.958) (-1639.711) (-1641.535) * (-1642.028) (-1639.690) (-1639.773) [-1639.269] -- 0:00:01
982000 -- (-1640.740) (-1647.831) (-1643.138) [-1642.484] * [-1639.341] (-1643.081) (-1642.986) (-1642.312) -- 0:00:01
982500 -- [-1641.114] (-1641.252) (-1641.035) (-1640.772) * (-1638.474) (-1638.652) [-1639.288] (-1641.181) -- 0:00:01
983000 -- (-1638.982) (-1642.299) [-1641.485] (-1640.201) * (-1639.879) [-1637.874] (-1639.069) (-1638.776) -- 0:00:01
983500 -- (-1639.070) [-1641.025] (-1638.991) (-1640.718) * [-1639.186] (-1638.861) (-1643.724) (-1640.685) -- 0:00:01
984000 -- (-1640.156) [-1640.681] (-1640.691) (-1638.343) * (-1643.624) (-1640.337) (-1648.951) [-1638.469] -- 0:00:01
984500 -- (-1640.466) (-1639.401) (-1638.353) [-1640.924] * (-1644.329) [-1640.050] (-1643.065) (-1642.225) -- 0:00:01
985000 -- (-1641.226) (-1638.230) (-1639.202) [-1638.244] * [-1645.132] (-1640.495) (-1640.162) (-1639.800) -- 0:00:01
Average standard deviation of split frequencies: 0.008542
985500 -- [-1638.927] (-1639.802) (-1638.326) (-1641.329) * (-1639.991) [-1645.784] (-1640.173) (-1642.436) -- 0:00:01
986000 -- (-1638.965) (-1639.683) [-1640.184] (-1642.015) * (-1639.395) (-1646.699) [-1640.197] (-1641.478) -- 0:00:01
986500 -- (-1642.306) (-1643.334) (-1638.865) [-1638.994] * (-1639.654) (-1638.545) [-1641.095] (-1647.177) -- 0:00:01
987000 -- (-1641.861) (-1639.218) (-1639.673) [-1641.266] * (-1639.123) [-1641.430] (-1642.786) (-1640.288) -- 0:00:00
987500 -- (-1640.676) (-1639.227) [-1641.090] (-1641.231) * (-1638.759) [-1639.510] (-1639.479) (-1638.435) -- 0:00:00
988000 -- (-1640.793) [-1639.045] (-1640.984) (-1641.346) * (-1640.273) (-1641.772) [-1639.023] (-1638.747) -- 0:00:00
988500 -- [-1641.386] (-1644.215) (-1639.231) (-1641.462) * (-1639.088) (-1641.273) (-1642.003) [-1638.958] -- 0:00:00
989000 -- (-1641.668) (-1640.030) (-1639.170) [-1640.411] * (-1640.070) (-1638.487) (-1639.184) [-1639.662] -- 0:00:00
989500 -- (-1640.576) (-1639.220) [-1642.537] (-1639.231) * [-1641.333] (-1638.930) (-1639.177) (-1640.822) -- 0:00:00
990000 -- (-1643.351) (-1645.115) (-1640.760) [-1641.301] * [-1639.978] (-1640.014) (-1639.484) (-1640.606) -- 0:00:00
Average standard deviation of split frequencies: 0.008311
990500 -- (-1639.913) [-1639.452] (-1640.648) (-1641.048) * [-1640.566] (-1639.662) (-1639.122) (-1638.512) -- 0:00:00
991000 -- (-1642.619) (-1639.853) [-1642.379] (-1642.052) * (-1639.435) (-1640.005) [-1638.870] (-1638.810) -- 0:00:00
991500 -- (-1640.994) (-1640.842) (-1643.158) [-1640.859] * (-1641.168) (-1643.572) [-1639.557] (-1639.275) -- 0:00:00
992000 -- [-1638.399] (-1639.026) (-1643.805) (-1638.991) * (-1640.623) [-1639.680] (-1645.912) (-1641.244) -- 0:00:00
992500 -- (-1639.386) [-1638.036] (-1640.210) (-1638.708) * (-1639.864) (-1642.281) [-1640.036] (-1639.821) -- 0:00:00
993000 -- [-1638.469] (-1638.098) (-1640.792) (-1641.820) * [-1639.339] (-1639.198) (-1640.848) (-1640.400) -- 0:00:00
993500 -- (-1640.036) [-1638.967] (-1641.669) (-1640.051) * (-1640.883) [-1639.865] (-1640.212) (-1642.384) -- 0:00:00
994000 -- (-1639.413) (-1641.841) [-1643.303] (-1640.441) * (-1640.339) (-1639.986) [-1639.388] (-1642.542) -- 0:00:00
994500 -- [-1640.500] (-1644.643) (-1638.559) (-1638.779) * [-1645.110] (-1639.303) (-1640.119) (-1638.860) -- 0:00:00
995000 -- (-1641.678) (-1642.096) [-1640.895] (-1640.707) * (-1643.794) (-1639.994) (-1640.595) [-1638.589] -- 0:00:00
Average standard deviation of split frequencies: 0.008235
995500 -- (-1645.464) (-1639.167) [-1639.009] (-1643.031) * [-1639.179] (-1639.883) (-1640.694) (-1642.762) -- 0:00:00
996000 -- (-1640.120) [-1639.832] (-1639.115) (-1639.513) * [-1643.019] (-1640.200) (-1640.429) (-1638.642) -- 0:00:00
996500 -- (-1641.023) (-1640.648) [-1639.138] (-1639.810) * [-1639.496] (-1641.048) (-1641.899) (-1638.379) -- 0:00:00
997000 -- (-1640.031) (-1639.383) (-1639.945) [-1639.723] * (-1640.106) (-1641.862) (-1639.288) [-1638.331] -- 0:00:00
997500 -- (-1638.826) [-1639.073] (-1641.604) (-1639.586) * (-1640.525) [-1642.164] (-1639.699) (-1642.714) -- 0:00:00
998000 -- (-1640.212) (-1640.744) (-1640.339) [-1638.559] * (-1639.333) (-1643.599) (-1640.002) [-1640.056] -- 0:00:00
998500 -- (-1639.540) (-1640.791) [-1640.936] (-1640.034) * [-1639.441] (-1643.037) (-1641.216) (-1642.369) -- 0:00:00
999000 -- [-1639.537] (-1639.499) (-1642.990) (-1640.494) * (-1639.032) [-1639.379] (-1640.859) (-1640.017) -- 0:00:00
999500 -- (-1639.587) [-1641.409] (-1644.668) (-1640.593) * (-1638.841) (-1639.576) [-1638.879] (-1642.668) -- 0:00:00
1000000 -- (-1640.050) [-1640.711] (-1641.244) (-1639.354) * [-1640.653] (-1642.286) (-1641.367) (-1640.171) -- 0:00:00
Average standard deviation of split frequencies: 0.007977
Analysis completed in 1 mins 15 seconds
Analysis used 73.76 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1637.81
Likelihood of best state for "cold" chain of run 2 was -1637.81
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 71 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
24.8 % ( 28 %) Dirichlet(Pi{all})
27.6 % ( 31 %) Slider(Pi{all})
78.8 % ( 50 %) Multiplier(Alpha{1,2})
77.9 % ( 51 %) Multiplier(Alpha{3})
16.3 % ( 20 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 63 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.6 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
24.3 % ( 22 %) Dirichlet(Pi{all})
27.2 % ( 25 %) Slider(Pi{all})
79.1 % ( 65 %) Multiplier(Alpha{1,2})
77.5 % ( 57 %) Multiplier(Alpha{3})
17.3 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.2 % ( 77 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 34 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.3 % ( 34 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166299 0.82 0.67
3 | 166734 166941 0.84
4 | 167074 166454 166498
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167024 0.83 0.67
3 | 166145 166519 0.84
4 | 166810 166703 166799
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1639.61
|2 2 2 2 |
| 1 2 |
|1 2 1 |
| * 2 2 2 12 2 1 1 1 2 1 2|
| 2 1 11 2 2 2 1 1 2 2 1 1 1 1 |
| 1 1 22 1 1 1 1 1 1 22 22 1|
| 1 * 22 2 1 1 2 2 1 12 |
| 1 1 2 1 1 2 2 21 2 1 1 221 |
| * 2 12 2 1 1 1 22 2 1 2 |
| 2 1 12 1 2 2 1 2 |
| 1 2 2 1 1 1 2 |
| 2 1 2 2 2 |
| 1 1 |
| |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1641.25
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1639.58 -1642.40
2 -1639.55 -1642.97
--------------------------------------
TOTAL -1639.57 -1642.73
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888905 0.087478 0.348699 1.484524 0.854171 1373.45 1431.76 1.000
r(A<->C){all} 0.161517 0.020381 0.000073 0.451137 0.123064 240.00 255.50 1.005
r(A<->G){all} 0.164211 0.018920 0.000007 0.439029 0.126257 223.72 255.80 1.001
r(A<->T){all} 0.156965 0.016809 0.000007 0.413118 0.126081 307.21 315.45 1.000
r(C<->G){all} 0.168742 0.019680 0.000026 0.448962 0.132751 161.42 196.95 1.013
r(C<->T){all} 0.173489 0.020864 0.000049 0.459913 0.133581 137.90 161.74 1.003
r(G<->T){all} 0.175076 0.020616 0.000025 0.464602 0.138698 84.93 156.35 1.000
pi(A){all} 0.202726 0.000136 0.179035 0.224818 0.202233 1386.27 1443.63 1.000
pi(C){all} 0.269874 0.000164 0.244071 0.294306 0.269851 1289.74 1318.36 1.000
pi(G){all} 0.319128 0.000183 0.291277 0.344389 0.318839 1171.12 1205.96 1.000
pi(T){all} 0.208272 0.000132 0.186032 0.230638 0.208271 1429.67 1465.33 1.000
alpha{1,2} 0.419433 0.227642 0.000140 1.397790 0.251660 1113.97 1307.48 1.000
alpha{3} 0.450355 0.232497 0.000391 1.407706 0.297716 1349.42 1386.95 1.000
pinvar{all} 0.998755 0.000002 0.995945 1.000000 0.999205 1093.61 1189.54 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- .*..*.
9 -- .*.***
10 -- .*...*
11 -- ..****
12 -- ..*.*.
13 -- ..*..*
14 -- ..**..
15 -- .***.*
16 -- .*.*..
17 -- ...**.
18 -- ....**
19 -- .**.**
20 -- .**...
21 -- .****.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 460 0.153231 0.005653 0.149234 0.157229 2
8 459 0.152898 0.013662 0.143238 0.162558 2
9 454 0.151233 0.010364 0.143904 0.158561 2
10 433 0.144237 0.008951 0.137908 0.150566 2
11 432 0.143904 0.000000 0.143904 0.143904 2
12 432 0.143904 0.007537 0.138574 0.149234 2
13 431 0.143571 0.015546 0.132578 0.154564 2
14 429 0.142905 0.008951 0.136576 0.149234 2
15 427 0.142239 0.004240 0.139241 0.145237 2
16 423 0.140906 0.009893 0.133911 0.147901 2
17 422 0.140573 0.005653 0.136576 0.144570 2
18 418 0.139241 0.000000 0.139241 0.139241 2
19 411 0.136909 0.015546 0.125916 0.147901 2
20 405 0.134910 0.004240 0.131912 0.137908 2
21 404 0.134577 0.009422 0.127915 0.141239 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/1res/argG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099374 0.009476 0.000002 0.294626 0.070956 1.000 2
length{all}[2] 0.095168 0.008751 0.000009 0.281975 0.064868 1.000 2
length{all}[3] 0.099322 0.010105 0.000005 0.296696 0.069708 1.000 2
length{all}[4] 0.101000 0.010374 0.000100 0.302034 0.068657 1.000 2
length{all}[5] 0.099652 0.009668 0.000002 0.297813 0.070534 1.000 2
length{all}[6] 0.095724 0.009283 0.000003 0.293775 0.066565 1.000 2
length{all}[7] 0.108120 0.009754 0.000456 0.304959 0.081471 1.004 2
length{all}[8] 0.102067 0.011234 0.000729 0.308919 0.073769 0.999 2
length{all}[9] 0.102270 0.012772 0.000459 0.305243 0.064323 0.999 2
length{all}[10] 0.094579 0.009394 0.000150 0.279058 0.063638 1.005 2
length{all}[11] 0.100776 0.010209 0.000029 0.294015 0.072408 1.000 2
length{all}[12] 0.105792 0.010893 0.000572 0.317583 0.073271 0.998 2
length{all}[13] 0.102671 0.010013 0.000679 0.300403 0.069430 1.003 2
length{all}[14] 0.102986 0.011110 0.000045 0.305838 0.066490 1.000 2
length{all}[15] 0.102129 0.010754 0.000137 0.304912 0.071569 1.000 2
length{all}[16] 0.094316 0.008129 0.000289 0.279445 0.065681 1.008 2
length{all}[17] 0.093504 0.009091 0.000151 0.278132 0.063807 1.003 2
length{all}[18] 0.084370 0.006726 0.000050 0.244292 0.056208 1.009 2
length{all}[19] 0.096876 0.009837 0.000086 0.290872 0.064150 1.000 2
length{all}[20] 0.101242 0.010790 0.000037 0.315233 0.063580 0.998 2
length{all}[21] 0.105791 0.011032 0.000223 0.335310 0.074008 1.003 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007977
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------ C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1200
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
3 ambiguity characters in seq. 1
3 ambiguity characters in seq. 2
3 ambiguity characters in seq. 3
3 ambiguity characters in seq. 4
6 ambiguity characters in seq. 5
6 ambiguity characters in seq. 6
2 sites are removed. 1 400
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 398 / 398 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 398 / 398 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.049279 0.040101 0.059599 0.059116 0.091978 0.078863 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1723.263008
Iterating by ming2
Initial: fx= 1723.263008
x= 0.04928 0.04010 0.05960 0.05912 0.09198 0.07886 0.30000 1.30000
1 h-m-p 0.0000 0.0001 950.1051 ++ 1629.998310 m 0.0001 13 | 1/8
2 h-m-p 0.0008 0.0042 91.3936 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 872.8465 ++ 1612.002052 m 0.0000 44 | 2/8
4 h-m-p 0.0003 0.0080 63.7654 ----------.. | 2/8
5 h-m-p 0.0000 0.0000 781.3322 ++ 1596.516518 m 0.0000 74 | 3/8
6 h-m-p 0.0003 0.0116 49.2718 ----------.. | 3/8
7 h-m-p 0.0000 0.0000 677.3086 ++ 1595.945479 m 0.0000 104 | 4/8
8 h-m-p 0.0000 0.0158 36.8628 ---------.. | 4/8
9 h-m-p 0.0000 0.0000 552.2110 ++ 1580.730872 m 0.0000 133 | 5/8
10 h-m-p 0.0008 0.0248 24.4291 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 391.3634 ++ 1575.518372 m 0.0000 164 | 6/8
12 h-m-p 0.1168 8.0000 0.0000 ++++ 1575.518372 m 8.0000 177 | 6/8
13 h-m-p 0.2695 8.0000 0.0002 +++ 1575.518372 m 8.0000 191 | 6/8
14 h-m-p 0.0068 3.3784 1.1160 +++Y 1575.518371 0 0.3208 207 | 6/8
15 h-m-p 1.6000 8.0000 0.0392 -----C 1575.518371 0 0.0004 223 | 6/8
16 h-m-p 1.6000 8.0000 0.0000 C 1575.518371 0 1.6000 236 | 6/8
17 h-m-p 0.2697 8.0000 0.0000 +Y 1575.518371 0 1.0788 250 | 6/8
18 h-m-p 0.0375 8.0000 0.0002 --N 1575.518371 0 0.0006 265 | 6/8
19 h-m-p 0.1074 8.0000 0.0000 -------N 1575.518371 0 0.0000 285
Out..
lnL = -1575.518371
286 lfun, 286 eigenQcodon, 1716 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.014037 0.049256 0.010278 0.096749 0.064831 0.050520 0.637851 0.540486 0.521986
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.197982
np = 9
lnL0 = -1685.773593
Iterating by ming2
Initial: fx= 1685.773593
x= 0.01404 0.04926 0.01028 0.09675 0.06483 0.05052 0.63785 0.54049 0.52199
1 h-m-p 0.0000 0.0000 935.4632 ++ 1662.315177 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0000 427.7868 ++ 1655.061962 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0002 391.0041 ++ 1604.030709 m 0.0002 38 | 3/9
4 h-m-p 0.0000 0.0001 143.2292 ++ 1600.831793 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0000 9470.5117 ++ 1587.014167 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 8820.2802 ++ 1575.518318 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 1575.518318 m 8.0000 86 | 6/9
8 h-m-p 0.0160 8.0000 0.0943 -----------C 1575.518318 0 0.0000 112 | 6/9
9 h-m-p 0.0160 8.0000 0.0099 +++++ 1575.518303 m 8.0000 130 | 6/9
10 h-m-p 0.2609 3.1310 0.3043 ------------Y 1575.518303 0 0.0000 157 | 6/9
11 h-m-p 0.0160 8.0000 0.0006 +++++ 1575.518302 m 8.0000 175 | 6/9
12 h-m-p 0.0171 2.7687 0.2934 -----------C 1575.518302 0 0.0000 201 | 6/9
13 h-m-p 0.0160 8.0000 0.0001 -----C 1575.518302 0 0.0000 221 | 6/9
14 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/9
15 h-m-p 0.0160 8.0000 0.0002 +++++ 1575.518302 m 8.0000 265 | 6/9
16 h-m-p 0.0096 4.7913 0.2449 -----------Y 1575.518302 0 0.0000 291 | 6/9
17 h-m-p 0.0160 8.0000 0.0038 +++++ 1575.518294 m 8.0000 309 | 6/9
18 h-m-p 0.1259 4.5725 0.2443 -----------C 1575.518294 0 0.0000 335 | 6/9
19 h-m-p 0.0160 8.0000 0.0115 +++++ 1575.518265 m 8.0000 353 | 6/9
20 h-m-p 0.3625 4.6092 0.2545 --------------C 1575.518265 0 0.0000 382 | 6/9
21 h-m-p 0.0160 8.0000 0.0000 +++++ 1575.518265 m 8.0000 400 | 6/9
22 h-m-p 0.0036 1.8064 0.3897 -----------C 1575.518265 0 0.0000 426 | 6/9
23 h-m-p 0.0160 8.0000 0.0000 -----------N 1575.518265 0 0.0000 452 | 6/9
24 h-m-p 0.0160 8.0000 0.0000 +++++ 1575.518265 m 8.0000 470 | 6/9
25 h-m-p 0.0057 2.8468 0.3040 -----------Y 1575.518265 0 0.0000 496 | 6/9
26 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/9
27 h-m-p 0.0160 8.0000 0.0004 +++++ 1575.518263 m 8.0000 540 | 6/9
28 h-m-p 0.0174 6.5606 0.1893 -------------.. | 6/9
29 h-m-p 0.0160 8.0000 0.0004 +++++ 1575.518262 m 8.0000 584 | 6/9
30 h-m-p 0.0179 6.6391 0.1874 ----------Y 1575.518262 0 0.0000 609 | 6/9
31 h-m-p 0.0001 0.0338 4.1059 +++++ 1575.518168 m 0.0338 627 | 7/9
32 h-m-p 0.5838 5.8214 0.1846 --------------Y 1575.518168 0 0.0000 653 | 7/9
33 h-m-p 0.0160 8.0000 0.0024 +++++ 1575.518152 m 8.0000 670 | 7/9
34 h-m-p 0.1059 5.3846 0.1798 -----------Y 1575.518152 0 0.0000 695 | 7/9
35 h-m-p 0.0160 8.0000 0.0001 ------C 1575.518152 0 0.0000 715 | 7/9
36 h-m-p 0.0160 8.0000 0.0002 +++++ 1575.518151 m 8.0000 732 | 7/9
37 h-m-p 0.0117 5.8505 0.1658 ----------C 1575.518151 0 0.0000 756 | 7/9
38 h-m-p 0.0160 8.0000 0.0000 ------C 1575.518151 0 0.0000 776 | 7/9
39 h-m-p 0.0160 8.0000 0.0000 +++++ 1575.518151 m 8.0000 793 | 7/9
40 h-m-p 0.0116 5.8094 0.1670 ----------Y 1575.518151 0 0.0000 817 | 7/9
41 h-m-p 0.0160 8.0000 0.0003 +++++ 1575.518149 m 8.0000 834 | 7/9
42 h-m-p 0.0152 5.8725 0.1656 ----------Y 1575.518149 0 0.0000 858 | 7/9
43 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/9
44 h-m-p 0.0160 8.0000 0.0009 +++++ 1575.518142 m 8.0000 900 | 7/9
45 h-m-p 0.0431 6.0948 0.1695 ------------Y 1575.518142 0 0.0000 926 | 7/9
46 h-m-p 0.0160 8.0000 0.0009 +++++ 1575.518138 m 8.0000 943 | 7/9
47 h-m-p 0.0180 8.0000 0.3856 -----------Y 1575.518138 0 0.0000 968 | 7/9
48 h-m-p 0.0160 8.0000 0.0000 ------Y 1575.518138 0 0.0000 988 | 7/9
49 h-m-p 0.0160 8.0000 0.0000 ---------Y 1575.518138 0 0.0000 1011
Out..
lnL = -1575.518138
1012 lfun, 3036 eigenQcodon, 12144 P(t)
Time used: 0:04
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.042787 0.052642 0.062859 0.099696 0.023592 0.093219 0.491560 1.261879 0.350792 0.438928 1.295310
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.895235
np = 11
lnL0 = -1717.558478
Iterating by ming2
Initial: fx= 1717.558478
x= 0.04279 0.05264 0.06286 0.09970 0.02359 0.09322 0.49156 1.26188 0.35079 0.43893 1.29531
1 h-m-p 0.0000 0.0001 902.6011 ++ 1665.212992 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0002 486.7386 ++ 1628.206702 m 0.0002 30 | 2/11
3 h-m-p 0.0000 0.0000 5315.9655 ++ 1613.559163 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0000 1488.6012 ++ 1601.457289 m 0.0000 58 | 4/11
5 h-m-p 0.0000 0.0000 13689.9011 ++ 1578.033773 m 0.0000 72 | 5/11
6 h-m-p 0.0000 0.0000 3584.4720 ++ 1575.518315 m 0.0000 86 | 6/11
7 h-m-p 1.6000 8.0000 0.0001 ++ 1575.518314 m 8.0000 100 | 6/11
8 h-m-p 0.0195 2.3087 0.0414 ++++ 1575.518302 m 2.3087 121 | 7/11
9 h-m-p 0.1657 8.0000 0.2241 -------------Y 1575.518302 0 0.0000 153 | 7/11
10 h-m-p 0.0160 8.0000 0.0033 +++++ 1575.518300 m 8.0000 174 | 7/11
11 h-m-p 0.0284 3.5541 0.9381 -----------Y 1575.518300 0 0.0000 203 | 7/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 1575.518300 m 8.0000 224 | 7/11
13 h-m-p 0.0160 8.0000 1.9370 -------------.. | 7/11
14 h-m-p 0.0160 8.0000 0.0001 +++++ 1575.518299 m 8.0000 270 | 7/11
15 h-m-p 0.0160 8.0000 0.0738 ----------Y 1575.518299 0 0.0000 298 | 7/11
16 h-m-p 0.0160 8.0000 0.0002 +++++ 1575.518299 m 8.0000 319 | 7/11
17 h-m-p 0.0160 8.0000 0.9914 ------------Y 1575.518299 0 0.0000 349 | 7/11
18 h-m-p 0.0160 8.0000 0.0185 +++++ 1575.518285 m 8.0000 370 | 7/11
19 h-m-p 0.1351 8.0000 1.0968 -------------Y 1575.518285 0 0.0000 401 | 7/11
20 h-m-p 0.0160 8.0000 0.0001 +++++ 1575.518285 m 8.0000 418 | 7/11
21 h-m-p 0.0024 1.1970 2.7946 -----------Y 1575.518285 0 0.0000 447 | 7/11
22 h-m-p 0.0160 8.0000 0.0000 ---C 1575.518285 0 0.0001 464 | 7/11
23 h-m-p 0.0160 8.0000 0.0010 -------------.. | 7/11
24 h-m-p 0.0160 8.0000 0.0001 +++++ 1575.518285 m 8.0000 514 | 7/11
25 h-m-p 0.0160 8.0000 0.7934 ----------C 1575.518285 0 0.0000 542 | 7/11
26 h-m-p 0.0160 8.0000 0.0114 +++++ 1575.518271 m 8.0000 563 | 7/11
27 h-m-p 0.1075 8.0000 0.8501 ------------C 1575.518271 0 0.0000 593 | 7/11
28 h-m-p 0.0160 8.0000 0.0002 +++++ 1575.518271 m 8.0000 614 | 7/11
29 h-m-p 0.0160 8.0000 1.4138 -----------C 1575.518271 0 0.0000 643 | 7/11
30 h-m-p 0.0160 8.0000 0.0002 +++++ 1575.518271 m 8.0000 660 | 7/11
31 h-m-p 0.0160 8.0000 1.7749 -----------N 1575.518271 0 0.0000 689 | 7/11
32 h-m-p 0.0160 8.0000 0.0001 +++++ 1575.518271 m 8.0000 706 | 7/11
33 h-m-p 0.0016 0.7758 1.4760 -----------.. | 7/11
34 h-m-p 0.0160 8.0000 0.0002 +++++ 1575.518271 m 8.0000 750 | 7/11
35 h-m-p 0.0059 1.5402 0.2078 +++++ 1575.518210 m 1.5402 771 | 8/11
36 h-m-p 0.3367 8.0000 0.5184 ---------------.. | 8/11
37 h-m-p 0.0160 8.0000 0.0001 +++++ 1575.518210 m 8.0000 822 | 8/11
38 h-m-p 0.0160 8.0000 2.2270 -------------.. | 8/11
39 h-m-p 0.0160 8.0000 0.0001 +++++ 1575.518210 m 8.0000 867 | 8/11
40 h-m-p 0.0045 2.2585 0.2510 +++++ 1575.518131 m 2.2585 887 | 9/11
41 h-m-p 0.1431 8.0000 3.5073 --------------Y 1575.518131 0 0.0000 918 | 9/11
42 h-m-p 0.0160 8.0000 0.0003 +++++ 1575.518131 m 8.0000 935 | 9/11
43 h-m-p 0.0160 8.0000 7.1042 +++++ 1575.517872 m 8.0000 954 | 9/11
44 h-m-p 1.6000 8.0000 0.0000 N 1575.517872 0 1.6000 968 | 9/11
45 h-m-p 0.0160 8.0000 0.0000 N 1575.517872 0 0.0160 984
Out..
lnL = -1575.517872
985 lfun, 3940 eigenQcodon, 17730 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1575.606549 S = -1575.519683 -0.033864
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:08
did 20 / 56 patterns 0:08
did 30 / 56 patterns 0:08
did 40 / 56 patterns 0:08
did 50 / 56 patterns 0:08
did 56 / 56 patterns 0:08
Time used: 0:08
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.040710 0.109421 0.092225 0.086829 0.039271 0.031299 0.000100 0.218703 1.777673
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 29.540373
np = 9
lnL0 = -1716.923232
Iterating by ming2
Initial: fx= 1716.923232
x= 0.04071 0.10942 0.09222 0.08683 0.03927 0.03130 0.00011 0.21870 1.77767
1 h-m-p 0.0000 0.0000 819.5074 ++ 1716.685186 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0168 50.8034 +++++ 1696.646702 m 0.0168 29 | 2/9
3 h-m-p 0.0000 0.0001 1484.8243 ++ 1679.583986 m 0.0001 41 | 3/9
4 h-m-p 0.0000 0.0001 291.8322 ++ 1677.812305 m 0.0001 53 | 4/9
5 h-m-p 0.0000 0.0012 595.0839 +++ 1624.524082 m 0.0012 66 | 5/9
6 h-m-p 0.0002 0.0008 480.4516 ++ 1603.204741 m 0.0008 78 | 6/9
7 h-m-p 0.0000 0.0002 460.7681 ++ 1575.518278 m 0.0002 90 | 7/9
8 h-m-p 1.6000 8.0000 0.0000 ++ 1575.518278 m 8.0000 102 | 7/9
9 h-m-p 0.0160 8.0000 0.0267 -------Y 1575.518278 0 0.0000 123 | 7/9
10 h-m-p 0.0160 8.0000 0.0001 +++++ 1575.518278 m 8.0000 140 | 7/9
11 h-m-p 0.0160 8.0000 0.7540 ---------Y 1575.518278 0 0.0000 163 | 7/9
12 h-m-p 0.0160 8.0000 0.0000 ---Y 1575.518278 0 0.0001 180 | 7/9
13 h-m-p 0.0160 8.0000 0.0001 +++++ 1575.518278 m 8.0000 197 | 7/9
14 h-m-p 0.0160 8.0000 0.4600 ---------C 1575.518278 0 0.0000 220 | 7/9
15 h-m-p 0.0160 8.0000 0.0000 -----C 1575.518278 0 0.0000 239 | 7/9
16 h-m-p 0.0160 8.0000 0.0002 -------------.. | 7/9
17 h-m-p 0.0160 8.0000 0.0001 +++++ 1575.518278 m 8.0000 281 | 7/9
18 h-m-p 0.0016 0.8152 1.1304 ----------N 1575.518278 0 0.0000 305 | 7/9
19 h-m-p 0.0160 8.0000 0.0003 +++++ 1575.518278 m 8.0000 320 | 7/9
20 h-m-p 0.0080 3.9986 0.6136 -----------Y 1575.518278 0 0.0000 345 | 7/9
21 h-m-p 0.0160 8.0000 0.0000 +++++ 1575.518278 m 8.0000 362 | 7/9
22 h-m-p 0.0097 4.8261 0.5106 ---------C 1575.518278 0 0.0000 385 | 7/9
23 h-m-p 0.0160 8.0000 0.0012 -------------.. | 7/9
24 h-m-p 0.0160 8.0000 0.0001 +++++ 1575.518278 m 8.0000 427 | 7/9
25 h-m-p 0.0016 0.7993 1.1570 --------Y 1575.518278 0 0.0000 449 | 7/9
26 h-m-p 0.0160 8.0000 0.0017 +++++ 1575.518277 m 8.0000 464 | 7/9
27 h-m-p 0.0058 0.3471 2.3351 ------------.. | 7/9
28 h-m-p 0.0160 8.0000 0.0001 +++++ 1575.518277 m 8.0000 503 | 7/9
29 h-m-p 0.0157 7.8626 0.1215 -------------.. | 7/9
30 h-m-p 0.0160 8.0000 0.0001 +++++ 1575.518276 m 8.0000 545 | 7/9
31 h-m-p 0.0018 0.8822 1.0787 ---------Y 1575.518276 0 0.0000 568 | 7/9
32 h-m-p 0.0160 8.0000 0.0000 +++++ 1575.518276 m 8.0000 583 | 7/9
33 h-m-p 0.0160 8.0000 0.0061 +++++ 1575.518276 m 8.0000 600 | 7/9
34 h-m-p 0.0842 8.0000 0.5759 --------------.. | 7/9
35 h-m-p 0.0160 8.0000 0.0001 +++++ 1575.518276 m 8.0000 643 | 7/9
36 h-m-p 0.0016 0.7886 1.1726 -----------.. | 7/9
37 h-m-p 0.0160 8.0000 0.0001 +++++ 1575.518276 m 8.0000 681 | 7/9
38 h-m-p 0.0123 6.1744 0.1500 ----------Y 1575.518276 0 0.0000 705 | 7/9
39 h-m-p 0.0160 8.0000 0.0073 +++++ 1575.518269 m 8.0000 722 | 7/9
40 h-m-p 0.0645 1.2138 0.8991 -------------C 1575.518269 0 0.0000 749 | 7/9
41 h-m-p 0.0160 8.0000 0.0000 +++++ 1575.518269 m 8.0000 766 | 7/9
42 h-m-p 0.0086 4.2947 0.7697 -----------Y 1575.518269 0 0.0000 791 | 7/9
43 h-m-p 0.0160 8.0000 0.0000 ---Y 1575.518269 0 0.0001 808 | 7/9
44 h-m-p 0.0160 8.0000 0.0000 +++++ 1575.518269 m 8.0000 825 | 7/9
45 h-m-p 0.0160 8.0000 0.1846 --------C 1575.518269 0 0.0000 847 | 7/9
46 h-m-p 0.0160 8.0000 0.0004 ------Y 1575.518269 0 0.0000 867 | 7/9
47 h-m-p 0.0160 8.0000 0.0000 ----------N 1575.518269 0 0.0000 891
Out..
lnL = -1575.518269
892 lfun, 9812 eigenQcodon, 53520 P(t)
Time used: 0:22
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.021289 0.019842 0.074699 0.092683 0.039245 0.108816 0.000100 0.900000 1.113052 1.579011 1.175884
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.462175
np = 11
lnL0 = -1706.901242
Iterating by ming2
Initial: fx= 1706.901242
x= 0.02129 0.01984 0.07470 0.09268 0.03924 0.10882 0.00011 0.90000 1.11305 1.57901 1.17588
1 h-m-p 0.0000 0.0000 863.7602 ++ 1706.141448 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0012 209.6186 ++++ 1659.601162 m 0.0012 32 | 2/11
3 h-m-p 0.0000 0.0000 845.0860 ++ 1656.860493 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0008 326.6208 +++ 1630.464827 m 0.0008 61 | 4/11
5 h-m-p 0.0000 0.0001 2988.3940 ++ 1594.543818 m 0.0001 75 | 5/11
6 h-m-p 0.0002 0.0008 563.9984 ++ 1580.724181 m 0.0008 89 | 6/11
7 h-m-p 0.0000 0.0002 3185.5298 ++ 1577.991494 m 0.0002 103 | 7/11
8 h-m-p 0.0063 0.0313 43.2024 ------------.. | 7/11
9 h-m-p 0.0000 0.0000 388.7214 ++ 1575.518355 m 0.0000 141 | 8/11
10 h-m-p 0.0690 8.0000 0.0000 ++++ 1575.518355 m 8.0000 157 | 8/11
11 h-m-p 0.0274 8.0000 0.0050 +++++ 1575.518354 m 8.0000 177 | 8/11
12 h-m-p 0.0617 5.8395 0.6514 ----------Y 1575.518354 0 0.0000 204 | 8/11
13 h-m-p 0.0160 8.0000 0.0000 --C 1575.518354 0 0.0003 223 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 1575.518354 m 8.0000 243 | 8/11
15 h-m-p 0.0160 8.0000 0.3086 ---------C 1575.518354 0 0.0000 269 | 8/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 1575.518354 m 8.0000 289 | 8/11
17 h-m-p 0.0091 4.5272 1.3423 +
QuantileBeta(0.15, 0.00500, 2.23529) = 1.170475e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.80752) = 8.854118e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.09645) = 4.472424e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
+ 1575.518300 m 4.5272 309
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.838705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742948e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
| 9/11
18 h-m-p 0.0041 0.0206 616.0326
QuantileBeta(0.15, 0.00500, 10.53645) = 2.052027e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.63809) = 2.530011e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.16350) = 2.686426e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.04485) = 2.728597e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.01519) = 2.739347e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00777) = 2.742048e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00592) = 2.742724e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00546) = 2.742893e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00534) = 2.742935e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00531) = 2.742946e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742948e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.838705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742948e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
| 9/11
19 h-m-p 0.0160 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
+ 1575.518300 m 8.0000 350
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.838705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00554) = 2.742860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00506) = 2.743038e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
| 9/11
20 h-m-p 0.0094 2.1862 0.1536
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
N 1575.518300 0 0.0000 378
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.838705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00554) = 2.742860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00506) = 2.743038e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
| 9/11
21 h-m-p 0.0007 0.3332 1.9936
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
+ 1575.517872 m 0.3332 397
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.838705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742948e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
| 10/11
22 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
N 1575.517872 0 0.0160 411
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.838705e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00554) = 2.742860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00506) = 2.743038e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
| 10/11
23 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
N 1575.517872 0 0.0160 426
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
Out..
lnL = -1575.517872
427 lfun, 5124 eigenQcodon, 28182 P(t)
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1575.632205 S = -1575.519683 -0.050703
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:29
did 20 / 56 patterns 0:30
did 30 / 56 patterns 0:30
did 40 / 56 patterns 0:30
did 50 / 56 patterns 0:30
did 56 / 56 patterns 0:30
QuantileBeta(0.15, 0.00500, 8.00530) = 2.742949e-161 2000 rounds
Time used: 0:30
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/1res/argG/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 398
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 6 6 6 6 6 6 | Cys TGT 1 1 1 1 1 1
TTC 10 10 10 10 10 10 | TCC 5 5 5 5 5 5 | TAC 8 8 8 8 8 8 | TGC 2 2 2 2 2 2
Leu TTA 3 3 3 3 3 3 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 10 10 10 10 10 10 | TCG 8 8 8 8 8 8 | TAG 0 0 0 0 0 0 | Trp TGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 3 3 3 3 3 3 | Arg CGT 9 9 9 9 9 9
CTC 7 7 7 7 7 7 | CCC 5 5 5 5 5 5 | CAC 9 9 9 9 9 9 | CGC 8 8 8 8 8 8
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 5 5 5 5 5 5 | CGA 5 5 5 5 5 5
CTG 12 12 12 12 12 12 | CCG 10 10 10 10 10 10 | CAG 4 4 4 4 4 4 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 6 6 6 6 6 6 | Thr ACT 3 3 3 3 3 3 | Asn AAT 5 5 5 5 5 5 | Ser AGT 2 2 2 2 2 2
ATC 15 15 15 15 15 15 | ACC 12 12 12 12 12 12 | AAC 7 7 7 7 7 7 | AGC 5 5 5 5 5 5
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 6 6 6 6 6 6 | ACG 3 3 3 3 3 3 | AAG 8 8 8 8 8 8 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 9 9 9 9 9 9 | Ala GCT 9 9 9 9 9 9 | Asp GAT 10 10 10 10 10 10 | Gly GGT 6 6 6 6 6 6
GTC 15 15 15 15 15 15 | GCC 10 10 10 10 10 10 | GAC 14 14 14 14 14 14 | GGC 15 15 15 15 15 15
GTA 2 2 2 2 2 2 | GCA 11 11 11 11 11 11 | Glu GAA 14 14 14 14 14 14 | GGA 7 7 7 7 7 7
GTG 15 15 15 15 15 15 | GCG 14 14 14 14 14 14 | GAG 17 17 17 17 17 17 | GGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908326_1_1491_MLBR_RS07055
position 1: T:0.15578 C:0.21106 A:0.19598 G:0.43719
position 2: T:0.28643 C:0.23116 A:0.28141 G:0.20101
position 3: T:0.18090 C:0.36935 A:0.13065 G:0.31910
Average T:0.20771 C:0.27052 A:0.20268 G:0.31910
#2: NC_002677_1_NP_302005_1_877_argG
position 1: T:0.15578 C:0.21106 A:0.19598 G:0.43719
position 2: T:0.28643 C:0.23116 A:0.28141 G:0.20101
position 3: T:0.18090 C:0.36935 A:0.13065 G:0.31910
Average T:0.20771 C:0.27052 A:0.20268 G:0.31910
#3: NZ_LVXE01000004_1_WP_010908326_1_1774_A3216_RS03005
position 1: T:0.15578 C:0.21106 A:0.19598 G:0.43719
position 2: T:0.28643 C:0.23116 A:0.28141 G:0.20101
position 3: T:0.18090 C:0.36935 A:0.13065 G:0.31910
Average T:0.20771 C:0.27052 A:0.20268 G:0.31910
#4: NZ_LYPH01000077_1_WP_010908326_1_2607_A8144_RS12555
position 1: T:0.15578 C:0.21106 A:0.19598 G:0.43719
position 2: T:0.28643 C:0.23116 A:0.28141 G:0.20101
position 3: T:0.18090 C:0.36935 A:0.13065 G:0.31910
Average T:0.20771 C:0.27052 A:0.20268 G:0.31910
#5: NZ_CP029543_1_WP_041322778_1_1513_DIJ64_RS07705
position 1: T:0.15578 C:0.21106 A:0.19598 G:0.43719
position 2: T:0.28643 C:0.23116 A:0.28141 G:0.20101
position 3: T:0.18090 C:0.36935 A:0.13065 G:0.31910
Average T:0.20771 C:0.27052 A:0.20268 G:0.31910
#6: NZ_AP014567_1_WP_041322778_1_1549_JK2ML_RS07885
position 1: T:0.15578 C:0.21106 A:0.19598 G:0.43719
position 2: T:0.28643 C:0.23116 A:0.28141 G:0.20101
position 3: T:0.18090 C:0.36935 A:0.13065 G:0.31910
Average T:0.20771 C:0.27052 A:0.20268 G:0.31910
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 36 | Cys C TGT 6
TTC 60 | TCC 30 | TAC 48 | TGC 12
Leu L TTA 18 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 60 | TCG 48 | TAG 0 | Trp W TGG 42
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 18 | Arg R CGT 54
CTC 42 | CCC 30 | CAC 54 | CGC 48
CTA 6 | CCA 0 | Gln Q CAA 30 | CGA 30
CTG 72 | CCG 60 | CAG 24 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 36 | Thr T ACT 18 | Asn N AAT 30 | Ser S AGT 12
ATC 90 | ACC 72 | AAC 42 | AGC 30
ATA 6 | ACA 6 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 36 | ACG 18 | AAG 48 | AGG 12
------------------------------------------------------------------------------
Val V GTT 54 | Ala A GCT 54 | Asp D GAT 60 | Gly G GGT 36
GTC 90 | GCC 60 | GAC 84 | GGC 90
GTA 12 | GCA 66 | Glu E GAA 84 | GGA 42
GTG 90 | GCG 84 | GAG 102 | GGG 36
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15578 C:0.21106 A:0.19598 G:0.43719
position 2: T:0.28643 C:0.23116 A:0.28141 G:0.20101
position 3: T:0.18090 C:0.36935 A:0.13065 G:0.31910
Average T:0.20771 C:0.27052 A:0.20268 G:0.31910
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1575.518371 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.637851 1.175884
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908326_1_1491_MLBR_RS07055: 0.000004, NC_002677_1_NP_302005_1_877_argG: 0.000004, NZ_LVXE01000004_1_WP_010908326_1_1774_A3216_RS03005: 0.000004, NZ_LYPH01000077_1_WP_010908326_1_2607_A8144_RS12555: 0.000004, NZ_CP029543_1_WP_041322778_1_1513_DIJ64_RS07705: 0.000004, NZ_AP014567_1_WP_041322778_1_1549_JK2ML_RS07885: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.63785
omega (dN/dS) = 1.17588
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 917.0 277.0 1.1759 0.0000 0.0000 0.0 0.0
7..2 0.000 917.0 277.0 1.1759 0.0000 0.0000 0.0 0.0
7..3 0.000 917.0 277.0 1.1759 0.0000 0.0000 0.0 0.0
7..4 0.000 917.0 277.0 1.1759 0.0000 0.0000 0.0 0.0
7..5 0.000 917.0 277.0 1.1759 0.0000 0.0000 0.0 0.0
7..6 0.000 917.0 277.0 1.1759 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1575.518138 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.491560 0.974416 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908326_1_1491_MLBR_RS07055: 0.000004, NC_002677_1_NP_302005_1_877_argG: 0.000004, NZ_LVXE01000004_1_WP_010908326_1_1774_A3216_RS03005: 0.000004, NZ_LYPH01000077_1_WP_010908326_1_2607_A8144_RS12555: 0.000004, NZ_CP029543_1_WP_041322778_1_1513_DIJ64_RS07705: 0.000004, NZ_AP014567_1_WP_041322778_1_1549_JK2ML_RS07885: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.49156
MLEs of dN/dS (w) for site classes (K=2)
p: 0.97442 0.02558
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 922.3 271.7 0.0256 0.0000 0.0000 0.0 0.0
7..2 0.000 922.3 271.7 0.0256 0.0000 0.0000 0.0 0.0
7..3 0.000 922.3 271.7 0.0256 0.0000 0.0000 0.0 0.0
7..4 0.000 922.3 271.7 0.0256 0.0000 0.0000 0.0 0.0
7..5 0.000 922.3 271.7 0.0256 0.0000 0.0000 0.0 0.0
7..6 0.000 922.3 271.7 0.0256 0.0000 0.0000 0.0 0.0
Time used: 0:04
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1575.517872 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908326_1_1491_MLBR_RS07055: 0.000004, NC_002677_1_NP_302005_1_877_argG: 0.000004, NZ_LVXE01000004_1_WP_010908326_1_1774_A3216_RS03005: 0.000004, NZ_LYPH01000077_1_WP_010908326_1_2607_A8144_RS12555: 0.000004, NZ_CP029543_1_WP_041322778_1_1513_DIJ64_RS07705: 0.000004, NZ_AP014567_1_WP_041322778_1_1549_JK2ML_RS07885: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 945.7 248.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 945.7 248.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 945.7 248.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 945.7 248.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 945.7 248.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 945.7 248.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908326_1_1491_MLBR_RS07055)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
w2: 0.105 0.104 0.103 0.102 0.101 0.099 0.098 0.097 0.096 0.095
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.011
0.010 0.010 0.010 0.010 0.011
0.010 0.010 0.010 0.010 0.010 0.010 0.011
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011
0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011
0.009 0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011
0.009 0.009 0.009 0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011
sum of density on p0-p1 = 1.000000
Time used: 0:08
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1575.518269 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.832598 0.759938
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908326_1_1491_MLBR_RS07055: 0.000004, NC_002677_1_NP_302005_1_877_argG: 0.000004, NZ_LVXE01000004_1_WP_010908326_1_1774_A3216_RS03005: 0.000004, NZ_LYPH01000077_1_WP_010908326_1_2607_A8144_RS12555: 0.000004, NZ_CP029543_1_WP_041322778_1_1513_DIJ64_RS07705: 0.000004, NZ_AP014567_1_WP_041322778_1_1549_JK2ML_RS07885: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.83260 q = 0.75994
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.03655 0.13490 0.24504 0.36006 0.47636 0.59124 0.70219 0.80643 0.90018 0.97630
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 945.7 248.3 0.5229 0.0000 0.0000 0.0 0.0
7..2 0.000 945.7 248.3 0.5229 0.0000 0.0000 0.0 0.0
7..3 0.000 945.7 248.3 0.5229 0.0000 0.0000 0.0 0.0
7..4 0.000 945.7 248.3 0.5229 0.0000 0.0000 0.0 0.0
7..5 0.000 945.7 248.3 0.5229 0.0000 0.0000 0.0 0.0
7..6 0.000 945.7 248.3 0.5229 0.0000 0.0000 0.0 0.0
Time used: 0:22
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1575.517872 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 8.005301 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908326_1_1491_MLBR_RS07055: 0.000004, NC_002677_1_NP_302005_1_877_argG: 0.000004, NZ_LVXE01000004_1_WP_010908326_1_1774_A3216_RS03005: 0.000004, NZ_LYPH01000077_1_WP_010908326_1_2607_A8144_RS12555: 0.000004, NZ_CP029543_1_WP_041322778_1_1513_DIJ64_RS07705: 0.000004, NZ_AP014567_1_WP_041322778_1_1549_JK2ML_RS07885: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 8.00530
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 945.7 248.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 945.7 248.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 945.7 248.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 945.7 248.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 945.7 248.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 945.7 248.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908326_1_1491_MLBR_RS07055)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.092 0.093 0.095 0.097 0.099 0.101 0.103 0.105 0.107 0.109
p : 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.108 0.106 0.104 0.102 0.101 0.099 0.097 0.096 0.094 0.092
Time used: 0:30