--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 09:50:32 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/argJ/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1654.87         -1658.34
2      -1654.84         -1658.49
--------------------------------------
TOTAL    -1654.85         -1658.42
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.889681    0.091695    0.389242    1.542722    0.850085   1219.54   1360.27    1.000
r(A<->C){all}   0.152530    0.016973    0.000003    0.412429    0.119664    237.50    313.49    1.003
r(A<->G){all}   0.157362    0.019032    0.000071    0.452048    0.115957    172.84    235.17    1.006
r(A<->T){all}   0.168736    0.020781    0.000238    0.461045    0.130486    138.06    199.75    1.004
r(C<->G){all}   0.163163    0.019469    0.000004    0.443007    0.126294    205.02    234.54    1.009
r(C<->T){all}   0.169643    0.020161    0.000006    0.455073    0.132258    257.78    296.88    1.000
r(G<->T){all}   0.188566    0.023112    0.000134    0.487209    0.153423    246.35    250.11    1.010
pi(A){all}      0.184447    0.000120    0.163761    0.206430    0.184279    979.76   1172.11    1.000
pi(C){all}      0.312679    0.000182    0.286489    0.338848    0.312443   1243.43   1276.71    1.000
pi(G){all}      0.313480    0.000174    0.286628    0.338104    0.313384   1208.35   1292.00    1.000
pi(T){all}      0.189395    0.000127    0.168177    0.211697    0.189077   1187.56   1344.28    1.000
alpha{1,2}      0.431072    0.250555    0.000156    1.442221    0.248825    979.73   1240.36    1.000
alpha{3}        0.455859    0.229197    0.000266    1.436078    0.303634   1350.60   1390.80    1.000
pinvar{all}     0.998762    0.000002    0.996078    0.999999    0.999253   1172.27   1181.39    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1580.964085
Model 2: PositiveSelection	-1580.964087
Model 0: one-ratio	-1580.964097
Model 7: beta	-1580.96408
Model 8: beta&w>1	-1580.964073


Model 0 vs 1	2.3999999939405825E-5

Model 2 vs 1	3.999999989900971E-6

Model 8 vs 7	1.3999999737279722E-5
>C1
VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
ENSAYSS
>C2
VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
ENSAYSS
>C3
VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
ENSAYSS
>C4
VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
ENSAYSS
>C5
VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
ENSAYSS
>C6
VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
ENSAYSS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=407 

C1              VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
C2              VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
C3              VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
C4              VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
C5              VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
C6              VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
                **************************************************

C1              DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
C2              DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
C3              DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
C4              DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
C5              DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
C6              DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
                **************************************************

C1              DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
C2              DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
C3              DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
C4              DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
C5              DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
C6              DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
                **************************************************

C1              HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
C2              HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
C3              HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
C4              HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
C5              HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
C6              HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
                **************************************************

C1              LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
C2              LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
C3              LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
C4              LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
C5              LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
C6              LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
                **************************************************

C1              SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
C2              SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
C3              SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
C4              SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
C5              SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
C6              SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
                **************************************************

C1              DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
C2              DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
C3              DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
C4              DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
C5              DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
C6              DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
                **************************************************

C1              GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
C2              GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
C3              GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
C4              GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
C5              GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
C6              GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
                **************************************************

C1              ENSAYSS
C2              ENSAYSS
C3              ENSAYSS
C4              ENSAYSS
C5              ENSAYSS
C6              ENSAYSS
                *******




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  407 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  407 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12210]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [12210]--->[12210]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.535 Mb, Max= 30.989 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
C2              VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
C3              VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
C4              VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
C5              VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
C6              VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
                **************************************************

C1              DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
C2              DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
C3              DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
C4              DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
C5              DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
C6              DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
                **************************************************

C1              DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
C2              DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
C3              DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
C4              DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
C5              DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
C6              DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
                **************************************************

C1              HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
C2              HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
C3              HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
C4              HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
C5              HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
C6              HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
                **************************************************

C1              LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
C2              LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
C3              LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
C4              LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
C5              LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
C6              LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
                **************************************************

C1              SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
C2              SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
C3              SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
C4              SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
C5              SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
C6              SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
                **************************************************

C1              DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
C2              DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
C3              DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
C4              DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
C5              DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
C6              DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
                **************************************************

C1              GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
C2              GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
C3              GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
C4              GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
C5              GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
C6              GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
                **************************************************

C1              ENSAYSS
C2              ENSAYSS
C3              ENSAYSS
C4              ENSAYSS
C5              ENSAYSS
C6              ENSAYSS
                *******




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA
C2              GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA
C3              GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA
C4              GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA
C5              GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA
C6              GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA
                **************************************************

C1              GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA
C2              GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA
C3              GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA
C4              GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA
C5              GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA
C6              GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA
                **************************************************

C1              TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC
C2              TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC
C3              TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC
C4              TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC
C5              TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC
C6              TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC
                **************************************************

C1              GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC
C2              GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC
C3              GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC
C4              GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC
C5              GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC
C6              GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC
                **************************************************

C1              GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA
C2              GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA
C3              GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA
C4              GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA
C5              GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA
C6              GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA
                **************************************************

C1              TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG
C2              TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG
C3              TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG
C4              TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG
C5              TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG
C6              TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG
                **************************************************

C1              GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG
C2              GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG
C3              GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG
C4              GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG
C5              GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG
C6              GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG
                **************************************************

C1              AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG
C2              AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG
C3              AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG
C4              AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG
C5              AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG
C6              AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG
                **************************************************

C1              GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG
C2              GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG
C3              GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG
C4              GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG
C5              GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG
C6              GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG
                **************************************************

C1              CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT
C2              CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT
C3              CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT
C4              CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT
C5              CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT
C6              CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT
                **************************************************

C1              CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA
C2              CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA
C3              CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA
C4              CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA
C5              CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA
C6              CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA
                **************************************************

C1              AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG
C2              AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG
C3              AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG
C4              AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG
C5              AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG
C6              AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG
                **************************************************

C1              CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC
C2              CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC
C3              CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC
C4              CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC
C5              CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC
C6              CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC
                **************************************************

C1              GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC
C2              GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC
C3              GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC
C4              GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC
C5              GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC
C6              GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC
                **************************************************

C1              TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA
C2              TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA
C3              TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA
C4              TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA
C5              TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA
C6              TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA
                **************************************************

C1              TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT
C2              TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT
C3              TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT
C4              TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT
C5              TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT
C6              TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT
                **************************************************

C1              ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG
C2              ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG
C3              ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG
C4              ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG
C5              ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG
C6              ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG
                **************************************************

C1              GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC
C2              GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC
C3              GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC
C4              GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC
C5              GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC
C6              GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC
                **************************************************

C1              GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC
C2              GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC
C3              GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC
C4              GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC
C5              GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC
C6              GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC
                **************************************************

C1              CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG
C2              CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG
C3              CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG
C4              CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG
C5              CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG
C6              CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG
                **************************************************

C1              GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC
C2              GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC
C3              GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC
C4              GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC
C5              GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC
C6              GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC
                **************************************************

C1              GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT
C2              GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT
C3              GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT
C4              GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT
C5              GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT
C6              GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT
                **************************************************

C1              GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG
C2              GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG
C3              GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG
C4              GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG
C5              GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG
C6              GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG
                **************************************************

C1              ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA
C2              ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA
C3              ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA
C4              ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA
C5              ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA
C6              ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA
                **************************************************

C1              GAGAATTCGGCCTACAGTTCG
C2              GAGAATTCGGCCTACAGTTCG
C3              GAGAATTCGGCCTACAGTTCG
C4              GAGAATTCGGCCTACAGTTCG
C5              GAGAATTCGGCCTACAGTTCG
C6              GAGAATTCGGCCTACAGTTCG
                *********************



>C1
GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA
GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA
TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC
GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC
GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA
TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG
GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG
AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG
GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG
CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT
CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA
AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG
CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC
GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC
TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA
TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT
ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG
GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC
GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC
CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG
GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC
GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT
GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG
ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA
GAGAATTCGGCCTACAGTTCG
>C2
GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA
GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA
TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC
GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC
GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA
TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG
GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG
AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG
GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG
CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT
CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA
AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG
CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC
GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC
TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA
TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT
ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG
GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC
GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC
CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG
GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC
GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT
GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG
ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA
GAGAATTCGGCCTACAGTTCG
>C3
GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA
GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA
TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC
GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC
GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA
TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG
GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG
AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG
GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG
CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT
CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA
AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG
CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC
GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC
TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA
TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT
ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG
GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC
GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC
CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG
GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC
GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT
GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG
ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA
GAGAATTCGGCCTACAGTTCG
>C4
GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA
GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA
TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC
GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC
GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA
TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG
GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG
AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG
GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG
CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT
CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA
AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG
CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC
GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC
TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA
TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT
ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG
GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC
GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC
CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG
GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC
GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT
GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG
ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA
GAGAATTCGGCCTACAGTTCG
>C5
GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA
GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA
TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC
GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC
GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA
TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG
GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG
AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG
GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG
CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT
CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA
AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG
CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC
GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC
TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA
TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT
ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG
GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC
GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC
CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG
GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC
GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT
GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG
ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA
GAGAATTCGGCCTACAGTTCG
>C6
GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA
GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA
TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC
GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC
GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA
TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG
GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG
AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG
GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG
CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT
CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA
AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG
CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC
GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC
TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA
TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT
ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG
GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC
GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC
CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG
GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC
GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT
GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG
ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA
GAGAATTCGGCCTACAGTTCG
>C1
VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
ENSAYSS
>C2
VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
ENSAYSS
>C3
VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
ENSAYSS
>C4
VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
ENSAYSS
>C5
VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
ENSAYSS
>C6
VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP
DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ
DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV
HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS
LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA
SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD
DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN
GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE
ENSAYSS


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1221 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579772956
      Setting output file names to "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1388241175
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 8446504401
      Seed = 2011405613
      Swapseed = 1579772956
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2732.656380 -- -24.965149
         Chain 2 -- -2732.656537 -- -24.965149
         Chain 3 -- -2732.656537 -- -24.965149
         Chain 4 -- -2732.656537 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2732.656537 -- -24.965149
         Chain 2 -- -2732.656537 -- -24.965149
         Chain 3 -- -2732.656537 -- -24.965149
         Chain 4 -- -2732.656537 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2732.656] (-2732.657) (-2732.657) (-2732.657) * [-2732.657] (-2732.657) (-2732.657) (-2732.657) 
        500 -- (-1675.446) (-1671.942) (-1704.055) [-1663.165] * (-1681.809) (-1698.936) [-1674.259] (-1689.580) -- 0:00:00
       1000 -- [-1666.416] (-1667.094) (-1680.554) (-1665.810) * (-1667.642) (-1683.535) [-1663.324] (-1668.913) -- 0:00:00
       1500 -- (-1659.248) (-1660.936) (-1671.446) [-1664.373] * (-1659.624) (-1670.430) [-1664.011] (-1674.232) -- 0:00:00
       2000 -- (-1668.241) (-1670.226) [-1661.955] (-1671.894) * (-1669.408) (-1661.231) (-1668.694) [-1665.729] -- 0:00:00
       2500 -- [-1663.070] (-1673.678) (-1662.403) (-1669.639) * [-1658.453] (-1669.676) (-1660.489) (-1662.179) -- 0:00:00
       3000 -- (-1666.104) (-1664.902) (-1667.806) [-1659.541] * (-1665.068) (-1667.616) (-1662.893) [-1663.514] -- 0:05:32
       3500 -- (-1664.913) [-1664.545] (-1660.795) (-1660.305) * (-1665.485) (-1664.839) [-1660.705] (-1662.979) -- 0:04:44
       4000 -- (-1667.066) (-1663.208) (-1661.811) [-1662.940] * (-1661.645) (-1668.231) [-1665.597] (-1659.166) -- 0:04:09
       4500 -- (-1672.107) (-1668.278) [-1663.388] (-1658.767) * [-1659.741] (-1662.747) (-1664.714) (-1664.422) -- 0:03:41
       5000 -- (-1674.936) (-1659.708) [-1658.304] (-1667.699) * (-1674.136) (-1654.983) (-1662.972) [-1661.927] -- 0:03:19

      Average standard deviation of split frequencies: 0.087996

       5500 -- (-1665.223) (-1665.533) [-1665.984] (-1672.131) * (-1661.758) [-1655.041] (-1668.919) (-1676.857) -- 0:03:00
       6000 -- [-1660.963] (-1666.828) (-1670.591) (-1671.413) * [-1658.851] (-1654.349) (-1665.243) (-1664.596) -- 0:02:45
       6500 -- (-1665.737) [-1663.689] (-1665.045) (-1670.977) * (-1665.837) [-1654.225] (-1670.493) (-1663.324) -- 0:02:32
       7000 -- (-1668.532) [-1672.201] (-1667.381) (-1665.511) * (-1659.955) (-1654.199) (-1661.972) [-1660.547] -- 0:02:21
       7500 -- (-1667.032) [-1677.098] (-1669.744) (-1661.670) * (-1664.789) (-1657.118) [-1660.275] (-1670.359) -- 0:02:12
       8000 -- (-1673.048) [-1663.534] (-1657.918) (-1669.697) * (-1669.600) (-1654.320) [-1656.421] (-1670.755) -- 0:02:04
       8500 -- (-1666.677) (-1662.708) (-1656.470) [-1660.280] * (-1670.675) (-1654.187) [-1662.475] (-1665.501) -- 0:01:56
       9000 -- (-1668.414) (-1661.831) [-1656.757] (-1661.283) * (-1674.802) (-1656.162) [-1657.702] (-1669.112) -- 0:01:50
       9500 -- (-1660.551) (-1667.059) [-1655.391] (-1662.299) * [-1667.665] (-1656.042) (-1662.127) (-1668.241) -- 0:01:44
      10000 -- (-1660.934) (-1667.230) (-1656.537) [-1667.683] * (-1657.835) [-1654.580] (-1661.514) (-1675.924) -- 0:01:39

      Average standard deviation of split frequencies: 0.068300

      10500 -- (-1657.701) (-1667.483) [-1654.671] (-1664.271) * [-1659.194] (-1654.253) (-1678.850) (-1671.352) -- 0:01:34
      11000 -- (-1660.102) (-1666.705) [-1655.291] (-1671.479) * (-1665.786) [-1655.601] (-1662.231) (-1662.497) -- 0:01:29
      11500 -- (-1657.052) [-1662.395] (-1658.777) (-1664.914) * (-1668.214) (-1655.527) [-1666.196] (-1672.538) -- 0:01:25
      12000 -- (-1656.715) (-1660.174) (-1658.784) [-1663.028] * (-1662.468) (-1654.280) (-1660.933) [-1669.179] -- 0:01:22
      12500 -- (-1656.625) (-1665.791) [-1657.324] (-1662.686) * (-1662.311) (-1656.374) (-1665.640) [-1671.165] -- 0:01:19
      13000 -- [-1658.388] (-1664.911) (-1659.049) (-1661.069) * (-1659.948) (-1654.852) (-1663.924) [-1664.433] -- 0:01:15
      13500 -- (-1658.503) [-1658.269] (-1656.628) (-1665.712) * (-1665.238) (-1654.400) [-1663.943] (-1667.203) -- 0:01:13
      14000 -- [-1656.536] (-1664.165) (-1658.066) (-1666.096) * (-1670.454) [-1653.885] (-1662.638) (-1666.850) -- 0:01:10
      14500 -- (-1656.869) [-1663.298] (-1657.925) (-1673.232) * (-1666.769) [-1655.202] (-1669.349) (-1664.758) -- 0:01:07
      15000 -- (-1659.897) (-1678.528) [-1656.616] (-1670.054) * (-1663.435) (-1656.741) (-1679.068) [-1663.756] -- 0:01:05

      Average standard deviation of split frequencies: 0.047702

      15500 -- (-1656.675) [-1659.840] (-1655.465) (-1660.240) * (-1663.508) [-1657.132] (-1668.043) (-1666.847) -- 0:01:03
      16000 -- (-1661.399) [-1657.773] (-1656.152) (-1664.762) * (-1665.969) (-1655.805) (-1662.658) [-1665.889] -- 0:01:01
      16500 -- (-1658.838) [-1661.673] (-1656.362) (-1668.844) * (-1672.075) [-1657.002] (-1669.993) (-1673.454) -- 0:00:59
      17000 -- [-1654.716] (-1661.737) (-1654.312) (-1663.719) * (-1663.924) [-1654.847] (-1661.678) (-1667.438) -- 0:00:57
      17500 -- (-1657.306) (-1657.399) (-1654.176) [-1666.205] * [-1665.422] (-1656.923) (-1671.286) (-1668.398) -- 0:00:56
      18000 -- [-1653.489] (-1665.840) (-1654.175) (-1666.472) * (-1667.993) (-1657.075) [-1662.714] (-1672.501) -- 0:00:54
      18500 -- (-1654.499) (-1666.325) (-1654.141) [-1668.622] * [-1678.473] (-1658.319) (-1662.056) (-1671.849) -- 0:01:46
      19000 -- (-1654.714) [-1659.391] (-1654.418) (-1667.055) * (-1659.039) [-1655.852] (-1669.874) (-1663.151) -- 0:01:43
      19500 -- [-1656.480] (-1671.524) (-1654.418) (-1661.994) * (-1661.569) [-1656.045] (-1669.240) (-1659.648) -- 0:01:40
      20000 -- (-1661.356) [-1661.437] (-1655.657) (-1660.310) * (-1664.783) (-1656.922) [-1664.837] (-1658.474) -- 0:01:38

      Average standard deviation of split frequencies: 0.052463

      20500 -- [-1655.125] (-1664.084) (-1655.620) (-1666.607) * (-1664.302) [-1657.616] (-1666.375) (-1666.566) -- 0:01:35
      21000 -- (-1655.657) (-1666.256) [-1655.923] (-1666.213) * (-1663.141) (-1657.683) (-1664.505) [-1662.203] -- 0:01:33
      21500 -- (-1655.505) [-1661.564] (-1660.240) (-1663.252) * (-1666.623) (-1659.151) (-1664.423) [-1659.969] -- 0:01:31
      22000 -- (-1656.597) (-1667.114) [-1656.376] (-1665.602) * [-1662.102] (-1655.056) (-1655.726) (-1666.590) -- 0:01:28
      22500 -- (-1655.105) [-1663.249] (-1656.131) (-1665.943) * (-1665.026) (-1654.221) [-1656.638] (-1664.495) -- 0:01:26
      23000 -- [-1655.145] (-1668.583) (-1657.672) (-1668.459) * (-1668.568) (-1656.447) [-1655.456] (-1664.004) -- 0:01:24
      23500 -- (-1655.595) (-1664.702) [-1656.404] (-1661.289) * [-1670.333] (-1655.175) (-1657.491) (-1670.533) -- 0:01:23
      24000 -- (-1656.491) [-1668.102] (-1654.631) (-1660.743) * (-1669.782) (-1655.353) [-1653.592] (-1675.257) -- 0:01:21
      24500 -- (-1655.549) (-1662.227) (-1654.933) [-1660.961] * (-1663.916) [-1655.126] (-1653.779) (-1661.551) -- 0:01:19
      25000 -- (-1656.754) [-1654.997] (-1655.702) (-1662.731) * (-1666.345) (-1654.764) [-1654.688] (-1672.076) -- 0:01:18

      Average standard deviation of split frequencies: 0.037838

      25500 -- (-1653.808) (-1654.681) [-1655.989] (-1671.497) * (-1661.849) (-1655.234) (-1653.684) [-1663.722] -- 0:01:16
      26000 -- (-1654.618) (-1655.933) (-1655.886) [-1657.552] * [-1661.519] (-1654.856) (-1656.013) (-1664.035) -- 0:01:14
      26500 -- (-1656.521) (-1654.403) [-1654.366] (-1661.837) * (-1667.130) [-1655.734] (-1655.397) (-1668.632) -- 0:01:13
      27000 -- (-1654.399) [-1655.043] (-1657.807) (-1668.691) * (-1662.208) [-1654.931] (-1656.233) (-1666.749) -- 0:01:12
      27500 -- [-1657.528] (-1654.983) (-1660.025) (-1667.026) * [-1666.162] (-1654.786) (-1656.436) (-1663.931) -- 0:01:10
      28000 -- (-1654.905) (-1656.283) (-1657.124) [-1663.744] * (-1667.068) [-1655.562] (-1656.655) (-1661.035) -- 0:01:09
      28500 -- (-1654.649) (-1655.653) (-1655.342) [-1660.402] * (-1664.009) (-1655.076) (-1653.814) [-1671.112] -- 0:01:08
      29000 -- [-1658.630] (-1656.885) (-1655.577) (-1668.972) * [-1658.454] (-1658.406) (-1655.199) (-1667.071) -- 0:01:06
      29500 -- (-1657.560) (-1656.342) [-1654.688] (-1669.146) * (-1672.533) (-1656.569) (-1655.252) [-1665.572] -- 0:01:05
      30000 -- (-1657.312) (-1657.620) [-1655.216] (-1669.102) * [-1663.501] (-1656.569) (-1655.256) (-1663.447) -- 0:01:04

      Average standard deviation of split frequencies: 0.029280

      30500 -- (-1657.812) (-1655.100) [-1654.595] (-1666.121) * (-1665.428) (-1656.230) (-1657.967) [-1657.679] -- 0:01:03
      31000 -- (-1656.761) (-1654.149) [-1654.268] (-1662.428) * (-1674.881) [-1656.327] (-1657.437) (-1660.739) -- 0:01:02
      31500 -- (-1658.117) [-1654.283] (-1654.061) (-1666.550) * [-1669.545] (-1656.569) (-1655.078) (-1670.600) -- 0:01:01
      32000 -- (-1653.971) (-1654.409) [-1655.324] (-1670.571) * (-1675.321) [-1656.127] (-1657.451) (-1666.859) -- 0:01:00
      32500 -- [-1655.493] (-1655.759) (-1654.767) (-1663.599) * (-1665.739) [-1655.318] (-1655.960) (-1659.047) -- 0:00:59
      33000 -- (-1656.901) (-1655.706) [-1658.648] (-1665.282) * (-1678.713) [-1654.447] (-1658.451) (-1663.285) -- 0:00:58
      33500 -- (-1655.583) (-1654.474) [-1654.735] (-1661.610) * (-1662.871) [-1656.171] (-1660.260) (-1672.814) -- 0:01:26
      34000 -- (-1656.398) (-1654.649) (-1656.135) [-1660.225] * (-1657.159) (-1657.942) (-1656.429) [-1658.573] -- 0:01:25
      34500 -- (-1655.232) (-1653.693) (-1658.484) [-1659.353] * [-1656.354] (-1657.581) (-1660.381) (-1661.383) -- 0:01:23
      35000 -- (-1656.303) (-1655.854) (-1662.366) [-1660.719] * [-1656.521] (-1654.588) (-1657.898) (-1666.257) -- 0:01:22

      Average standard deviation of split frequencies: 0.038037

      35500 -- (-1654.681) [-1656.033] (-1657.194) (-1669.861) * (-1657.149) (-1654.726) [-1657.023] (-1671.465) -- 0:01:21
      36000 -- (-1654.943) (-1653.419) [-1654.956] (-1661.695) * [-1658.256] (-1654.829) (-1657.005) (-1664.525) -- 0:01:20
      36500 -- (-1657.279) [-1653.595] (-1656.327) (-1662.001) * (-1662.418) (-1662.545) (-1657.353) [-1661.727] -- 0:01:19
      37000 -- (-1656.150) [-1653.894] (-1655.473) (-1662.731) * (-1658.427) (-1658.029) (-1654.256) [-1665.853] -- 0:01:18
      37500 -- (-1659.028) (-1656.763) (-1654.597) [-1665.092] * [-1659.576] (-1654.629) (-1656.129) (-1661.967) -- 0:01:17
      38000 -- (-1654.559) (-1654.009) [-1653.370] (-1666.730) * (-1657.020) (-1656.981) (-1657.398) [-1660.109] -- 0:01:15
      38500 -- (-1655.603) (-1654.092) (-1655.596) [-1667.782] * (-1656.452) (-1656.604) [-1655.233] (-1663.453) -- 0:01:14
      39000 -- (-1657.596) [-1655.291] (-1654.220) (-1663.952) * [-1657.733] (-1655.772) (-1656.046) (-1668.889) -- 0:01:13
      39500 -- (-1655.836) (-1655.384) (-1655.003) [-1662.743] * (-1657.668) (-1653.945) [-1656.218] (-1671.424) -- 0:01:12
      40000 -- (-1657.060) (-1655.427) (-1657.792) [-1666.706] * (-1658.120) [-1654.327] (-1655.947) (-1664.207) -- 0:01:12

      Average standard deviation of split frequencies: 0.036139

      40500 -- (-1655.677) (-1656.594) [-1655.445] (-1670.706) * (-1653.651) (-1655.567) (-1657.572) [-1664.510] -- 0:01:11
      41000 -- (-1654.335) [-1653.577] (-1656.463) (-1662.585) * (-1656.011) [-1659.510] (-1656.152) (-1663.571) -- 0:01:10
      41500 -- (-1654.145) [-1654.360] (-1658.007) (-1664.673) * (-1654.953) (-1657.224) [-1656.364] (-1663.548) -- 0:01:09
      42000 -- (-1654.959) (-1654.754) (-1658.436) [-1666.900] * (-1658.664) (-1656.890) [-1656.201] (-1662.252) -- 0:01:08
      42500 -- (-1654.916) (-1658.205) (-1659.822) [-1665.236] * (-1657.935) (-1657.928) [-1656.644] (-1671.396) -- 0:01:07
      43000 -- (-1654.783) (-1659.252) (-1656.256) [-1661.246] * (-1657.800) (-1656.472) (-1656.928) [-1663.528] -- 0:01:06
      43500 -- (-1655.675) (-1656.149) (-1659.914) [-1664.397] * (-1656.720) (-1655.637) (-1658.866) [-1664.367] -- 0:01:05
      44000 -- (-1654.301) (-1654.050) [-1656.593] (-1664.339) * [-1655.877] (-1655.870) (-1655.086) (-1664.190) -- 0:01:05
      44500 -- [-1654.313] (-1654.250) (-1663.270) (-1667.880) * (-1655.968) (-1655.712) [-1654.901] (-1671.743) -- 0:01:04
      45000 -- (-1655.467) (-1653.838) [-1656.676] (-1682.518) * (-1654.378) (-1655.648) (-1654.707) [-1664.983] -- 0:01:03

      Average standard deviation of split frequencies: 0.031232

      45500 -- (-1654.962) [-1655.250] (-1654.709) (-1660.699) * [-1655.484] (-1656.524) (-1654.551) (-1670.497) -- 0:01:02
      46000 -- (-1654.778) (-1655.218) [-1653.749] (-1666.055) * [-1655.215] (-1656.531) (-1654.384) (-1657.010) -- 0:01:02
      46500 -- [-1656.489] (-1656.490) (-1659.497) (-1656.268) * (-1654.768) (-1658.450) (-1654.727) [-1654.753] -- 0:01:01
      47000 -- [-1654.373] (-1654.999) (-1655.520) (-1656.076) * (-1653.646) [-1657.302] (-1657.387) (-1655.922) -- 0:01:00
      47500 -- (-1655.590) (-1660.661) [-1654.045] (-1656.289) * (-1654.805) (-1657.023) [-1656.704] (-1656.532) -- 0:01:00
      48000 -- (-1654.844) (-1659.250) [-1653.468] (-1656.833) * (-1656.264) (-1658.568) (-1655.876) [-1657.751] -- 0:00:59
      48500 -- (-1656.285) (-1657.467) (-1653.450) [-1656.659] * (-1658.133) (-1659.944) (-1655.433) [-1654.457] -- 0:00:58
      49000 -- (-1659.397) (-1659.142) [-1653.668] (-1653.679) * (-1656.619) (-1659.175) [-1654.806] (-1658.779) -- 0:00:58
      49500 -- (-1654.578) (-1656.056) (-1655.413) [-1658.034] * (-1662.488) [-1654.837] (-1654.699) (-1655.220) -- 0:01:16
      50000 -- (-1653.817) (-1656.349) [-1653.314] (-1657.415) * (-1659.367) [-1655.606] (-1654.526) (-1657.590) -- 0:01:16

      Average standard deviation of split frequencies: 0.031169

      50500 -- (-1654.414) [-1655.265] (-1655.018) (-1656.664) * [-1654.662] (-1656.694) (-1656.747) (-1653.831) -- 0:01:15
      51000 -- (-1655.533) (-1655.576) [-1657.398] (-1654.319) * (-1654.524) (-1659.995) (-1660.984) [-1655.298] -- 0:01:14
      51500 -- (-1655.695) (-1657.919) [-1657.755] (-1656.980) * (-1654.455) (-1660.045) (-1659.001) [-1655.062] -- 0:01:13
      52000 -- (-1656.222) (-1657.929) [-1656.555] (-1657.969) * (-1655.407) (-1660.251) (-1656.227) [-1655.363] -- 0:01:12
      52500 -- (-1654.722) [-1654.057] (-1655.770) (-1654.275) * (-1654.190) [-1658.046] (-1655.790) (-1657.809) -- 0:01:12
      53000 -- (-1658.496) [-1653.625] (-1653.686) (-1655.276) * (-1654.202) (-1657.596) [-1657.423] (-1655.274) -- 0:01:11
      53500 -- [-1653.941] (-1653.752) (-1658.959) (-1656.180) * (-1654.752) [-1655.167] (-1658.826) (-1657.263) -- 0:01:10
      54000 -- (-1654.070) [-1654.872] (-1658.265) (-1656.168) * [-1654.498] (-1657.059) (-1656.962) (-1660.402) -- 0:01:10
      54500 -- (-1656.037) (-1657.856) (-1659.307) [-1655.823] * (-1654.678) [-1656.876] (-1656.640) (-1656.542) -- 0:01:09
      55000 -- (-1657.285) [-1656.278] (-1660.335) (-1655.268) * (-1654.384) (-1658.331) [-1655.537] (-1660.340) -- 0:01:08

      Average standard deviation of split frequencies: 0.034607

      55500 -- (-1657.192) [-1654.273] (-1660.040) (-1655.763) * [-1653.867] (-1656.160) (-1660.052) (-1662.544) -- 0:01:08
      56000 -- (-1657.270) (-1653.942) (-1662.767) [-1656.491] * (-1654.367) (-1655.424) [-1654.883] (-1657.373) -- 0:01:07
      56500 -- [-1658.488] (-1654.345) (-1657.004) (-1654.892) * [-1653.961] (-1656.161) (-1653.539) (-1655.259) -- 0:01:06
      57000 -- [-1659.954] (-1655.165) (-1657.010) (-1655.226) * (-1653.905) (-1658.440) (-1653.476) [-1653.603] -- 0:01:06
      57500 -- (-1659.531) (-1653.987) [-1658.522] (-1654.265) * (-1654.190) (-1657.085) (-1654.209) [-1654.063] -- 0:01:05
      58000 -- (-1660.305) [-1654.659] (-1657.768) (-1654.265) * (-1655.994) [-1656.683] (-1655.723) (-1656.330) -- 0:01:04
      58500 -- [-1657.244] (-1654.867) (-1656.432) (-1654.318) * (-1656.766) (-1656.330) [-1657.290] (-1656.689) -- 0:01:04
      59000 -- (-1657.024) [-1653.522] (-1659.922) (-1656.123) * (-1656.548) (-1656.132) (-1658.421) [-1655.055] -- 0:01:03
      59500 -- [-1654.139] (-1659.864) (-1657.102) (-1656.962) * (-1657.256) (-1654.892) [-1660.100] (-1654.837) -- 0:01:03
      60000 -- (-1653.665) [-1655.812] (-1655.595) (-1655.343) * (-1655.948) (-1655.842) (-1657.974) [-1655.928] -- 0:01:02

      Average standard deviation of split frequencies: 0.034738

      60500 -- [-1654.354] (-1654.023) (-1657.083) (-1654.912) * [-1656.789] (-1656.646) (-1656.395) (-1656.310) -- 0:01:02
      61000 -- [-1654.205] (-1653.811) (-1658.264) (-1654.259) * (-1657.196) (-1655.987) (-1654.774) [-1656.255] -- 0:01:01
      61500 -- (-1656.284) [-1654.651] (-1654.717) (-1655.677) * [-1657.993] (-1656.252) (-1655.905) (-1658.673) -- 0:01:01
      62000 -- (-1658.039) (-1654.265) (-1654.530) [-1653.646] * (-1656.802) (-1654.985) (-1657.704) [-1658.374] -- 0:01:00
      62500 -- [-1654.344] (-1654.193) (-1655.319) (-1655.720) * (-1656.073) (-1657.252) (-1657.699) [-1655.260] -- 0:01:00
      63000 -- [-1654.013] (-1656.254) (-1656.386) (-1655.720) * (-1657.282) [-1653.787] (-1660.810) (-1654.544) -- 0:00:59
      63500 -- (-1654.406) [-1656.334] (-1655.487) (-1654.541) * (-1661.848) (-1653.600) (-1659.105) [-1654.173] -- 0:00:58
      64000 -- (-1656.160) [-1656.607] (-1659.805) (-1657.409) * (-1656.528) (-1653.721) [-1656.711] (-1654.821) -- 0:00:58
      64500 -- (-1656.674) [-1656.844] (-1655.451) (-1654.957) * (-1657.356) (-1653.897) [-1658.234] (-1658.411) -- 0:00:58
      65000 -- (-1658.098) [-1658.239] (-1655.070) (-1654.292) * (-1655.775) [-1653.894] (-1657.325) (-1656.602) -- 0:00:57

      Average standard deviation of split frequencies: 0.032651

      65500 -- (-1655.200) [-1656.406] (-1654.829) (-1654.619) * (-1657.041) (-1658.204) [-1658.510] (-1653.845) -- 0:01:11
      66000 -- [-1659.026] (-1658.024) (-1660.280) (-1654.670) * (-1655.403) (-1657.905) [-1656.411] (-1654.830) -- 0:01:10
      66500 -- [-1657.279] (-1657.307) (-1655.484) (-1654.051) * (-1656.161) [-1655.140] (-1656.788) (-1660.601) -- 0:01:10
      67000 -- [-1660.177] (-1657.200) (-1657.574) (-1654.050) * (-1658.033) (-1653.483) [-1656.907] (-1654.346) -- 0:01:09
      67500 -- (-1654.221) [-1653.645] (-1654.073) (-1654.100) * (-1658.070) (-1656.145) (-1653.813) [-1654.346] -- 0:01:09
      68000 -- [-1656.123] (-1654.923) (-1655.218) (-1655.279) * (-1654.683) (-1656.535) [-1656.408] (-1653.615) -- 0:01:08
      68500 -- [-1655.429] (-1654.799) (-1654.868) (-1656.423) * (-1655.203) (-1657.489) [-1655.352] (-1654.315) -- 0:01:07
      69000 -- (-1655.317) [-1656.546] (-1654.384) (-1657.900) * (-1655.805) [-1658.524] (-1654.395) (-1654.736) -- 0:01:07
      69500 -- (-1655.077) (-1656.442) (-1654.159) [-1654.276] * [-1655.342] (-1659.860) (-1653.910) (-1655.555) -- 0:01:06
      70000 -- [-1654.025] (-1657.004) (-1654.380) (-1654.608) * (-1656.138) (-1655.396) [-1653.853] (-1654.229) -- 0:01:06

      Average standard deviation of split frequencies: 0.037567

      70500 -- (-1656.239) (-1654.552) (-1656.189) [-1656.519] * (-1657.363) (-1655.953) [-1654.036] (-1654.621) -- 0:01:05
      71000 -- (-1658.684) (-1654.280) [-1655.226] (-1657.002) * (-1659.668) (-1655.130) (-1657.077) [-1655.215] -- 0:01:05
      71500 -- (-1657.252) [-1654.601] (-1656.576) (-1654.801) * (-1658.380) [-1654.760] (-1655.817) (-1657.073) -- 0:01:04
      72000 -- (-1659.189) (-1654.781) (-1657.881) [-1654.225] * (-1660.436) (-1653.879) (-1657.666) [-1655.708] -- 0:01:04
      72500 -- (-1659.587) (-1655.203) [-1658.560] (-1654.195) * [-1656.255] (-1653.645) (-1654.101) (-1655.819) -- 0:01:03
      73000 -- (-1657.897) (-1654.486) [-1657.630] (-1654.250) * (-1654.468) [-1653.515] (-1655.843) (-1653.805) -- 0:01:03
      73500 -- [-1654.681] (-1655.900) (-1655.247) (-1655.549) * (-1654.934) (-1654.838) (-1658.548) [-1655.883] -- 0:01:03
      74000 -- (-1656.274) [-1654.379] (-1654.451) (-1656.404) * (-1655.199) (-1655.253) [-1657.111] (-1663.825) -- 0:01:02
      74500 -- (-1657.037) [-1656.817] (-1658.162) (-1657.397) * (-1655.195) [-1657.282] (-1661.646) (-1658.795) -- 0:01:02
      75000 -- (-1656.781) (-1655.989) (-1656.528) [-1655.137] * (-1655.106) (-1658.370) (-1661.493) [-1654.691] -- 0:01:01

      Average standard deviation of split frequencies: 0.036182

      75500 -- (-1654.936) [-1653.912] (-1654.851) (-1654.680) * (-1655.687) (-1654.370) (-1656.804) [-1655.014] -- 0:01:01
      76000 -- (-1653.420) (-1653.924) (-1654.925) [-1655.519] * (-1658.941) (-1656.923) (-1657.520) [-1655.461] -- 0:01:00
      76500 -- (-1655.030) (-1654.796) [-1656.148] (-1658.313) * [-1656.829] (-1656.397) (-1658.073) (-1654.887) -- 0:01:00
      77000 -- (-1653.757) (-1654.920) [-1653.579] (-1662.111) * [-1654.784] (-1655.002) (-1655.652) (-1655.590) -- 0:00:59
      77500 -- (-1653.838) [-1657.533] (-1657.305) (-1663.268) * (-1654.685) (-1658.096) (-1653.837) [-1657.504] -- 0:00:59
      78000 -- (-1653.838) (-1654.527) (-1655.573) [-1658.667] * (-1654.462) [-1657.856] (-1657.643) (-1654.192) -- 0:00:59
      78500 -- (-1654.084) [-1654.548] (-1655.257) (-1655.564) * [-1657.032] (-1660.077) (-1656.146) (-1654.219) -- 0:00:58
      79000 -- (-1654.062) [-1654.547] (-1654.469) (-1657.809) * (-1657.858) (-1658.757) [-1654.967] (-1656.622) -- 0:00:58
      79500 -- (-1655.298) [-1654.748] (-1655.109) (-1657.612) * [-1653.987] (-1660.726) (-1656.671) (-1654.598) -- 0:00:57
      80000 -- (-1656.317) (-1654.475) (-1653.981) [-1657.196] * (-1655.396) (-1661.181) [-1658.002] (-1654.987) -- 0:00:57

      Average standard deviation of split frequencies: 0.037469

      80500 -- (-1655.495) (-1653.432) (-1657.121) [-1658.467] * (-1654.844) (-1660.382) (-1655.695) [-1654.611] -- 0:00:57
      81000 -- (-1655.383) [-1653.421] (-1654.597) (-1661.953) * [-1654.669] (-1659.697) (-1654.631) (-1654.665) -- 0:01:08
      81500 -- (-1658.209) [-1654.302] (-1655.410) (-1658.969) * [-1654.716] (-1659.038) (-1654.721) (-1655.033) -- 0:01:07
      82000 -- (-1658.793) (-1657.134) [-1655.553] (-1654.173) * (-1654.805) (-1654.062) [-1656.698] (-1655.512) -- 0:01:07
      82500 -- [-1657.810] (-1654.866) (-1655.314) (-1653.624) * [-1657.994] (-1654.457) (-1654.845) (-1656.256) -- 0:01:06
      83000 -- (-1657.900) [-1656.264] (-1655.453) (-1659.354) * (-1657.726) (-1655.272) [-1656.105] (-1655.476) -- 0:01:06
      83500 -- (-1657.347) [-1657.747] (-1660.391) (-1656.396) * (-1656.906) (-1655.727) (-1656.589) [-1655.046] -- 0:01:05
      84000 -- (-1657.480) [-1653.857] (-1656.914) (-1656.226) * (-1657.452) (-1654.721) [-1655.590] (-1654.632) -- 0:01:05
      84500 -- (-1656.950) (-1655.803) [-1654.988] (-1657.473) * (-1658.021) (-1655.743) [-1654.461] (-1654.123) -- 0:01:05
      85000 -- (-1657.656) (-1656.876) (-1656.095) [-1656.326] * (-1657.967) (-1654.586) [-1655.699] (-1655.324) -- 0:01:04

      Average standard deviation of split frequencies: 0.039893

      85500 -- (-1656.040) (-1654.241) (-1657.799) [-1657.442] * [-1655.736] (-1656.954) (-1656.449) (-1659.188) -- 0:01:04
      86000 -- (-1659.355) (-1657.675) [-1654.269] (-1654.950) * (-1657.390) (-1656.411) [-1654.430] (-1656.700) -- 0:01:03
      86500 -- (-1654.233) (-1656.939) [-1654.670] (-1654.932) * (-1654.882) (-1656.603) (-1657.432) [-1654.918] -- 0:01:03
      87000 -- (-1656.817) (-1657.153) [-1658.886] (-1656.608) * (-1654.963) (-1656.878) (-1653.596) [-1654.073] -- 0:01:02
      87500 -- [-1654.448] (-1654.312) (-1656.061) (-1654.473) * (-1655.092) (-1657.519) (-1656.871) [-1655.249] -- 0:01:02
      88000 -- (-1653.572) (-1654.189) [-1654.068] (-1656.701) * (-1655.334) (-1657.448) [-1657.373] (-1654.216) -- 0:01:02
      88500 -- (-1655.006) (-1654.210) [-1655.781] (-1654.649) * [-1654.260] (-1659.020) (-1654.623) (-1653.613) -- 0:01:01
      89000 -- [-1656.152] (-1653.717) (-1655.291) (-1656.113) * (-1654.571) [-1656.825] (-1654.623) (-1658.015) -- 0:01:01
      89500 -- (-1656.020) [-1658.996] (-1655.905) (-1653.975) * [-1656.037] (-1657.145) (-1654.500) (-1653.835) -- 0:01:01
      90000 -- (-1654.724) (-1657.219) [-1659.342] (-1654.114) * (-1654.131) (-1656.313) (-1656.653) [-1654.667] -- 0:01:00

      Average standard deviation of split frequencies: 0.034662

      90500 -- (-1653.705) (-1654.948) (-1655.870) [-1654.666] * [-1653.721] (-1654.644) (-1655.781) (-1657.030) -- 0:01:00
      91000 -- (-1654.197) (-1655.067) [-1657.728] (-1654.561) * (-1653.800) (-1653.486) (-1656.757) [-1658.041] -- 0:00:59
      91500 -- (-1656.653) (-1654.456) (-1658.799) [-1655.933] * (-1656.153) [-1653.947] (-1655.112) (-1654.862) -- 0:00:59
      92000 -- (-1656.659) [-1653.491] (-1663.921) (-1656.780) * (-1656.277) [-1655.894] (-1656.445) (-1654.972) -- 0:00:59
      92500 -- (-1654.759) (-1653.530) (-1661.860) [-1657.039] * [-1657.120] (-1655.079) (-1656.127) (-1654.332) -- 0:00:58
      93000 -- (-1653.713) (-1655.462) [-1658.499] (-1658.409) * [-1655.919] (-1654.394) (-1655.804) (-1655.056) -- 0:00:58
      93500 -- (-1655.882) [-1654.353] (-1661.849) (-1657.068) * [-1655.191] (-1654.132) (-1654.870) (-1657.999) -- 0:00:58
      94000 -- (-1653.790) (-1654.206) [-1655.796] (-1657.314) * (-1655.138) (-1655.210) (-1655.863) [-1655.098] -- 0:00:57
      94500 -- (-1653.694) (-1654.543) (-1654.562) [-1655.241] * [-1661.557] (-1657.458) (-1655.444) (-1654.472) -- 0:00:57
      95000 -- (-1655.531) (-1654.140) (-1657.904) [-1656.829] * [-1656.792] (-1658.982) (-1654.640) (-1657.246) -- 0:00:57

      Average standard deviation of split frequencies: 0.030497

      95500 -- [-1654.949] (-1657.235) (-1655.074) (-1657.372) * (-1655.515) (-1655.687) [-1656.109] (-1665.070) -- 0:00:56
      96000 -- (-1658.998) [-1658.139] (-1653.641) (-1654.288) * (-1655.325) [-1655.716] (-1656.156) (-1656.057) -- 0:00:56
      96500 -- (-1654.247) (-1655.824) [-1654.233] (-1655.358) * (-1658.727) (-1656.504) (-1654.815) [-1655.221] -- 0:01:05
      97000 -- [-1654.143] (-1653.798) (-1653.920) (-1659.110) * (-1656.401) (-1656.362) [-1655.491] (-1657.484) -- 0:01:05
      97500 -- (-1653.419) (-1653.614) (-1658.052) [-1655.854] * (-1656.978) [-1656.579] (-1658.788) (-1656.981) -- 0:01:04
      98000 -- (-1654.304) [-1654.128] (-1655.227) (-1657.541) * (-1655.580) [-1660.082] (-1653.918) (-1656.149) -- 0:01:04
      98500 -- [-1655.158] (-1656.421) (-1654.796) (-1653.759) * (-1657.425) (-1654.993) (-1653.764) [-1654.077] -- 0:01:04
      99000 -- (-1654.424) (-1654.910) (-1654.147) [-1653.216] * [-1656.386] (-1655.765) (-1655.822) (-1654.743) -- 0:01:03
      99500 -- (-1655.454) (-1655.568) (-1660.508) [-1653.208] * (-1655.951) [-1656.924] (-1655.720) (-1655.865) -- 0:01:03
      100000 -- [-1653.831] (-1657.183) (-1656.037) (-1653.348) * (-1660.858) (-1655.139) (-1655.720) [-1655.356] -- 0:01:02

      Average standard deviation of split frequencies: 0.034601

      100500 -- (-1656.332) (-1656.979) (-1663.095) [-1657.978] * (-1662.006) (-1654.514) (-1655.205) [-1654.070] -- 0:01:02
      101000 -- (-1657.618) [-1655.107] (-1661.807) (-1654.516) * (-1664.059) [-1654.347] (-1655.547) (-1654.144) -- 0:01:02
      101500 -- (-1654.224) (-1656.388) (-1655.295) [-1654.249] * [-1660.745] (-1653.735) (-1655.936) (-1659.308) -- 0:01:01
      102000 -- [-1653.931] (-1656.262) (-1654.444) (-1653.351) * (-1657.161) (-1655.989) [-1655.223] (-1657.219) -- 0:01:01
      102500 -- [-1656.640] (-1657.551) (-1654.773) (-1654.696) * [-1656.643] (-1654.663) (-1655.603) (-1658.492) -- 0:01:01
      103000 -- [-1656.730] (-1658.232) (-1655.272) (-1657.074) * (-1657.882) (-1656.474) (-1655.251) [-1655.981] -- 0:01:00
      103500 -- (-1657.731) (-1655.849) [-1655.063] (-1655.446) * (-1657.624) [-1654.705] (-1655.282) (-1656.673) -- 0:01:00
      104000 -- [-1659.639] (-1655.446) (-1655.537) (-1655.719) * (-1655.213) (-1656.302) (-1654.921) [-1658.584] -- 0:01:00
      104500 -- (-1658.897) [-1654.340] (-1655.847) (-1653.545) * (-1655.224) (-1655.537) (-1655.808) [-1654.289] -- 0:00:59
      105000 -- (-1657.984) [-1654.763] (-1655.928) (-1658.263) * (-1656.655) [-1654.465] (-1655.242) (-1654.222) -- 0:00:59

      Average standard deviation of split frequencies: 0.029492

      105500 -- (-1656.954) [-1656.887] (-1655.791) (-1659.323) * (-1657.443) (-1653.732) [-1655.583] (-1654.107) -- 0:00:59
      106000 -- [-1654.351] (-1656.940) (-1657.671) (-1656.709) * (-1657.269) (-1655.438) [-1656.227] (-1653.775) -- 0:00:59
      106500 -- (-1655.350) (-1656.100) (-1655.341) [-1653.836] * (-1654.984) [-1657.081] (-1655.966) (-1654.921) -- 0:00:58
      107000 -- (-1654.282) (-1654.920) [-1656.959] (-1654.005) * (-1659.255) (-1654.938) (-1659.358) [-1655.276] -- 0:00:58
      107500 -- [-1659.381] (-1653.365) (-1656.854) (-1653.974) * (-1656.059) (-1655.273) (-1659.791) [-1655.533] -- 0:00:58
      108000 -- (-1667.490) [-1655.712] (-1657.432) (-1654.750) * (-1655.784) (-1657.298) [-1659.621] (-1658.444) -- 0:00:57
      108500 -- (-1656.301) (-1665.397) [-1657.833] (-1653.690) * (-1656.757) [-1657.026] (-1655.184) (-1659.057) -- 0:00:57
      109000 -- (-1654.469) [-1661.607] (-1657.194) (-1653.396) * (-1655.055) (-1655.151) (-1655.247) [-1658.812] -- 0:00:57
      109500 -- (-1656.355) (-1653.819) (-1658.458) [-1654.901] * (-1655.525) (-1655.196) (-1654.941) [-1658.607] -- 0:00:56
      110000 -- (-1658.812) (-1654.916) (-1662.548) [-1658.158] * (-1654.699) (-1654.829) (-1660.556) [-1658.897] -- 0:00:56

      Average standard deviation of split frequencies: 0.031474

      110500 -- (-1661.711) [-1656.256] (-1656.369) (-1657.670) * (-1655.005) (-1654.880) (-1660.473) [-1654.677] -- 0:00:56
      111000 -- (-1654.125) (-1657.500) (-1656.530) [-1658.518] * (-1655.484) (-1655.317) [-1655.293] (-1654.707) -- 0:00:56
      111500 -- (-1654.323) [-1654.777] (-1655.653) (-1658.001) * (-1654.931) (-1655.651) (-1654.624) [-1657.773] -- 0:00:55
      112000 -- (-1654.207) (-1654.245) [-1656.862] (-1657.126) * [-1655.225] (-1655.323) (-1654.757) (-1654.051) -- 0:01:03
      112500 -- (-1654.202) [-1656.728] (-1657.965) (-1653.981) * [-1654.636] (-1655.528) (-1655.633) (-1653.652) -- 0:01:03
      113000 -- (-1655.037) (-1655.531) (-1657.201) [-1654.601] * (-1655.245) (-1654.851) (-1655.595) [-1653.825] -- 0:01:02
      113500 -- (-1655.337) (-1657.389) (-1660.203) [-1654.574] * (-1656.016) (-1654.933) (-1658.008) [-1653.825] -- 0:01:02
      114000 -- (-1655.969) (-1659.988) (-1658.439) [-1655.245] * (-1655.955) [-1654.384] (-1654.644) (-1655.122) -- 0:01:02
      114500 -- (-1654.209) (-1656.056) (-1658.467) [-1654.665] * [-1655.679] (-1654.537) (-1655.413) (-1654.665) -- 0:01:01
      115000 -- (-1659.074) [-1654.784] (-1658.331) (-1653.454) * (-1654.013) [-1654.639] (-1656.021) (-1655.594) -- 0:01:01

      Average standard deviation of split frequencies: 0.030837

      115500 -- (-1662.092) (-1655.983) [-1654.154] (-1653.563) * [-1659.951] (-1655.093) (-1654.781) (-1656.002) -- 0:01:01
      116000 -- (-1656.714) [-1654.833] (-1654.753) (-1659.581) * [-1653.970] (-1659.459) (-1656.768) (-1657.027) -- 0:01:00
      116500 -- (-1657.921) (-1654.765) [-1654.694] (-1656.100) * (-1655.012) (-1654.321) [-1655.082] (-1654.761) -- 0:01:00
      117000 -- (-1655.595) [-1654.979] (-1653.973) (-1657.816) * (-1653.162) (-1654.603) (-1655.782) [-1653.555] -- 0:01:00
      117500 -- (-1655.186) (-1654.985) (-1653.925) [-1657.104] * (-1653.877) (-1656.152) (-1656.617) [-1653.602] -- 0:01:00
      118000 -- (-1656.205) [-1654.726] (-1653.777) (-1656.670) * (-1653.942) (-1655.300) [-1656.032] (-1654.353) -- 0:00:59
      118500 -- (-1655.280) (-1654.734) (-1654.630) [-1654.944] * (-1653.157) [-1654.645] (-1655.087) (-1655.438) -- 0:00:59
      119000 -- [-1653.906] (-1654.708) (-1654.440) (-1656.179) * [-1654.311] (-1654.635) (-1659.095) (-1655.616) -- 0:00:59
      119500 -- (-1656.668) [-1656.865] (-1656.370) (-1656.407) * (-1653.523) [-1654.241] (-1657.328) (-1657.789) -- 0:00:58
      120000 -- (-1654.232) [-1657.297] (-1655.841) (-1657.129) * (-1654.773) (-1654.024) (-1659.386) [-1655.959] -- 0:00:58

      Average standard deviation of split frequencies: 0.029734

      120500 -- (-1654.250) (-1658.155) (-1655.792) [-1657.448] * [-1653.909] (-1654.479) (-1655.084) (-1657.300) -- 0:00:58
      121000 -- (-1654.255) [-1657.590] (-1656.218) (-1659.271) * (-1653.780) [-1653.426] (-1657.194) (-1654.089) -- 0:00:58
      121500 -- (-1655.777) (-1658.058) [-1654.917] (-1657.802) * (-1653.291) (-1654.984) [-1657.713] (-1653.332) -- 0:00:57
      122000 -- [-1655.246] (-1657.375) (-1654.992) (-1655.182) * (-1653.879) (-1654.205) [-1655.399] (-1654.817) -- 0:00:57
      122500 -- [-1655.386] (-1659.923) (-1653.786) (-1654.021) * (-1655.625) (-1654.043) [-1655.097] (-1655.436) -- 0:00:57
      123000 -- (-1656.369) (-1657.447) [-1653.751] (-1654.700) * (-1658.031) [-1654.528] (-1654.578) (-1659.530) -- 0:00:57
      123500 -- (-1656.840) [-1660.690] (-1653.757) (-1655.622) * (-1655.487) (-1657.328) (-1656.592) [-1658.989] -- 0:00:56
      124000 -- (-1655.450) (-1654.389) [-1655.168] (-1655.009) * (-1657.266) (-1657.261) [-1655.710] (-1655.509) -- 0:00:56
      124500 -- (-1654.419) (-1654.843) (-1655.264) [-1653.464] * (-1662.279) [-1655.203] (-1655.121) (-1655.146) -- 0:00:56
      125000 -- (-1653.534) (-1654.575) (-1654.364) [-1653.383] * (-1657.905) (-1654.341) [-1654.771] (-1654.123) -- 0:00:56

      Average standard deviation of split frequencies: 0.024408

      125500 -- (-1654.760) [-1654.533] (-1654.622) (-1654.439) * (-1659.512) (-1653.283) [-1653.677] (-1654.429) -- 0:00:55
      126000 -- (-1654.070) (-1653.639) (-1657.846) [-1654.512] * (-1657.859) (-1657.720) [-1654.842] (-1655.995) -- 0:00:55
      126500 -- (-1654.355) (-1653.897) (-1662.434) [-1656.145] * [-1656.150] (-1656.074) (-1654.577) (-1655.618) -- 0:00:55
      127000 -- (-1658.144) (-1654.172) (-1660.905) [-1655.351] * (-1656.624) (-1654.143) (-1654.639) [-1655.109] -- 0:00:54
      127500 -- [-1657.835] (-1654.700) (-1655.100) (-1654.780) * (-1657.003) (-1654.002) (-1654.382) [-1655.244] -- 0:00:54
      128000 -- (-1655.311) [-1654.015] (-1655.475) (-1655.922) * (-1659.141) [-1653.716] (-1655.004) (-1658.708) -- 0:01:01
      128500 -- [-1655.692] (-1655.885) (-1654.766) (-1655.298) * [-1658.581] (-1653.440) (-1654.517) (-1656.481) -- 0:01:01
      129000 -- (-1661.051) [-1656.745] (-1654.738) (-1659.089) * [-1660.081] (-1653.439) (-1656.818) (-1654.419) -- 0:01:00
      129500 -- (-1658.459) (-1655.776) [-1656.733] (-1655.717) * [-1657.246] (-1653.421) (-1655.602) (-1654.748) -- 0:01:00
      130000 -- [-1654.888] (-1658.861) (-1654.747) (-1665.472) * (-1654.272) (-1653.327) (-1655.595) [-1655.441] -- 0:01:00

      Average standard deviation of split frequencies: 0.023089

      130500 -- (-1655.721) (-1659.028) [-1654.220] (-1661.458) * (-1654.516) [-1653.353] (-1658.699) (-1654.134) -- 0:00:59
      131000 -- [-1655.862] (-1655.962) (-1655.265) (-1653.424) * (-1657.313) [-1653.655] (-1660.483) (-1654.857) -- 0:00:59
      131500 -- (-1656.012) (-1655.432) (-1654.817) [-1653.845] * [-1655.543] (-1653.419) (-1656.877) (-1655.753) -- 0:00:59
      132000 -- (-1657.534) [-1653.765] (-1654.480) (-1658.483) * (-1655.274) [-1653.969] (-1656.580) (-1654.353) -- 0:00:59
      132500 -- [-1655.171] (-1656.408) (-1653.830) (-1658.234) * [-1656.432] (-1653.963) (-1657.887) (-1654.571) -- 0:00:58
      133000 -- (-1654.364) (-1655.814) (-1655.349) [-1656.792] * (-1656.021) [-1654.482] (-1654.852) (-1657.006) -- 0:00:58
      133500 -- (-1655.730) [-1655.208] (-1658.322) (-1655.583) * (-1657.336) [-1655.185] (-1655.606) (-1656.769) -- 0:00:58
      134000 -- (-1655.772) (-1664.299) [-1655.140] (-1660.501) * (-1657.795) [-1656.062] (-1663.089) (-1656.513) -- 0:00:58
      134500 -- (-1656.510) (-1661.701) [-1658.123] (-1658.620) * (-1658.750) (-1660.026) [-1656.564] (-1656.647) -- 0:00:57
      135000 -- (-1653.847) (-1655.356) (-1655.792) [-1658.097] * (-1656.516) (-1656.162) [-1654.334] (-1655.210) -- 0:00:57

      Average standard deviation of split frequencies: 0.020432

      135500 -- (-1654.591) (-1654.397) [-1654.574] (-1656.004) * [-1657.051] (-1656.016) (-1656.024) (-1658.145) -- 0:00:57
      136000 -- [-1655.593] (-1655.605) (-1654.941) (-1654.123) * (-1655.133) (-1657.863) (-1656.895) [-1657.740] -- 0:00:57
      136500 -- [-1653.131] (-1654.798) (-1654.867) (-1654.863) * (-1654.640) (-1656.940) (-1655.152) [-1660.067] -- 0:00:56
      137000 -- (-1656.588) (-1656.748) (-1656.834) [-1656.844] * (-1654.596) (-1654.629) (-1655.841) [-1658.311] -- 0:00:56
      137500 -- (-1653.682) (-1655.619) [-1657.044] (-1655.166) * (-1655.552) (-1654.485) (-1654.629) [-1655.594] -- 0:00:56
      138000 -- (-1654.220) (-1655.759) (-1655.683) [-1656.679] * (-1654.931) (-1653.856) [-1654.401] (-1654.429) -- 0:00:56
      138500 -- (-1654.234) [-1654.413] (-1655.722) (-1655.287) * [-1654.316] (-1654.365) (-1656.192) (-1656.438) -- 0:00:55
      139000 -- [-1653.992] (-1654.416) (-1653.293) (-1655.573) * (-1655.201) [-1654.983] (-1655.278) (-1656.494) -- 0:00:55
      139500 -- (-1657.182) (-1655.157) [-1656.122] (-1654.323) * (-1656.104) [-1654.843] (-1654.095) (-1655.153) -- 0:00:55
      140000 -- (-1657.416) [-1656.095] (-1654.340) (-1654.588) * (-1654.468) (-1655.796) [-1655.477] (-1654.548) -- 0:00:55

      Average standard deviation of split frequencies: 0.020293

      140500 -- (-1657.682) (-1656.969) [-1655.295] (-1654.955) * [-1654.530] (-1654.363) (-1653.871) (-1654.321) -- 0:00:55
      141000 -- (-1657.174) (-1656.164) [-1653.344] (-1654.232) * (-1656.104) [-1654.613] (-1655.184) (-1654.321) -- 0:00:54
      141500 -- [-1657.662] (-1659.425) (-1653.903) (-1653.781) * (-1657.603) [-1654.348] (-1656.433) (-1654.802) -- 0:00:54
      142000 -- (-1660.631) (-1656.324) [-1654.836] (-1654.404) * [-1655.972] (-1653.832) (-1654.396) (-1656.742) -- 0:00:54
      142500 -- (-1656.736) (-1656.114) (-1654.000) [-1654.078] * (-1655.841) (-1654.019) (-1657.057) [-1655.389] -- 0:00:54
      143000 -- [-1653.909] (-1655.871) (-1658.096) (-1657.240) * (-1657.167) (-1653.894) [-1655.404] (-1655.364) -- 0:00:53
      143500 -- [-1653.704] (-1653.991) (-1655.198) (-1656.873) * (-1654.103) (-1665.714) [-1654.025] (-1656.640) -- 0:00:53
      144000 -- (-1657.845) (-1654.154) (-1654.601) [-1656.797] * (-1654.499) (-1663.582) [-1655.373] (-1655.640) -- 0:00:59
      144500 -- (-1653.925) (-1656.032) [-1654.390] (-1655.771) * [-1655.259] (-1654.298) (-1655.485) (-1654.201) -- 0:00:59
      145000 -- (-1657.201) (-1654.307) [-1654.360] (-1656.570) * (-1655.838) (-1653.595) (-1654.576) [-1654.449] -- 0:00:58

      Average standard deviation of split frequencies: 0.019680

      145500 -- (-1655.174) [-1654.009] (-1654.572) (-1655.487) * (-1658.167) (-1656.322) [-1654.951] (-1655.527) -- 0:00:58
      146000 -- (-1656.946) [-1654.605] (-1656.223) (-1656.727) * (-1655.222) (-1654.808) (-1655.572) [-1657.403] -- 0:00:58
      146500 -- (-1656.080) [-1656.222] (-1655.533) (-1653.483) * [-1656.614] (-1655.828) (-1659.970) (-1654.304) -- 0:00:58
      147000 -- (-1655.701) (-1660.566) [-1655.343] (-1653.573) * [-1657.241] (-1654.503) (-1657.218) (-1654.756) -- 0:00:58
      147500 -- (-1657.753) (-1655.164) [-1657.287] (-1656.913) * (-1656.332) (-1659.360) [-1656.972] (-1654.483) -- 0:00:57
      148000 -- (-1657.307) (-1656.107) [-1654.095] (-1655.396) * (-1659.087) [-1660.806] (-1654.522) (-1655.283) -- 0:00:57
      148500 -- (-1654.946) [-1654.576] (-1654.852) (-1655.893) * (-1657.881) [-1657.281] (-1654.776) (-1656.681) -- 0:00:57
      149000 -- (-1655.095) (-1655.540) [-1659.141] (-1654.836) * (-1658.478) (-1655.837) (-1656.755) [-1656.913] -- 0:00:57
      149500 -- (-1657.041) [-1654.886] (-1656.648) (-1654.837) * (-1659.048) (-1657.691) [-1657.179] (-1656.455) -- 0:00:56
      150000 -- (-1655.347) [-1654.398] (-1656.969) (-1654.777) * (-1653.613) (-1658.637) [-1656.139] (-1655.765) -- 0:00:56

      Average standard deviation of split frequencies: 0.018177

      150500 -- (-1654.065) (-1658.378) [-1658.845] (-1654.368) * [-1654.295] (-1658.146) (-1657.346) (-1655.264) -- 0:00:56
      151000 -- (-1655.720) (-1655.579) (-1656.760) [-1654.160] * (-1654.509) [-1654.702] (-1653.940) (-1655.909) -- 0:00:56
      151500 -- (-1654.470) (-1655.387) (-1655.697) [-1656.266] * (-1655.816) (-1654.861) [-1653.271] (-1655.506) -- 0:00:56
      152000 -- [-1656.218] (-1661.287) (-1656.267) (-1658.780) * [-1655.748] (-1654.347) (-1654.311) (-1658.056) -- 0:00:55
      152500 -- [-1657.991] (-1658.474) (-1655.732) (-1657.968) * (-1657.999) (-1660.411) [-1653.849] (-1654.278) -- 0:00:55
      153000 -- (-1660.910) (-1657.036) (-1657.155) [-1657.311] * (-1655.200) (-1654.474) (-1654.087) [-1655.188] -- 0:00:55
      153500 -- [-1657.360] (-1655.485) (-1655.253) (-1657.520) * (-1660.301) [-1655.444] (-1654.028) (-1654.655) -- 0:00:55
      154000 -- (-1654.106) (-1656.903) [-1658.133] (-1657.363) * [-1659.089] (-1657.148) (-1656.699) (-1656.130) -- 0:00:54
      154500 -- (-1654.112) [-1654.632] (-1656.811) (-1655.797) * [-1654.430] (-1658.771) (-1654.086) (-1656.139) -- 0:00:54
      155000 -- (-1653.985) [-1654.434] (-1655.792) (-1656.296) * (-1654.430) (-1655.746) [-1656.474] (-1653.471) -- 0:00:54

      Average standard deviation of split frequencies: 0.017527

      155500 -- (-1654.031) [-1656.414] (-1654.170) (-1657.451) * [-1654.429] (-1657.265) (-1659.146) (-1654.871) -- 0:00:54
      156000 -- (-1665.159) (-1656.814) [-1653.736] (-1654.901) * (-1655.645) (-1655.873) (-1657.142) [-1653.974] -- 0:00:54
      156500 -- (-1659.155) (-1657.843) (-1656.091) [-1655.003] * (-1657.486) (-1659.865) (-1656.345) [-1655.103] -- 0:00:53
      157000 -- (-1655.627) [-1655.882] (-1654.057) (-1657.877) * [-1653.793] (-1663.313) (-1654.681) (-1655.311) -- 0:00:53
      157500 -- (-1656.114) (-1662.571) (-1654.702) [-1657.004] * (-1655.891) (-1665.798) [-1654.467] (-1655.552) -- 0:00:53
      158000 -- (-1657.468) (-1658.349) [-1654.107] (-1658.079) * [-1656.308] (-1657.254) (-1653.910) (-1654.636) -- 0:00:53
      158500 -- [-1658.708] (-1654.874) (-1655.187) (-1659.683) * (-1656.538) (-1655.592) (-1655.057) [-1657.103] -- 0:00:53
      159000 -- [-1658.989] (-1655.770) (-1655.254) (-1657.903) * (-1656.399) (-1655.391) (-1654.535) [-1655.422] -- 0:00:52
      159500 -- (-1661.290) (-1655.833) [-1653.957] (-1657.840) * (-1657.717) [-1655.489] (-1656.625) (-1654.953) -- 0:00:57
      160000 -- (-1655.059) [-1654.523] (-1655.085) (-1658.838) * (-1657.080) (-1655.155) (-1657.527) [-1656.123] -- 0:00:57

      Average standard deviation of split frequencies: 0.018068

      160500 -- (-1655.655) (-1654.672) (-1654.752) [-1659.436] * (-1658.012) [-1654.295] (-1655.539) (-1656.064) -- 0:00:57
      161000 -- (-1658.102) [-1654.369] (-1654.934) (-1663.118) * [-1656.045] (-1654.952) (-1660.237) (-1656.880) -- 0:00:57
      161500 -- (-1656.605) (-1656.655) [-1653.625] (-1664.233) * (-1655.673) (-1653.994) [-1654.714] (-1657.810) -- 0:00:57
      162000 -- (-1657.091) [-1654.364] (-1655.725) (-1656.458) * (-1657.135) (-1655.497) (-1654.518) [-1657.365] -- 0:00:56
      162500 -- (-1658.195) (-1654.429) (-1654.587) [-1655.902] * [-1659.500] (-1654.722) (-1655.893) (-1654.739) -- 0:00:56
      163000 -- (-1654.169) (-1654.925) (-1655.533) [-1655.411] * (-1659.036) (-1654.611) (-1655.175) [-1655.781] -- 0:00:56
      163500 -- (-1654.065) (-1654.841) (-1654.121) [-1654.515] * (-1657.854) (-1653.780) (-1656.757) [-1656.184] -- 0:00:56
      164000 -- (-1654.793) (-1656.369) [-1654.966] (-1654.249) * (-1656.888) (-1654.169) (-1655.727) [-1655.796] -- 0:00:56
      164500 -- (-1654.141) (-1655.931) (-1655.151) [-1655.930] * (-1656.830) [-1658.379] (-1657.153) (-1653.702) -- 0:00:55
      165000 -- (-1656.122) [-1654.754] (-1655.687) (-1655.592) * (-1656.993) [-1655.821] (-1657.006) (-1657.701) -- 0:00:55

      Average standard deviation of split frequencies: 0.017813

      165500 -- (-1654.303) (-1655.082) (-1655.038) [-1655.173] * (-1656.553) (-1655.659) (-1659.275) [-1653.976] -- 0:00:55
      166000 -- [-1656.394] (-1654.718) (-1656.555) (-1655.367) * (-1660.182) (-1655.881) [-1655.252] (-1657.529) -- 0:00:55
      166500 -- [-1656.550] (-1654.741) (-1654.396) (-1657.325) * (-1655.310) (-1653.552) [-1655.186] (-1654.270) -- 0:00:55
      167000 -- (-1661.090) (-1654.270) (-1658.401) [-1653.554] * (-1655.379) (-1654.039) (-1655.428) [-1654.570] -- 0:00:54
      167500 -- (-1656.104) (-1653.958) (-1654.919) [-1653.948] * (-1656.393) (-1654.406) [-1656.191] (-1653.656) -- 0:00:54
      168000 -- (-1655.556) [-1657.185] (-1655.174) (-1654.532) * (-1655.922) [-1654.773] (-1655.574) (-1656.288) -- 0:00:54
      168500 -- (-1654.478) [-1654.833] (-1655.147) (-1653.779) * (-1653.966) [-1656.647] (-1655.572) (-1654.452) -- 0:00:54
      169000 -- (-1654.348) [-1654.614] (-1655.713) (-1661.904) * (-1653.844) (-1660.019) [-1656.596] (-1654.604) -- 0:00:54
      169500 -- [-1654.125] (-1654.993) (-1656.374) (-1657.604) * (-1654.844) (-1657.116) (-1658.054) [-1654.969] -- 0:00:53
      170000 -- (-1654.721) [-1655.588] (-1655.062) (-1656.590) * (-1654.640) (-1655.036) [-1655.106] (-1654.265) -- 0:00:53

      Average standard deviation of split frequencies: 0.018368

      170500 -- (-1659.027) (-1654.716) (-1653.785) [-1657.071] * (-1655.062) [-1654.010] (-1653.349) (-1654.281) -- 0:00:53
      171000 -- (-1655.706) [-1655.392] (-1657.765) (-1653.727) * [-1654.237] (-1654.020) (-1655.351) (-1655.456) -- 0:00:53
      171500 -- [-1657.411] (-1655.331) (-1657.863) (-1654.278) * [-1654.513] (-1654.437) (-1653.722) (-1658.266) -- 0:00:53
      172000 -- (-1654.492) [-1658.785] (-1655.072) (-1654.199) * (-1656.100) [-1654.932] (-1657.609) (-1656.587) -- 0:00:52
      172500 -- (-1657.362) (-1654.244) [-1656.238] (-1655.818) * (-1655.115) (-1655.158) (-1654.583) [-1653.682] -- 0:00:52
      173000 -- (-1661.410) (-1656.034) (-1656.595) [-1660.006] * (-1654.642) (-1654.657) (-1655.518) [-1654.784] -- 0:00:52
      173500 -- (-1657.028) (-1656.700) (-1654.976) [-1660.851] * (-1654.766) [-1655.251] (-1656.536) (-1653.939) -- 0:00:52
      174000 -- (-1655.159) [-1654.261] (-1656.027) (-1657.122) * [-1653.785] (-1656.583) (-1655.812) (-1653.984) -- 0:00:52
      174500 -- (-1655.022) (-1655.273) (-1653.336) [-1655.568] * (-1656.149) (-1663.571) (-1654.709) [-1654.346] -- 0:00:52
      175000 -- (-1655.015) (-1658.012) (-1656.385) [-1656.167] * [-1656.140] (-1658.809) (-1656.194) (-1657.122) -- 0:00:56

      Average standard deviation of split frequencies: 0.017198

      175500 -- (-1655.404) (-1657.799) (-1655.880) [-1656.206] * (-1658.651) (-1657.035) (-1653.508) [-1653.957] -- 0:00:56
      176000 -- [-1658.309] (-1656.933) (-1657.814) (-1656.854) * (-1658.056) (-1656.485) (-1653.508) [-1654.583] -- 0:00:56
      176500 -- [-1659.030] (-1655.917) (-1654.892) (-1656.106) * (-1656.117) (-1657.806) [-1653.535] (-1653.516) -- 0:00:55
      177000 -- [-1657.040] (-1654.260) (-1657.096) (-1656.232) * [-1659.189] (-1661.628) (-1653.566) (-1655.590) -- 0:00:55
      177500 -- (-1654.274) (-1653.908) (-1655.590) [-1654.865] * (-1656.376) (-1661.500) (-1655.528) [-1657.350] -- 0:00:55
      178000 -- (-1654.792) (-1656.790) (-1657.407) [-1654.668] * (-1655.418) (-1663.279) [-1653.828] (-1659.156) -- 0:00:55
      178500 -- (-1654.875) (-1655.630) (-1659.140) [-1654.262] * (-1657.418) (-1658.173) [-1654.148] (-1658.137) -- 0:00:55
      179000 -- (-1656.476) (-1655.392) (-1656.988) [-1655.165] * (-1655.368) (-1658.065) [-1653.641] (-1654.665) -- 0:00:55
      179500 -- (-1653.995) (-1653.823) (-1658.838) [-1655.326] * [-1658.648] (-1659.455) (-1660.089) (-1656.700) -- 0:00:54
      180000 -- (-1655.739) (-1653.966) [-1654.789] (-1654.882) * (-1656.115) [-1655.595] (-1657.151) (-1654.102) -- 0:00:54

      Average standard deviation of split frequencies: 0.018410

      180500 -- (-1655.846) (-1654.430) [-1657.077] (-1654.208) * (-1657.813) [-1655.779] (-1657.176) (-1655.215) -- 0:00:54
      181000 -- (-1655.789) [-1654.983] (-1655.428) (-1657.119) * [-1655.657] (-1655.215) (-1658.566) (-1654.341) -- 0:00:54
      181500 -- (-1659.202) (-1658.227) (-1659.552) [-1653.591] * (-1655.938) (-1655.290) [-1658.767] (-1656.020) -- 0:00:54
      182000 -- (-1657.167) [-1659.086] (-1654.532) (-1656.082) * (-1656.554) (-1655.306) (-1654.532) [-1655.169] -- 0:00:53
      182500 -- (-1653.864) (-1655.567) [-1655.269] (-1656.971) * (-1654.198) (-1656.032) (-1653.869) [-1655.225] -- 0:00:53
      183000 -- (-1654.121) [-1654.480] (-1654.704) (-1655.905) * (-1655.733) [-1655.769] (-1654.022) (-1654.089) -- 0:00:53
      183500 -- [-1653.549] (-1654.685) (-1656.696) (-1653.770) * [-1655.583] (-1656.215) (-1655.720) (-1655.346) -- 0:00:53
      184000 -- [-1656.136] (-1655.755) (-1660.250) (-1653.961) * (-1654.179) (-1656.022) [-1655.547] (-1656.778) -- 0:00:53
      184500 -- (-1655.214) (-1654.371) [-1655.980] (-1653.596) * [-1653.850] (-1654.501) (-1656.566) (-1655.667) -- 0:00:53
      185000 -- (-1654.441) (-1657.472) [-1654.550] (-1660.005) * (-1654.286) (-1654.592) [-1655.379] (-1658.925) -- 0:00:52

      Average standard deviation of split frequencies: 0.017614

      185500 -- (-1656.423) [-1657.223] (-1655.135) (-1655.875) * [-1653.560] (-1654.602) (-1654.470) (-1659.031) -- 0:00:52
      186000 -- (-1654.173) [-1653.912] (-1655.575) (-1660.374) * (-1653.462) [-1655.620] (-1659.349) (-1655.347) -- 0:00:52
      186500 -- (-1656.750) [-1654.678] (-1654.572) (-1658.241) * [-1655.043] (-1654.068) (-1657.880) (-1655.745) -- 0:00:52
      187000 -- (-1656.078) [-1654.571] (-1655.554) (-1664.288) * (-1656.252) [-1655.547] (-1658.589) (-1656.735) -- 0:00:52
      187500 -- (-1655.895) [-1654.411] (-1655.681) (-1656.093) * (-1658.085) [-1655.607] (-1658.625) (-1656.477) -- 0:00:52
      188000 -- (-1654.538) [-1655.530] (-1655.074) (-1656.093) * (-1657.555) (-1655.555) (-1655.294) [-1655.415] -- 0:00:51
      188500 -- [-1654.888] (-1654.421) (-1655.072) (-1655.725) * (-1654.180) (-1657.145) [-1654.967] (-1654.562) -- 0:00:51
      189000 -- [-1653.623] (-1654.529) (-1655.197) (-1657.327) * (-1654.253) (-1653.938) (-1658.397) [-1657.612] -- 0:00:51
      189500 -- (-1654.926) (-1653.873) [-1655.891] (-1657.289) * (-1655.715) (-1654.760) [-1655.056] (-1660.729) -- 0:00:51
      190000 -- (-1653.550) (-1655.787) (-1655.515) [-1655.064] * (-1654.595) [-1653.895] (-1654.397) (-1659.788) -- 0:00:51

      Average standard deviation of split frequencies: 0.019408

      190500 -- (-1656.109) (-1656.324) [-1654.666] (-1655.478) * (-1654.398) (-1654.249) [-1655.167] (-1656.297) -- 0:00:50
      191000 -- [-1659.897] (-1658.085) (-1655.527) (-1655.999) * (-1655.672) (-1653.575) (-1656.097) [-1659.237] -- 0:00:55
      191500 -- (-1658.430) (-1656.708) [-1657.263] (-1656.812) * (-1657.731) (-1653.551) [-1654.414] (-1657.036) -- 0:00:54
      192000 -- (-1657.067) (-1655.479) [-1653.257] (-1655.088) * (-1656.930) (-1653.372) [-1654.618] (-1656.504) -- 0:00:54
      192500 -- (-1655.316) (-1655.479) [-1655.614] (-1653.991) * (-1662.518) (-1655.356) (-1655.451) [-1655.338] -- 0:00:54
      193000 -- [-1655.305] (-1653.921) (-1654.920) (-1656.522) * (-1660.994) (-1654.757) (-1656.522) [-1655.437] -- 0:00:54
      193500 -- (-1660.599) (-1653.899) (-1654.822) [-1654.372] * (-1661.276) (-1657.225) (-1658.926) [-1660.702] -- 0:00:54
      194000 -- (-1659.992) [-1655.269] (-1654.962) (-1656.865) * (-1655.875) [-1653.562] (-1655.128) (-1655.260) -- 0:00:54
      194500 -- (-1660.365) [-1655.269] (-1654.485) (-1657.343) * (-1656.289) [-1655.376] (-1654.590) (-1655.211) -- 0:00:53
      195000 -- [-1657.907] (-1654.807) (-1654.027) (-1654.032) * (-1657.570) (-1657.555) (-1654.622) [-1655.320] -- 0:00:53

      Average standard deviation of split frequencies: 0.020887

      195500 -- [-1659.767] (-1656.479) (-1654.458) (-1655.256) * (-1654.824) (-1655.038) (-1656.918) [-1654.425] -- 0:00:53
      196000 -- (-1659.076) [-1656.487] (-1653.489) (-1654.639) * (-1659.407) (-1654.573) (-1656.265) [-1654.602] -- 0:00:53
      196500 -- (-1655.012) (-1658.797) (-1653.947) [-1657.547] * (-1655.428) (-1653.947) (-1653.453) [-1656.769] -- 0:00:53
      197000 -- (-1656.169) (-1656.736) [-1655.022] (-1658.022) * (-1658.366) (-1653.651) [-1653.453] (-1656.769) -- 0:00:52
      197500 -- [-1657.011] (-1655.997) (-1655.697) (-1654.685) * [-1660.161] (-1656.207) (-1654.577) (-1660.370) -- 0:00:52
      198000 -- (-1659.263) (-1663.400) (-1654.919) [-1654.775] * (-1658.681) (-1659.736) (-1654.501) [-1654.021] -- 0:00:52
      198500 -- (-1657.357) (-1660.892) (-1654.352) [-1653.857] * [-1656.583] (-1659.983) (-1655.180) (-1654.556) -- 0:00:52
      199000 -- [-1654.006] (-1659.882) (-1654.737) (-1653.973) * [-1656.731] (-1656.546) (-1654.005) (-1655.974) -- 0:00:52
      199500 -- (-1656.111) (-1655.153) (-1655.042) [-1654.884] * (-1654.872) [-1655.684] (-1653.775) (-1656.581) -- 0:00:52
      200000 -- [-1656.314] (-1653.792) (-1654.454) (-1655.767) * (-1653.932) (-1658.163) (-1656.008) [-1656.721] -- 0:00:51

      Average standard deviation of split frequencies: 0.019707

      200500 -- [-1655.828] (-1653.774) (-1654.990) (-1659.352) * (-1653.811) (-1656.100) [-1658.030] (-1655.971) -- 0:00:51
      201000 -- (-1657.180) (-1653.747) (-1656.652) [-1657.074] * (-1656.687) [-1653.885] (-1653.896) (-1655.973) -- 0:00:51
      201500 -- (-1654.432) [-1658.807] (-1656.441) (-1657.305) * (-1655.870) (-1653.940) [-1654.642] (-1654.797) -- 0:00:51
      202000 -- (-1653.531) [-1655.222] (-1654.391) (-1659.079) * (-1655.028) [-1656.665] (-1654.427) (-1658.509) -- 0:00:51
      202500 -- (-1653.461) (-1657.039) (-1654.363) [-1655.737] * [-1654.307] (-1656.139) (-1654.622) (-1654.382) -- 0:00:51
      203000 -- (-1653.443) (-1654.961) (-1655.025) [-1657.929] * (-1657.484) [-1654.639] (-1654.554) (-1657.322) -- 0:00:51
      203500 -- (-1655.401) (-1654.097) [-1654.860] (-1655.635) * (-1653.885) (-1655.873) [-1653.692] (-1655.101) -- 0:00:50
      204000 -- (-1655.425) [-1654.038] (-1654.560) (-1657.307) * (-1655.347) [-1654.840] (-1654.967) (-1653.815) -- 0:00:50
      204500 -- [-1655.358] (-1653.768) (-1655.475) (-1657.353) * [-1654.208] (-1654.631) (-1654.985) (-1654.411) -- 0:00:50
      205000 -- [-1655.598] (-1657.554) (-1655.323) (-1656.908) * (-1654.149) (-1654.698) [-1655.004] (-1655.259) -- 0:00:50

      Average standard deviation of split frequencies: 0.019752

      205500 -- (-1656.787) [-1657.891] (-1655.683) (-1655.047) * (-1655.145) (-1654.937) [-1653.979] (-1657.390) -- 0:00:50
      206000 -- [-1657.103] (-1657.414) (-1655.901) (-1655.275) * [-1655.299] (-1656.029) (-1653.999) (-1655.560) -- 0:00:50
      206500 -- (-1655.707) [-1659.447] (-1655.158) (-1655.404) * (-1655.709) [-1658.096] (-1654.706) (-1655.160) -- 0:00:53
      207000 -- (-1657.021) (-1660.402) [-1655.903] (-1655.398) * (-1659.157) (-1656.042) (-1653.957) [-1657.206] -- 0:00:53
      207500 -- (-1655.220) (-1654.194) [-1655.806] (-1653.595) * (-1655.934) (-1658.172) [-1655.022] (-1657.172) -- 0:00:53
      208000 -- (-1654.363) (-1653.990) [-1655.430] (-1655.771) * (-1657.151) (-1654.639) (-1654.984) [-1655.121] -- 0:00:53
      208500 -- (-1654.786) [-1653.279] (-1655.416) (-1655.984) * (-1656.582) [-1655.033] (-1659.667) (-1656.730) -- 0:00:53
      209000 -- (-1653.850) (-1653.623) [-1656.696] (-1654.632) * (-1656.938) [-1654.657] (-1657.377) (-1661.445) -- 0:00:52
      209500 -- [-1653.575] (-1655.856) (-1659.913) (-1656.845) * (-1657.301) (-1656.861) [-1657.442] (-1655.309) -- 0:00:52
      210000 -- (-1657.061) (-1655.923) (-1659.339) [-1656.704] * (-1656.581) (-1656.104) (-1655.840) [-1654.895] -- 0:00:52

      Average standard deviation of split frequencies: 0.021317

      210500 -- (-1654.422) [-1654.078] (-1656.669) (-1655.086) * [-1653.874] (-1655.643) (-1658.355) (-1656.326) -- 0:00:52
      211000 -- (-1654.946) (-1655.068) (-1655.551) [-1653.786] * [-1653.928] (-1655.749) (-1661.132) (-1653.769) -- 0:00:52
      211500 -- (-1654.716) (-1655.979) [-1660.222] (-1655.618) * [-1656.651] (-1657.673) (-1657.971) (-1654.900) -- 0:00:52
      212000 -- (-1654.440) [-1655.578] (-1657.015) (-1658.157) * (-1655.330) [-1654.868] (-1660.399) (-1655.291) -- 0:00:52
      212500 -- [-1657.989] (-1660.849) (-1656.012) (-1658.324) * [-1656.931] (-1655.057) (-1660.045) (-1654.805) -- 0:00:51
      213000 -- (-1657.634) (-1660.511) [-1657.074] (-1656.594) * (-1659.193) (-1662.335) [-1658.645] (-1655.504) -- 0:00:51
      213500 -- (-1659.066) [-1654.550] (-1657.253) (-1656.623) * [-1656.601] (-1658.909) (-1657.295) (-1654.176) -- 0:00:51
      214000 -- (-1655.871) (-1653.639) [-1655.383] (-1653.742) * [-1655.003] (-1654.712) (-1656.243) (-1658.265) -- 0:00:51
      214500 -- [-1655.642] (-1654.753) (-1655.392) (-1654.697) * [-1656.251] (-1654.612) (-1659.411) (-1657.356) -- 0:00:51
      215000 -- (-1655.280) (-1657.615) (-1655.619) [-1659.772] * (-1654.876) (-1654.061) (-1657.408) [-1656.337] -- 0:00:51

      Average standard deviation of split frequencies: 0.021939

      215500 -- [-1654.871] (-1657.473) (-1655.366) (-1657.130) * [-1655.584] (-1654.570) (-1658.791) (-1656.096) -- 0:00:50
      216000 -- (-1655.909) (-1657.388) (-1655.507) [-1655.346] * [-1655.265] (-1653.970) (-1660.251) (-1660.736) -- 0:00:50
      216500 -- (-1656.688) [-1657.838] (-1655.365) (-1654.664) * [-1655.891] (-1654.956) (-1660.070) (-1655.791) -- 0:00:50
      217000 -- (-1656.131) [-1657.099] (-1656.808) (-1656.947) * [-1660.383] (-1654.933) (-1657.842) (-1656.440) -- 0:00:50
      217500 -- (-1655.988) (-1656.665) [-1658.419] (-1655.593) * [-1656.122] (-1654.205) (-1659.275) (-1657.579) -- 0:00:50
      218000 -- [-1656.236] (-1655.937) (-1655.851) (-1657.489) * (-1655.229) [-1655.046] (-1657.317) (-1659.969) -- 0:00:50
      218500 -- [-1659.174] (-1656.052) (-1655.016) (-1655.359) * (-1659.838) (-1655.128) [-1655.449] (-1654.892) -- 0:00:50
      219000 -- (-1658.512) (-1656.654) (-1654.804) [-1656.844] * (-1658.391) [-1656.934] (-1657.648) (-1654.791) -- 0:00:49
      219500 -- (-1654.973) [-1656.640] (-1657.116) (-1656.141) * (-1656.323) (-1654.825) [-1656.135] (-1654.187) -- 0:00:49
      220000 -- (-1654.144) (-1657.259) [-1654.187] (-1655.485) * (-1656.791) (-1654.472) [-1657.239] (-1653.731) -- 0:00:49

      Average standard deviation of split frequencies: 0.022150

      220500 -- [-1655.998] (-1656.045) (-1656.850) (-1655.160) * (-1658.867) (-1654.559) (-1657.509) [-1655.260] -- 0:00:49
      221000 -- (-1655.242) (-1655.627) (-1654.483) [-1656.004] * (-1658.472) [-1658.084] (-1660.083) (-1654.516) -- 0:00:49
      221500 -- (-1655.303) [-1657.194] (-1655.243) (-1654.453) * (-1655.716) [-1656.103] (-1656.441) (-1656.342) -- 0:00:49
      222000 -- [-1655.002] (-1654.303) (-1653.504) (-1655.031) * [-1654.437] (-1660.646) (-1655.687) (-1654.510) -- 0:00:49
      222500 -- [-1658.718] (-1653.854) (-1654.288) (-1655.196) * [-1654.592] (-1657.747) (-1655.587) (-1654.521) -- 0:00:52
      223000 -- (-1657.447) (-1654.938) (-1654.191) [-1654.675] * (-1656.204) [-1654.791] (-1658.844) (-1654.090) -- 0:00:52
      223500 -- (-1656.942) (-1653.909) [-1656.728] (-1653.866) * (-1657.083) (-1654.397) (-1658.107) [-1654.221] -- 0:00:52
      224000 -- (-1655.445) (-1653.813) (-1654.217) [-1655.277] * [-1656.851] (-1656.894) (-1660.056) (-1656.190) -- 0:00:51
      224500 -- (-1655.797) (-1656.009) [-1657.399] (-1657.638) * (-1659.158) [-1655.833] (-1666.793) (-1656.115) -- 0:00:51
      225000 -- (-1656.749) (-1656.488) (-1659.690) [-1656.043] * (-1654.393) (-1657.301) (-1662.002) [-1657.490] -- 0:00:51

      Average standard deviation of split frequencies: 0.023384

      225500 -- [-1656.857] (-1656.322) (-1656.977) (-1654.192) * (-1658.975) (-1656.761) [-1654.978] (-1658.127) -- 0:00:51
      226000 -- (-1656.318) (-1654.547) (-1654.499) [-1654.865] * (-1656.099) (-1655.067) [-1653.652] (-1656.673) -- 0:00:51
      226500 -- (-1658.624) (-1654.677) (-1653.866) [-1657.072] * (-1658.314) (-1657.365) (-1654.110) [-1655.079] -- 0:00:51
      227000 -- [-1658.255] (-1655.476) (-1653.863) (-1658.126) * (-1657.371) [-1657.274] (-1654.115) (-1654.837) -- 0:00:51
      227500 -- (-1654.072) (-1659.134) [-1654.151] (-1658.340) * (-1655.395) (-1655.733) (-1654.016) [-1655.873] -- 0:00:50
      228000 -- (-1654.239) (-1653.793) (-1663.654) [-1658.584] * (-1659.913) (-1654.315) [-1656.100] (-1655.441) -- 0:00:50
      228500 -- (-1653.762) (-1657.627) (-1656.129) [-1655.495] * (-1657.815) (-1656.736) [-1656.673] (-1655.759) -- 0:00:50
      229000 -- [-1653.627] (-1656.623) (-1654.009) (-1657.564) * (-1658.617) (-1660.942) [-1658.668] (-1657.063) -- 0:00:50
      229500 -- (-1657.454) [-1653.264] (-1654.965) (-1655.701) * (-1659.768) (-1655.394) (-1660.675) [-1656.738] -- 0:00:50
      230000 -- (-1655.328) [-1655.044] (-1653.730) (-1653.835) * [-1655.734] (-1655.145) (-1655.705) (-1659.795) -- 0:00:50

      Average standard deviation of split frequencies: 0.022158

      230500 -- (-1654.389) (-1654.388) [-1655.078] (-1654.392) * (-1655.781) [-1654.194] (-1658.898) (-1663.447) -- 0:00:50
      231000 -- (-1654.905) (-1654.936) [-1655.469] (-1654.287) * (-1656.921) (-1654.329) [-1657.984] (-1661.339) -- 0:00:49
      231500 -- (-1655.438) (-1657.149) (-1653.850) [-1654.059] * (-1654.945) (-1655.177) (-1659.190) [-1655.974] -- 0:00:49
      232000 -- (-1657.356) (-1655.698) (-1653.850) [-1654.093] * [-1653.607] (-1656.862) (-1657.056) (-1655.761) -- 0:00:49
      232500 -- (-1655.747) (-1655.826) [-1656.032] (-1655.631) * [-1654.162] (-1656.333) (-1655.735) (-1661.186) -- 0:00:49
      233000 -- [-1653.818] (-1662.958) (-1656.632) (-1655.595) * (-1654.697) (-1656.269) (-1655.872) [-1655.685] -- 0:00:49
      233500 -- (-1653.418) (-1657.399) (-1655.819) [-1656.886] * (-1658.060) [-1655.229] (-1659.392) (-1655.188) -- 0:00:49
      234000 -- (-1655.699) (-1656.990) (-1654.775) [-1655.973] * (-1658.112) (-1655.620) [-1662.269] (-1657.582) -- 0:00:49
      234500 -- [-1660.541] (-1653.350) (-1654.718) (-1658.135) * (-1656.775) (-1655.655) (-1659.483) [-1655.826] -- 0:00:48
      235000 -- (-1657.939) (-1655.193) [-1656.669] (-1657.669) * (-1655.461) (-1654.587) (-1653.938) [-1655.028] -- 0:00:48

      Average standard deviation of split frequencies: 0.022077

      235500 -- (-1654.460) [-1656.157] (-1655.995) (-1659.031) * [-1654.538] (-1654.724) (-1655.425) (-1656.266) -- 0:00:48
      236000 -- (-1655.312) (-1653.347) (-1654.008) [-1656.312] * (-1655.092) (-1655.877) [-1653.724] (-1653.966) -- 0:00:48
      236500 -- (-1654.358) (-1654.159) (-1655.151) [-1654.557] * [-1653.488] (-1656.473) (-1654.221) (-1653.816) -- 0:00:48
      237000 -- (-1655.501) (-1657.134) (-1655.159) [-1655.555] * (-1653.729) [-1657.161] (-1654.159) (-1658.679) -- 0:00:48
      237500 -- (-1654.708) (-1655.976) (-1654.796) [-1657.320] * (-1654.597) (-1657.178) (-1654.135) [-1653.939] -- 0:00:48
      238000 -- (-1653.973) (-1655.768) (-1654.531) [-1653.996] * (-1654.391) (-1664.458) (-1654.209) [-1654.484] -- 0:00:51
      238500 -- [-1654.199] (-1656.294) (-1654.299) (-1655.506) * [-1656.361] (-1659.465) (-1661.130) (-1656.381) -- 0:00:51
      239000 -- (-1654.835) (-1657.599) (-1655.443) [-1655.419] * (-1655.001) [-1656.407] (-1660.517) (-1654.628) -- 0:00:50
      239500 -- [-1655.006] (-1661.693) (-1655.568) (-1655.186) * (-1655.836) (-1653.869) (-1658.007) [-1653.743] -- 0:00:50
      240000 -- [-1656.554] (-1655.541) (-1655.585) (-1654.915) * (-1654.461) (-1656.229) (-1658.720) [-1656.457] -- 0:00:50

      Average standard deviation of split frequencies: 0.023711

      240500 -- [-1655.647] (-1654.394) (-1654.831) (-1654.266) * [-1653.745] (-1655.807) (-1659.790) (-1657.519) -- 0:00:50
      241000 -- [-1653.475] (-1659.558) (-1656.329) (-1656.501) * (-1653.756) [-1655.474] (-1657.765) (-1655.923) -- 0:00:50
      241500 -- [-1653.574] (-1660.105) (-1658.125) (-1655.247) * (-1653.676) (-1656.256) [-1656.112] (-1655.793) -- 0:00:50
      242000 -- (-1654.552) [-1655.144] (-1658.328) (-1656.550) * (-1657.232) [-1653.673] (-1654.713) (-1656.625) -- 0:00:50
      242500 -- (-1655.782) (-1656.044) [-1655.597] (-1654.386) * [-1657.899] (-1656.599) (-1655.598) (-1657.857) -- 0:00:49
      243000 -- (-1654.496) (-1655.431) (-1659.462) [-1654.375] * (-1657.701) (-1654.555) (-1657.428) [-1655.034] -- 0:00:49
      243500 -- [-1655.433] (-1657.380) (-1658.245) (-1657.757) * (-1654.834) [-1655.728] (-1658.257) (-1654.147) -- 0:00:49
      244000 -- (-1660.043) [-1655.957] (-1657.852) (-1659.058) * (-1658.347) [-1654.757] (-1657.244) (-1654.423) -- 0:00:49
      244500 -- (-1656.185) (-1654.392) [-1657.534] (-1658.722) * (-1663.312) [-1655.519] (-1654.550) (-1659.233) -- 0:00:49
      245000 -- (-1654.343) (-1655.993) (-1656.910) [-1656.188] * (-1656.804) [-1656.106] (-1657.256) (-1659.879) -- 0:00:49

      Average standard deviation of split frequencies: 0.022083

      245500 -- (-1654.485) (-1655.111) (-1657.797) [-1653.979] * [-1659.660] (-1657.051) (-1656.462) (-1656.157) -- 0:00:49
      246000 -- (-1656.378) (-1654.284) [-1657.734] (-1654.215) * (-1660.340) (-1654.603) [-1655.354] (-1654.108) -- 0:00:49
      246500 -- (-1655.741) (-1657.078) [-1659.577] (-1654.465) * (-1659.214) (-1654.147) [-1654.939] (-1654.425) -- 0:00:48
      247000 -- (-1656.274) [-1655.625] (-1655.613) (-1653.931) * (-1654.770) (-1654.527) [-1656.247] (-1655.759) -- 0:00:48
      247500 -- (-1659.245) [-1655.973] (-1661.548) (-1654.344) * (-1655.166) [-1655.835] (-1655.157) (-1656.019) -- 0:00:48
      248000 -- [-1658.836] (-1654.950) (-1658.166) (-1656.864) * (-1657.912) (-1656.529) [-1654.735] (-1655.768) -- 0:00:48
      248500 -- (-1656.332) (-1655.777) (-1657.587) [-1655.275] * [-1654.768] (-1653.352) (-1655.908) (-1655.142) -- 0:00:48
      249000 -- (-1656.492) [-1654.022] (-1655.466) (-1667.069) * (-1653.654) (-1655.240) [-1656.033] (-1658.362) -- 0:00:48
      249500 -- (-1654.236) [-1653.685] (-1656.618) (-1662.454) * (-1656.276) (-1655.296) (-1659.360) [-1654.693] -- 0:00:48
      250000 -- (-1654.083) (-1657.656) (-1657.731) [-1654.382] * [-1654.431] (-1657.372) (-1659.519) (-1656.905) -- 0:00:48

      Average standard deviation of split frequencies: 0.023062

      250500 -- (-1654.585) (-1655.377) [-1655.426] (-1654.382) * [-1655.984] (-1655.268) (-1657.470) (-1656.774) -- 0:00:47
      251000 -- (-1658.378) [-1654.323] (-1654.739) (-1655.535) * (-1657.104) (-1655.800) [-1654.691] (-1654.294) -- 0:00:47
      251500 -- (-1659.489) [-1653.674] (-1656.213) (-1655.307) * [-1655.979] (-1655.939) (-1654.439) (-1653.488) -- 0:00:47
      252000 -- (-1659.979) (-1656.685) [-1656.774] (-1657.063) * (-1656.226) (-1654.189) [-1653.377] (-1659.074) -- 0:00:47
      252500 -- [-1658.860] (-1656.204) (-1657.801) (-1654.311) * (-1658.361) [-1654.162] (-1655.556) (-1654.208) -- 0:00:47
      253000 -- (-1659.977) [-1655.891] (-1657.145) (-1653.708) * (-1656.837) [-1654.274] (-1656.713) (-1655.106) -- 0:00:47
      253500 -- [-1654.106] (-1655.802) (-1656.164) (-1654.205) * (-1654.905) [-1653.444] (-1658.338) (-1655.738) -- 0:00:47
      254000 -- (-1655.334) (-1654.195) (-1658.284) [-1658.163] * (-1654.592) [-1656.886] (-1653.703) (-1654.318) -- 0:00:49
      254500 -- (-1655.741) (-1657.163) (-1656.647) [-1653.615] * (-1655.664) (-1656.169) [-1656.139] (-1654.302) -- 0:00:49
      255000 -- (-1656.180) (-1657.252) (-1661.612) [-1653.797] * (-1654.587) (-1656.480) [-1654.562] (-1655.628) -- 0:00:49

      Average standard deviation of split frequencies: 0.022609

      255500 -- (-1656.304) [-1656.125] (-1660.662) (-1653.653) * (-1655.346) (-1656.945) (-1654.275) [-1662.355] -- 0:00:49
      256000 -- (-1656.030) [-1657.106] (-1653.895) (-1654.258) * (-1654.366) (-1657.165) (-1655.280) [-1657.039] -- 0:00:49
      256500 -- [-1656.412] (-1656.525) (-1655.694) (-1653.935) * [-1654.711] (-1655.312) (-1657.816) (-1655.410) -- 0:00:49
      257000 -- (-1655.718) (-1661.629) (-1656.466) [-1653.555] * (-1653.361) [-1655.257] (-1662.740) (-1654.989) -- 0:00:49
      257500 -- [-1656.572] (-1661.805) (-1662.526) (-1660.979) * (-1653.797) (-1654.916) (-1655.714) [-1654.880] -- 0:00:49
      258000 -- (-1656.167) [-1658.291] (-1659.874) (-1655.532) * (-1654.890) (-1655.954) [-1653.748] (-1654.927) -- 0:00:48
      258500 -- (-1657.044) [-1656.511] (-1660.491) (-1657.445) * (-1654.891) (-1658.336) (-1654.265) [-1655.073] -- 0:00:48
      259000 -- [-1661.292] (-1657.055) (-1657.866) (-1655.310) * (-1655.144) [-1656.123] (-1655.913) (-1654.796) -- 0:00:48
      259500 -- (-1657.737) (-1656.069) (-1655.827) [-1655.853] * [-1656.465] (-1654.668) (-1655.891) (-1654.142) -- 0:00:48
      260000 -- [-1657.979] (-1657.226) (-1656.801) (-1654.957) * (-1655.231) (-1654.656) [-1654.527] (-1654.336) -- 0:00:48

      Average standard deviation of split frequencies: 0.020750

      260500 -- (-1654.453) (-1660.714) (-1659.519) [-1655.077] * (-1655.080) [-1654.785] (-1654.927) (-1654.147) -- 0:00:48
      261000 -- (-1655.517) [-1656.814] (-1660.564) (-1655.011) * (-1653.919) (-1656.955) (-1655.275) [-1655.161] -- 0:00:48
      261500 -- (-1653.403) (-1654.600) (-1656.181) [-1655.593] * (-1656.080) [-1655.976] (-1654.990) (-1656.799) -- 0:00:48
      262000 -- (-1662.221) (-1654.947) (-1658.235) [-1654.582] * (-1658.171) (-1654.904) [-1654.816] (-1653.632) -- 0:00:47
      262500 -- [-1657.873] (-1655.601) (-1657.862) (-1653.925) * (-1656.154) (-1654.529) [-1653.888] (-1655.974) -- 0:00:47
      263000 -- [-1656.626] (-1656.529) (-1655.515) (-1659.709) * (-1655.162) [-1655.238] (-1656.027) (-1654.569) -- 0:00:47
      263500 -- [-1655.133] (-1657.571) (-1654.001) (-1656.423) * [-1654.786] (-1655.266) (-1662.643) (-1653.907) -- 0:00:47
      264000 -- (-1655.398) (-1659.249) (-1654.722) [-1655.636] * (-1658.673) [-1653.648] (-1661.842) (-1655.899) -- 0:00:47
      264500 -- (-1654.379) (-1662.516) [-1657.412] (-1655.573) * (-1655.999) [-1653.832] (-1656.820) (-1653.961) -- 0:00:47
      265000 -- (-1656.567) [-1658.689] (-1655.863) (-1656.721) * [-1653.619] (-1654.147) (-1656.652) (-1656.158) -- 0:00:47

      Average standard deviation of split frequencies: 0.019849

      265500 -- (-1657.976) (-1653.899) [-1653.646] (-1655.044) * (-1653.484) (-1657.104) (-1653.880) [-1654.546] -- 0:00:47
      266000 -- (-1659.183) (-1653.611) (-1653.617) [-1655.436] * (-1658.887) (-1655.444) (-1656.885) [-1655.344] -- 0:00:46
      266500 -- (-1658.903) (-1657.670) (-1658.636) [-1656.889] * (-1662.829) (-1654.745) (-1656.794) [-1654.045] -- 0:00:46
      267000 -- (-1657.680) (-1659.794) [-1654.218] (-1656.544) * (-1657.208) [-1653.442] (-1656.893) (-1654.037) -- 0:00:46
      267500 -- [-1654.452] (-1653.690) (-1654.824) (-1657.115) * (-1655.887) [-1654.044] (-1654.155) (-1654.017) -- 0:00:46
      268000 -- (-1655.609) (-1654.658) (-1655.031) [-1656.889] * (-1657.369) [-1655.459] (-1655.300) (-1653.718) -- 0:00:46
      268500 -- (-1657.423) [-1654.590] (-1654.122) (-1655.145) * (-1655.433) [-1654.187] (-1654.327) (-1655.724) -- 0:00:46
      269000 -- (-1658.968) (-1655.970) (-1655.316) [-1656.947] * (-1656.012) [-1655.373] (-1656.100) (-1654.719) -- 0:00:48
      269500 -- (-1655.089) [-1653.863] (-1654.808) (-1656.019) * (-1654.150) (-1655.798) [-1661.677] (-1655.007) -- 0:00:48
      270000 -- [-1653.866] (-1653.975) (-1655.733) (-1654.457) * (-1655.830) (-1655.594) [-1657.155] (-1655.854) -- 0:00:48

      Average standard deviation of split frequencies: 0.020258

      270500 -- (-1657.398) [-1654.385] (-1658.959) (-1656.249) * [-1653.287] (-1655.535) (-1656.317) (-1656.647) -- 0:00:48
      271000 -- (-1656.463) (-1653.480) [-1654.014] (-1658.548) * (-1653.356) [-1657.259] (-1656.403) (-1656.965) -- 0:00:48
      271500 -- (-1654.432) (-1653.964) (-1653.547) [-1656.388] * (-1654.276) (-1654.222) [-1655.952] (-1658.015) -- 0:00:48
      272000 -- (-1655.072) (-1655.295) [-1658.167] (-1657.822) * (-1655.513) (-1655.930) [-1654.106] (-1657.837) -- 0:00:48
      272500 -- (-1659.885) [-1653.965] (-1653.874) (-1657.919) * (-1656.277) (-1654.473) [-1654.192] (-1655.987) -- 0:00:48
      273000 -- (-1658.443) (-1653.868) (-1655.883) [-1656.412] * (-1656.524) (-1654.864) [-1655.964] (-1657.737) -- 0:00:47
      273500 -- (-1657.693) [-1655.203] (-1657.718) (-1654.300) * (-1661.471) [-1655.334] (-1655.417) (-1655.719) -- 0:00:47
      274000 -- [-1654.828] (-1657.216) (-1655.500) (-1653.702) * (-1655.120) (-1657.935) (-1658.113) [-1655.816] -- 0:00:47
      274500 -- (-1654.216) [-1660.593] (-1660.911) (-1658.381) * (-1655.568) [-1654.574] (-1656.322) (-1656.582) -- 0:00:47
      275000 -- (-1655.131) (-1655.008) [-1654.575] (-1656.970) * [-1654.910] (-1660.580) (-1656.565) (-1656.833) -- 0:00:47

      Average standard deviation of split frequencies: 0.018338

      275500 -- (-1656.968) (-1654.566) [-1655.232] (-1654.241) * (-1656.962) [-1658.801] (-1656.934) (-1656.490) -- 0:00:47
      276000 -- [-1655.886] (-1654.267) (-1655.805) (-1654.613) * (-1655.157) (-1664.643) (-1657.664) [-1653.426] -- 0:00:47
      276500 -- [-1654.400] (-1653.941) (-1654.240) (-1654.943) * (-1654.941) (-1656.640) [-1658.034] (-1653.636) -- 0:00:47
      277000 -- (-1655.957) (-1654.809) [-1655.678] (-1653.564) * (-1654.287) (-1654.328) [-1654.893] (-1655.283) -- 0:00:46
      277500 -- (-1655.736) (-1653.688) (-1654.239) [-1654.110] * (-1654.340) (-1655.213) [-1656.462] (-1655.405) -- 0:00:46
      278000 -- (-1655.731) (-1653.512) (-1656.271) [-1658.632] * (-1655.224) (-1654.324) (-1658.763) [-1653.962] -- 0:00:46
      278500 -- (-1654.738) (-1654.399) [-1653.902] (-1656.180) * (-1654.660) (-1653.875) [-1657.975] (-1660.736) -- 0:00:46
      279000 -- (-1654.500) (-1654.339) [-1654.132] (-1655.521) * (-1658.674) [-1655.236] (-1662.845) (-1663.442) -- 0:00:46
      279500 -- (-1654.486) [-1654.339] (-1654.728) (-1657.311) * (-1658.811) (-1653.528) (-1655.770) [-1654.279] -- 0:00:46
      280000 -- (-1655.555) (-1656.402) [-1654.262] (-1658.120) * (-1655.998) (-1653.528) [-1655.724] (-1654.518) -- 0:00:46

      Average standard deviation of split frequencies: 0.016973

      280500 -- (-1654.473) (-1658.750) (-1655.677) [-1655.125] * [-1655.236] (-1653.535) (-1656.060) (-1654.705) -- 0:00:46
      281000 -- (-1655.079) (-1656.306) [-1657.114] (-1655.781) * (-1654.130) (-1654.659) (-1656.744) [-1653.894] -- 0:00:46
      281500 -- (-1657.898) [-1656.065] (-1657.041) (-1656.491) * (-1655.711) (-1656.054) (-1656.623) [-1655.570] -- 0:00:45
      282000 -- (-1654.842) [-1656.189] (-1656.459) (-1655.564) * [-1653.919] (-1655.947) (-1661.082) (-1656.173) -- 0:00:45
      282500 -- (-1658.320) (-1655.199) (-1656.395) [-1655.233] * (-1654.083) (-1655.665) (-1657.831) [-1657.189] -- 0:00:45
      283000 -- [-1653.893] (-1656.938) (-1655.453) (-1655.323) * (-1654.277) (-1655.608) [-1656.707] (-1659.111) -- 0:00:45
      283500 -- (-1657.884) (-1654.769) (-1655.722) [-1657.901] * [-1655.153] (-1653.798) (-1655.542) (-1655.206) -- 0:00:45
      284000 -- (-1654.119) (-1655.602) (-1655.581) [-1655.228] * [-1658.923] (-1653.354) (-1654.126) (-1656.605) -- 0:00:45
      284500 -- (-1654.315) (-1655.244) [-1655.555] (-1662.232) * [-1656.387] (-1656.047) (-1654.776) (-1655.869) -- 0:00:47
      285000 -- [-1655.262] (-1654.522) (-1656.347) (-1655.334) * (-1653.671) (-1654.661) (-1654.611) [-1654.879] -- 0:00:47

      Average standard deviation of split frequencies: 0.014748

      285500 -- (-1656.928) (-1654.330) (-1655.580) [-1654.923] * (-1657.172) (-1657.954) (-1655.565) [-1658.082] -- 0:00:47
      286000 -- [-1655.914] (-1654.283) (-1656.006) (-1655.541) * (-1659.709) [-1656.826] (-1655.810) (-1655.019) -- 0:00:47
      286500 -- [-1655.507] (-1654.340) (-1655.174) (-1656.764) * (-1657.833) (-1659.053) [-1656.209] (-1655.689) -- 0:00:47
      287000 -- (-1654.312) (-1653.721) (-1655.442) [-1655.409] * (-1655.534) (-1654.635) (-1654.531) [-1658.024] -- 0:00:47
      287500 -- (-1656.313) [-1654.921] (-1656.146) (-1654.488) * (-1657.867) (-1653.547) [-1655.894] (-1659.012) -- 0:00:47
      288000 -- [-1657.422] (-1655.347) (-1656.786) (-1655.341) * (-1657.761) (-1653.470) (-1654.610) [-1655.874] -- 0:00:46
      288500 -- [-1654.033] (-1655.827) (-1655.604) (-1654.542) * [-1653.960] (-1653.444) (-1654.898) (-1655.965) -- 0:00:46
      289000 -- [-1656.240] (-1655.821) (-1655.235) (-1656.176) * (-1655.289) (-1654.543) [-1655.911] (-1655.968) -- 0:00:46
      289500 -- (-1658.298) [-1655.821] (-1655.841) (-1654.200) * (-1655.483) (-1658.188) [-1654.665] (-1654.672) -- 0:00:46
      290000 -- (-1658.180) (-1655.821) [-1656.903] (-1654.771) * (-1654.062) (-1657.217) [-1654.823] (-1655.289) -- 0:00:46

      Average standard deviation of split frequencies: 0.015587

      290500 -- [-1653.963] (-1656.855) (-1658.312) (-1657.997) * (-1654.419) (-1654.428) (-1658.797) [-1655.386] -- 0:00:46
      291000 -- [-1653.870] (-1654.200) (-1655.820) (-1655.841) * (-1654.619) (-1655.011) [-1655.566] (-1655.816) -- 0:00:46
      291500 -- (-1653.850) (-1657.056) (-1654.642) [-1655.421] * (-1655.257) (-1654.220) [-1660.570] (-1655.839) -- 0:00:46
      292000 -- (-1657.124) [-1657.070] (-1653.958) (-1654.772) * (-1656.186) [-1654.458] (-1654.589) (-1654.809) -- 0:00:46
      292500 -- (-1658.465) [-1655.976] (-1655.628) (-1654.412) * [-1655.389] (-1655.248) (-1654.589) (-1657.259) -- 0:00:45
      293000 -- [-1655.164] (-1656.032) (-1655.786) (-1654.265) * [-1653.845] (-1657.554) (-1658.441) (-1658.061) -- 0:00:45
      293500 -- [-1656.589] (-1655.828) (-1656.538) (-1654.237) * (-1656.970) (-1656.945) [-1655.394] (-1655.305) -- 0:00:45
      294000 -- (-1656.063) (-1656.765) (-1660.137) [-1655.222] * (-1661.344) (-1655.065) (-1657.090) [-1654.640] -- 0:00:45
      294500 -- (-1654.255) (-1655.354) [-1656.489] (-1654.497) * [-1655.309] (-1659.640) (-1657.405) (-1659.406) -- 0:00:45
      295000 -- (-1656.804) (-1655.098) [-1653.974] (-1653.273) * (-1654.745) (-1658.555) (-1656.279) [-1654.837] -- 0:00:45

      Average standard deviation of split frequencies: 0.015826

      295500 -- (-1655.274) (-1655.097) (-1655.270) [-1654.509] * [-1655.959] (-1657.422) (-1658.143) (-1654.462) -- 0:00:45
      296000 -- (-1656.105) (-1654.689) [-1655.931] (-1654.573) * (-1657.914) [-1657.029] (-1656.050) (-1654.701) -- 0:00:45
      296500 -- (-1658.537) [-1656.863] (-1659.159) (-1654.496) * (-1655.710) [-1653.727] (-1656.012) (-1654.826) -- 0:00:45
      297000 -- (-1656.118) (-1655.691) (-1665.468) [-1655.933] * (-1656.745) [-1653.801] (-1654.154) (-1657.613) -- 0:00:44
      297500 -- (-1657.689) (-1655.151) [-1659.139] (-1655.408) * (-1656.972) (-1653.906) (-1655.243) [-1656.593] -- 0:00:44
      298000 -- (-1656.815) (-1658.725) (-1659.161) [-1655.736] * (-1659.178) [-1653.873] (-1658.821) (-1654.696) -- 0:00:44
      298500 -- (-1655.404) [-1657.500] (-1654.664) (-1660.150) * (-1654.253) (-1654.028) (-1656.178) [-1654.920] -- 0:00:44
      299000 -- (-1657.034) (-1657.568) [-1658.685] (-1654.716) * (-1656.514) [-1654.655] (-1654.489) (-1656.749) -- 0:00:44
      299500 -- (-1653.917) (-1657.568) (-1658.241) [-1654.294] * (-1656.818) [-1654.316] (-1654.471) (-1656.193) -- 0:00:44
      300000 -- (-1653.917) (-1655.483) (-1660.743) [-1654.920] * (-1657.187) [-1654.365] (-1655.648) (-1658.428) -- 0:00:44

      Average standard deviation of split frequencies: 0.015875

      300500 -- (-1654.753) (-1655.226) [-1657.379] (-1656.500) * (-1656.247) [-1654.684] (-1654.640) (-1656.221) -- 0:00:46
      301000 -- (-1654.189) [-1656.729] (-1656.683) (-1658.108) * [-1656.092] (-1655.466) (-1656.577) (-1655.384) -- 0:00:46
      301500 -- [-1655.135] (-1656.489) (-1657.845) (-1658.209) * [-1654.642] (-1655.759) (-1656.537) (-1657.093) -- 0:00:46
      302000 -- [-1656.347] (-1656.065) (-1655.946) (-1655.987) * [-1654.726] (-1656.377) (-1658.933) (-1655.082) -- 0:00:46
      302500 -- (-1654.745) (-1654.271) [-1654.383] (-1654.022) * [-1656.813] (-1654.410) (-1658.073) (-1655.702) -- 0:00:46
      303000 -- (-1659.026) (-1655.281) (-1656.132) [-1653.919] * (-1655.338) (-1653.760) (-1655.874) [-1659.007] -- 0:00:46
      303500 -- (-1655.983) [-1657.520] (-1654.862) (-1654.797) * (-1654.941) (-1654.425) [-1657.204] (-1655.181) -- 0:00:45
      304000 -- (-1656.337) [-1656.819] (-1654.823) (-1654.987) * (-1657.104) [-1654.328] (-1655.279) (-1660.008) -- 0:00:45
      304500 -- (-1656.153) (-1657.937) [-1654.568] (-1659.690) * (-1658.626) (-1655.648) [-1655.077] (-1656.469) -- 0:00:45
      305000 -- (-1657.989) [-1661.235] (-1657.157) (-1661.357) * (-1657.666) (-1655.641) (-1655.933) [-1654.101] -- 0:00:45

      Average standard deviation of split frequencies: 0.016221

      305500 -- [-1654.756] (-1654.776) (-1654.245) (-1656.542) * (-1655.626) (-1659.188) [-1655.204] (-1658.239) -- 0:00:45
      306000 -- (-1659.254) [-1654.115] (-1654.243) (-1658.258) * [-1654.558] (-1655.608) (-1654.471) (-1655.162) -- 0:00:45
      306500 -- (-1655.235) (-1655.484) [-1653.673] (-1656.405) * (-1656.292) [-1656.091] (-1655.487) (-1653.922) -- 0:00:45
      307000 -- (-1654.916) (-1655.283) [-1654.429] (-1656.983) * (-1658.030) [-1655.235] (-1654.453) (-1653.484) -- 0:00:45
      307500 -- [-1653.909] (-1654.624) (-1653.818) (-1656.557) * (-1657.318) [-1655.585] (-1655.358) (-1654.176) -- 0:00:45
      308000 -- (-1654.260) (-1654.433) (-1656.083) [-1658.896] * (-1658.181) (-1656.968) (-1656.693) [-1654.081] -- 0:00:44
      308500 -- [-1654.140] (-1654.631) (-1654.060) (-1654.072) * (-1656.001) (-1654.284) (-1656.956) [-1654.761] -- 0:00:44
      309000 -- (-1654.554) [-1655.625] (-1655.233) (-1654.054) * [-1656.026] (-1653.916) (-1656.210) (-1655.684) -- 0:00:44
      309500 -- (-1654.332) (-1655.325) (-1658.389) [-1654.520] * [-1654.649] (-1656.149) (-1654.119) (-1654.368) -- 0:00:44
      310000 -- (-1655.125) [-1655.216] (-1655.346) (-1655.804) * (-1653.579) (-1656.824) [-1654.236] (-1654.123) -- 0:00:44

      Average standard deviation of split frequencies: 0.015090

      310500 -- (-1655.256) [-1654.371] (-1655.677) (-1653.906) * (-1654.714) (-1654.745) (-1655.891) [-1655.194] -- 0:00:44
      311000 -- (-1655.320) (-1654.140) (-1655.139) [-1655.209] * (-1657.309) (-1654.652) [-1656.746] (-1654.622) -- 0:00:44
      311500 -- [-1657.131] (-1654.570) (-1653.714) (-1656.131) * [-1654.621] (-1656.392) (-1654.885) (-1659.084) -- 0:00:44
      312000 -- (-1656.325) (-1655.101) (-1655.107) [-1660.863] * (-1655.112) (-1656.476) (-1654.890) [-1658.848] -- 0:00:44
      312500 -- [-1654.271] (-1654.882) (-1655.602) (-1656.559) * [-1654.983] (-1655.833) (-1654.459) (-1659.145) -- 0:00:44
      313000 -- (-1655.309) (-1653.447) [-1658.677] (-1656.568) * [-1654.527] (-1653.699) (-1655.635) (-1658.544) -- 0:00:43
      313500 -- (-1655.215) [-1654.741] (-1654.410) (-1656.391) * (-1656.203) (-1653.368) [-1656.467] (-1655.567) -- 0:00:43
      314000 -- (-1654.797) [-1653.440] (-1656.968) (-1657.202) * (-1655.138) (-1653.368) [-1658.018] (-1655.819) -- 0:00:43
      314500 -- [-1654.066] (-1655.900) (-1657.489) (-1657.358) * (-1654.835) [-1655.625] (-1655.285) (-1657.926) -- 0:00:43
      315000 -- [-1654.228] (-1655.802) (-1656.512) (-1660.877) * (-1656.235) (-1654.483) (-1655.275) [-1654.851] -- 0:00:43

      Average standard deviation of split frequencies: 0.014830

      315500 -- (-1655.699) (-1654.431) (-1656.606) [-1654.794] * [-1654.734] (-1653.508) (-1653.881) (-1654.241) -- 0:00:45
      316000 -- (-1657.299) (-1653.761) (-1655.667) [-1656.366] * (-1656.466) [-1653.548] (-1654.218) (-1654.531) -- 0:00:45
      316500 -- (-1657.725) [-1657.072] (-1658.940) (-1659.945) * (-1656.547) (-1655.169) (-1653.976) [-1656.089] -- 0:00:45
      317000 -- [-1654.784] (-1657.365) (-1656.209) (-1655.358) * (-1653.685) (-1657.061) [-1654.492] (-1654.169) -- 0:00:45
      317500 -- [-1660.388] (-1653.979) (-1657.805) (-1659.663) * (-1653.814) (-1655.449) (-1657.352) [-1654.152] -- 0:00:45
      318000 -- (-1653.790) [-1654.719] (-1659.401) (-1656.805) * (-1654.323) (-1656.414) (-1656.764) [-1653.892] -- 0:00:45
      318500 -- (-1656.244) [-1655.847] (-1655.185) (-1654.958) * (-1656.839) [-1656.521] (-1657.142) (-1656.044) -- 0:00:44
      319000 -- (-1655.832) (-1656.530) (-1653.817) [-1655.419] * [-1660.069] (-1655.032) (-1655.117) (-1655.755) -- 0:00:44
      319500 -- (-1656.086) (-1656.126) (-1655.620) [-1654.255] * (-1655.555) [-1656.119] (-1654.597) (-1656.800) -- 0:00:44
      320000 -- (-1655.642) (-1656.020) (-1659.340) [-1656.862] * (-1656.522) (-1655.659) [-1656.760] (-1657.485) -- 0:00:44

      Average standard deviation of split frequencies: 0.015306

      320500 -- [-1653.780] (-1655.802) (-1659.612) (-1656.988) * [-1655.785] (-1653.800) (-1657.943) (-1662.557) -- 0:00:44
      321000 -- (-1653.543) (-1657.265) (-1655.930) [-1655.392] * (-1656.138) [-1654.348] (-1661.933) (-1658.206) -- 0:00:44
      321500 -- (-1653.420) [-1657.476] (-1654.457) (-1654.178) * [-1657.692] (-1656.098) (-1655.053) (-1656.253) -- 0:00:44
      322000 -- (-1654.187) (-1656.531) (-1654.046) [-1654.165] * (-1655.048) (-1654.462) (-1654.900) [-1655.542] -- 0:00:44
      322500 -- (-1655.764) (-1654.700) (-1654.596) [-1655.470] * [-1655.152] (-1654.390) (-1656.470) (-1654.301) -- 0:00:44
      323000 -- [-1653.454] (-1654.559) (-1655.212) (-1655.328) * [-1653.503] (-1654.462) (-1655.057) (-1654.610) -- 0:00:44
      323500 -- (-1655.227) (-1654.866) [-1654.700] (-1659.080) * (-1654.478) (-1654.351) [-1656.260] (-1653.449) -- 0:00:43
      324000 -- (-1655.692) [-1655.705] (-1655.911) (-1660.854) * (-1654.208) (-1654.701) (-1656.063) [-1653.942] -- 0:00:43
      324500 -- [-1655.656] (-1656.251) (-1656.662) (-1657.784) * (-1654.197) (-1654.473) [-1657.625] (-1654.582) -- 0:00:43
      325000 -- (-1658.126) (-1655.102) [-1654.814] (-1657.486) * [-1653.987] (-1660.189) (-1658.877) (-1655.247) -- 0:00:43

      Average standard deviation of split frequencies: 0.014942

      325500 -- [-1656.407] (-1653.995) (-1657.987) (-1654.238) * [-1654.013] (-1656.444) (-1655.916) (-1657.613) -- 0:00:43
      326000 -- (-1653.860) [-1653.686] (-1658.828) (-1655.119) * [-1654.289] (-1656.850) (-1654.714) (-1660.448) -- 0:00:43
      326500 -- [-1655.470] (-1655.756) (-1655.274) (-1656.166) * (-1655.788) [-1654.345] (-1659.871) (-1660.457) -- 0:00:43
      327000 -- [-1655.772] (-1654.074) (-1658.980) (-1657.791) * (-1655.543) [-1655.544] (-1659.579) (-1658.972) -- 0:00:43
      327500 -- (-1656.089) (-1653.497) (-1656.800) [-1655.348] * [-1656.121] (-1654.636) (-1654.790) (-1657.593) -- 0:00:43
      328000 -- [-1659.922] (-1657.166) (-1655.391) (-1655.873) * (-1656.113) (-1654.484) [-1653.987] (-1660.908) -- 0:00:43
      328500 -- (-1655.724) (-1656.532) [-1654.566] (-1653.771) * (-1654.918) [-1653.836] (-1655.772) (-1661.542) -- 0:00:42
      329000 -- [-1658.304] (-1657.385) (-1654.995) (-1654.086) * (-1659.374) (-1654.717) (-1655.784) [-1658.457] -- 0:00:42
      329500 -- [-1654.612] (-1656.430) (-1659.035) (-1657.203) * (-1657.996) (-1653.930) [-1656.413] (-1655.463) -- 0:00:42
      330000 -- [-1655.125] (-1656.799) (-1655.860) (-1655.517) * (-1656.030) (-1653.930) (-1660.149) [-1654.292] -- 0:00:42

      Average standard deviation of split frequencies: 0.014508

      330500 -- (-1654.950) (-1654.871) [-1655.307] (-1662.569) * (-1655.247) (-1655.212) [-1656.768] (-1656.634) -- 0:00:42
      331000 -- (-1655.264) (-1654.040) [-1654.319] (-1656.133) * (-1655.828) (-1654.561) (-1655.731) [-1654.326] -- 0:00:42
      331500 -- [-1657.159] (-1654.595) (-1653.613) (-1653.974) * (-1655.783) (-1656.423) [-1655.944] (-1654.660) -- 0:00:44
      332000 -- (-1653.560) (-1654.335) [-1654.733] (-1653.952) * (-1658.589) (-1656.613) (-1655.570) [-1654.747] -- 0:00:44
      332500 -- (-1655.160) (-1655.137) (-1655.401) [-1653.315] * [-1655.673] (-1655.477) (-1655.201) (-1659.844) -- 0:00:44
      333000 -- (-1655.342) [-1655.470] (-1656.446) (-1653.316) * (-1655.712) [-1655.896] (-1655.094) (-1657.698) -- 0:00:44
      333500 -- [-1654.757] (-1656.104) (-1655.418) (-1653.312) * (-1654.709) [-1656.985] (-1654.332) (-1654.497) -- 0:00:43
      334000 -- [-1654.802] (-1659.477) (-1654.846) (-1653.591) * (-1657.371) (-1657.982) [-1655.618] (-1658.537) -- 0:00:43
      334500 -- (-1654.952) (-1654.916) (-1658.588) [-1654.634] * (-1657.472) (-1662.418) [-1653.986] (-1656.971) -- 0:00:43
      335000 -- (-1654.952) (-1655.880) [-1657.924] (-1654.524) * (-1657.161) (-1655.079) [-1654.208] (-1657.927) -- 0:00:43

      Average standard deviation of split frequencies: 0.014731

      335500 -- [-1655.397] (-1654.650) (-1656.347) (-1656.778) * (-1654.442) (-1655.755) (-1654.290) [-1654.670] -- 0:00:43
      336000 -- [-1654.664] (-1655.614) (-1659.936) (-1658.796) * (-1654.573) (-1656.869) [-1655.371] (-1655.927) -- 0:00:43
      336500 -- [-1653.873] (-1653.256) (-1658.471) (-1655.270) * [-1654.374] (-1655.417) (-1657.000) (-1657.665) -- 0:00:43
      337000 -- (-1654.701) [-1653.251] (-1653.791) (-1658.036) * (-1655.293) (-1656.157) [-1656.253] (-1656.055) -- 0:00:43
      337500 -- (-1653.987) (-1654.171) [-1654.508] (-1654.326) * (-1657.530) [-1654.805] (-1656.248) (-1657.430) -- 0:00:43
      338000 -- (-1654.837) (-1654.743) [-1654.448] (-1655.955) * (-1659.077) (-1656.242) [-1654.615] (-1657.392) -- 0:00:43
      338500 -- [-1656.168] (-1656.239) (-1654.225) (-1654.401) * (-1656.941) (-1654.378) (-1656.758) [-1656.118] -- 0:00:42
      339000 -- (-1656.129) [-1657.223] (-1654.035) (-1653.863) * (-1655.437) (-1656.651) (-1655.109) [-1654.911] -- 0:00:42
      339500 -- (-1654.640) (-1656.901) (-1655.543) [-1655.810] * (-1655.351) (-1655.411) (-1657.421) [-1654.051] -- 0:00:42
      340000 -- (-1654.557) (-1660.783) [-1654.139] (-1654.656) * (-1654.333) (-1657.414) [-1657.006] (-1653.899) -- 0:00:42

      Average standard deviation of split frequencies: 0.012886

      340500 -- (-1657.672) (-1656.243) [-1654.303] (-1655.031) * (-1653.990) (-1657.471) (-1654.597) [-1654.912] -- 0:00:42
      341000 -- (-1655.481) [-1655.054] (-1653.986) (-1655.162) * (-1654.177) [-1655.021] (-1655.019) (-1655.505) -- 0:00:42
      341500 -- (-1660.742) (-1655.629) (-1656.620) [-1655.423] * (-1658.989) (-1655.064) [-1655.090] (-1654.727) -- 0:00:42
      342000 -- (-1657.992) [-1655.004] (-1657.755) (-1653.309) * (-1656.014) (-1658.408) [-1655.090] (-1655.450) -- 0:00:42
      342500 -- (-1659.282) [-1653.759] (-1657.593) (-1653.315) * (-1654.711) (-1655.463) [-1655.523] (-1662.322) -- 0:00:42
      343000 -- (-1659.733) (-1655.530) (-1658.895) [-1657.859] * (-1653.433) (-1654.228) [-1660.575] (-1661.125) -- 0:00:42
      343500 -- (-1653.958) [-1654.629] (-1656.701) (-1655.870) * [-1653.469] (-1654.140) (-1656.907) (-1657.508) -- 0:00:42
      344000 -- (-1654.941) (-1657.890) (-1658.573) [-1654.178] * (-1653.508) (-1656.851) [-1657.404] (-1654.031) -- 0:00:41
      344500 -- (-1653.445) (-1658.626) (-1658.150) [-1653.843] * [-1657.257] (-1656.665) (-1654.867) (-1653.903) -- 0:00:41
      345000 -- (-1655.208) [-1656.169] (-1657.914) (-1653.963) * (-1659.063) [-1655.559] (-1656.741) (-1654.708) -- 0:00:41

      Average standard deviation of split frequencies: 0.013028

      345500 -- (-1655.326) (-1656.002) [-1658.907] (-1653.857) * (-1657.329) (-1657.921) [-1656.265] (-1656.684) -- 0:00:41
      346000 -- [-1654.033] (-1655.466) (-1657.042) (-1653.900) * (-1656.094) (-1655.583) [-1654.389] (-1658.348) -- 0:00:41
      346500 -- (-1654.890) [-1655.412] (-1653.181) (-1653.900) * [-1656.094] (-1654.814) (-1654.719) (-1658.948) -- 0:00:41
      347000 -- (-1656.290) (-1653.526) [-1653.828] (-1656.950) * (-1654.740) (-1654.901) [-1656.231] (-1658.311) -- 0:00:43
      347500 -- (-1660.577) (-1653.526) [-1655.457] (-1664.311) * (-1656.903) [-1656.570] (-1655.131) (-1661.102) -- 0:00:43
      348000 -- (-1654.583) [-1654.052] (-1656.871) (-1661.380) * [-1655.249] (-1657.939) (-1657.058) (-1656.243) -- 0:00:43
      348500 -- [-1654.794] (-1654.343) (-1656.049) (-1655.182) * (-1654.360) [-1656.529] (-1655.456) (-1654.280) -- 0:00:42
      349000 -- (-1655.052) (-1653.998) (-1658.445) [-1655.050] * [-1654.390] (-1657.462) (-1654.226) (-1657.934) -- 0:00:42
      349500 -- (-1653.843) (-1653.750) [-1654.859] (-1654.025) * (-1657.106) (-1657.935) (-1654.503) [-1656.235] -- 0:00:42
      350000 -- [-1655.751] (-1657.827) (-1655.986) (-1654.802) * (-1655.927) (-1654.063) [-1655.893] (-1657.967) -- 0:00:42

      Average standard deviation of split frequencies: 0.012267

      350500 -- (-1655.976) (-1655.283) [-1653.930] (-1656.513) * [-1656.315] (-1655.204) (-1653.601) (-1655.169) -- 0:00:42
      351000 -- (-1658.446) (-1656.203) (-1656.093) [-1655.877] * (-1656.317) (-1658.872) (-1654.407) [-1655.110] -- 0:00:42
      351500 -- (-1656.025) [-1655.707] (-1656.597) (-1654.205) * (-1658.807) (-1658.421) (-1655.045) [-1653.437] -- 0:00:42
      352000 -- (-1658.553) [-1655.725] (-1656.953) (-1655.050) * (-1656.860) [-1659.134] (-1659.295) (-1655.785) -- 0:00:42
      352500 -- [-1654.657] (-1655.292) (-1656.828) (-1657.466) * (-1657.449) (-1658.163) (-1660.893) [-1654.026] -- 0:00:42
      353000 -- (-1655.192) (-1657.212) (-1657.279) [-1654.951] * [-1654.137] (-1658.453) (-1660.727) (-1653.340) -- 0:00:42
      353500 -- (-1656.222) (-1656.422) (-1656.456) [-1654.646] * (-1655.670) [-1658.126] (-1656.782) (-1653.372) -- 0:00:42
      354000 -- [-1654.866] (-1655.002) (-1659.180) (-1657.345) * [-1653.349] (-1656.773) (-1653.414) (-1654.100) -- 0:00:41
      354500 -- (-1661.358) (-1655.369) (-1656.090) [-1657.846] * (-1655.476) (-1655.758) [-1655.363] (-1657.600) -- 0:00:41
      355000 -- (-1656.671) [-1658.622] (-1654.696) (-1657.848) * (-1655.476) (-1657.272) (-1654.001) [-1656.308] -- 0:00:41

      Average standard deviation of split frequencies: 0.012580

      355500 -- (-1656.158) (-1654.510) (-1659.394) [-1655.807] * (-1655.430) (-1655.135) [-1654.127] (-1654.224) -- 0:00:41
      356000 -- (-1655.928) (-1654.358) (-1653.686) [-1654.743] * [-1655.577] (-1658.337) (-1654.610) (-1653.825) -- 0:00:41
      356500 -- (-1655.568) (-1655.917) [-1653.683] (-1653.522) * (-1655.577) (-1658.755) [-1656.326] (-1655.429) -- 0:00:41
      357000 -- [-1654.685] (-1658.054) (-1653.940) (-1654.392) * [-1656.574] (-1665.774) (-1658.087) (-1658.110) -- 0:00:41
      357500 -- [-1659.151] (-1659.314) (-1653.857) (-1654.444) * [-1654.815] (-1659.971) (-1653.833) (-1665.039) -- 0:00:41
      358000 -- [-1654.472] (-1653.865) (-1654.850) (-1654.279) * (-1656.238) (-1655.679) [-1654.047] (-1663.201) -- 0:00:41
      358500 -- (-1655.718) (-1655.642) [-1654.505] (-1654.317) * [-1655.320] (-1653.586) (-1653.828) (-1655.474) -- 0:00:41
      359000 -- (-1656.457) [-1655.563] (-1654.882) (-1656.358) * (-1656.059) (-1655.304) [-1653.703] (-1654.446) -- 0:00:41
      359500 -- (-1655.380) (-1654.860) [-1653.526] (-1655.576) * [-1655.158] (-1656.796) (-1655.501) (-1655.838) -- 0:00:40
      360000 -- [-1658.716] (-1657.642) (-1653.544) (-1654.202) * [-1655.315] (-1656.794) (-1654.833) (-1655.429) -- 0:00:40

      Average standard deviation of split frequencies: 0.012580

      360500 -- (-1658.361) (-1661.733) (-1655.231) [-1655.874] * (-1654.640) (-1657.632) (-1655.209) [-1655.007] -- 0:00:40
      361000 -- (-1654.685) (-1658.759) (-1655.320) [-1655.331] * (-1654.591) (-1661.317) (-1654.907) [-1654.874] -- 0:00:40
      361500 -- [-1656.740] (-1656.360) (-1656.424) (-1655.889) * (-1655.517) [-1657.757] (-1655.549) (-1655.275) -- 0:00:40
      362000 -- [-1656.536] (-1655.444) (-1655.930) (-1655.030) * (-1656.100) (-1654.247) (-1656.031) [-1655.296] -- 0:00:40
      362500 -- (-1656.630) (-1653.930) [-1656.515] (-1655.046) * (-1657.671) (-1654.169) [-1654.316] (-1654.402) -- 0:00:40
      363000 -- [-1660.423] (-1653.667) (-1656.588) (-1654.145) * (-1655.734) [-1654.683] (-1654.373) (-1656.969) -- 0:00:42
      363500 -- [-1654.983] (-1655.120) (-1656.117) (-1654.139) * (-1655.505) (-1655.994) [-1654.339] (-1655.908) -- 0:00:42
      364000 -- (-1659.001) (-1653.722) (-1654.249) [-1657.918] * (-1655.963) (-1658.881) [-1654.830] (-1655.159) -- 0:00:41
      364500 -- (-1656.784) [-1653.695] (-1656.337) (-1659.287) * (-1657.013) (-1656.668) (-1655.738) [-1656.907] -- 0:00:41
      365000 -- (-1656.142) (-1655.164) [-1654.912] (-1657.778) * (-1659.150) (-1656.110) (-1655.258) [-1654.124] -- 0:00:41

      Average standard deviation of split frequencies: 0.012653

      365500 -- (-1655.772) (-1656.689) (-1655.123) [-1656.765] * (-1662.895) (-1656.148) [-1654.517] (-1653.296) -- 0:00:41
      366000 -- (-1654.596) (-1659.049) [-1655.194] (-1654.275) * (-1658.222) (-1654.655) [-1656.197] (-1653.344) -- 0:00:41
      366500 -- (-1654.534) (-1655.571) (-1658.976) [-1655.375] * (-1656.559) (-1657.091) [-1655.712] (-1656.515) -- 0:00:41
      367000 -- (-1659.152) (-1654.153) [-1658.753] (-1654.430) * (-1655.501) [-1656.951] (-1655.084) (-1658.389) -- 0:00:41
      367500 -- [-1657.730] (-1653.411) (-1657.151) (-1654.924) * (-1656.052) (-1657.419) (-1654.495) [-1655.235] -- 0:00:41
      368000 -- (-1654.822) (-1654.032) (-1656.850) [-1655.598] * (-1655.314) [-1655.914] (-1655.605) (-1655.262) -- 0:00:41
      368500 -- [-1654.826] (-1654.031) (-1655.854) (-1655.246) * (-1656.726) (-1656.356) [-1654.288] (-1654.868) -- 0:00:41
      369000 -- (-1656.036) (-1654.608) (-1656.777) [-1654.628] * [-1655.548] (-1657.449) (-1654.257) (-1657.678) -- 0:00:41
      369500 -- (-1654.373) [-1656.278] (-1656.145) (-1656.482) * (-1655.657) (-1655.319) (-1654.101) [-1655.758] -- 0:00:40
      370000 -- [-1655.866] (-1654.629) (-1656.431) (-1655.885) * (-1655.840) [-1654.089] (-1654.878) (-1655.755) -- 0:00:40

      Average standard deviation of split frequencies: 0.013274

      370500 -- [-1656.343] (-1654.973) (-1657.344) (-1657.709) * (-1656.569) (-1657.880) [-1657.619] (-1655.402) -- 0:00:40
      371000 -- (-1655.491) (-1655.882) (-1655.319) [-1655.928] * (-1656.353) (-1654.904) [-1655.534] (-1658.183) -- 0:00:40
      371500 -- (-1653.796) (-1654.678) [-1653.240] (-1656.304) * (-1653.661) (-1653.373) (-1656.731) [-1654.326] -- 0:00:40
      372000 -- (-1654.501) (-1657.959) (-1654.267) [-1653.678] * (-1653.658) (-1655.337) (-1655.368) [-1655.567] -- 0:00:40
      372500 -- (-1657.663) (-1655.754) [-1654.509] (-1655.628) * (-1653.971) (-1655.038) (-1655.453) [-1656.979] -- 0:00:40
      373000 -- (-1655.158) [-1654.599] (-1657.456) (-1653.418) * (-1654.384) (-1657.263) (-1655.110) [-1654.488] -- 0:00:40
      373500 -- (-1655.430) [-1654.301] (-1655.239) (-1654.907) * [-1655.092] (-1654.717) (-1655.839) (-1655.014) -- 0:00:40
      374000 -- (-1654.801) [-1653.666] (-1654.343) (-1657.303) * (-1655.821) (-1655.053) (-1654.030) [-1653.525] -- 0:00:40
      374500 -- (-1656.796) (-1659.267) (-1655.033) [-1654.255] * (-1657.530) (-1664.591) [-1654.673] (-1654.182) -- 0:00:40
      375000 -- (-1654.254) (-1657.477) [-1656.100] (-1659.129) * [-1654.667] (-1659.906) (-1656.482) (-1653.327) -- 0:00:40

      Average standard deviation of split frequencies: 0.013869

      375500 -- [-1653.681] (-1653.636) (-1654.864) (-1659.066) * (-1659.482) (-1657.565) [-1655.294] (-1658.286) -- 0:00:39
      376000 -- (-1656.208) [-1655.289] (-1660.169) (-1656.473) * (-1656.427) (-1656.109) [-1658.146] (-1658.634) -- 0:00:39
      376500 -- (-1655.959) (-1658.392) (-1656.743) [-1656.049] * (-1654.977) (-1655.019) [-1654.534] (-1658.359) -- 0:00:39
      377000 -- [-1655.063] (-1658.543) (-1656.107) (-1656.420) * (-1655.410) (-1655.879) (-1658.198) [-1655.556] -- 0:00:39
      377500 -- (-1653.785) (-1659.536) (-1661.342) [-1656.758] * (-1657.216) (-1655.866) (-1658.700) [-1655.546] -- 0:00:39
      378000 -- (-1654.804) (-1655.350) (-1657.156) [-1653.807] * (-1657.134) [-1655.466] (-1657.370) (-1656.367) -- 0:00:39
      378500 -- (-1659.483) (-1656.262) (-1661.064) [-1655.330] * (-1654.974) (-1654.831) [-1656.270] (-1657.937) -- 0:00:41
      379000 -- (-1655.069) (-1655.938) (-1656.686) [-1656.814] * [-1654.449] (-1654.107) (-1656.605) (-1655.009) -- 0:00:40
      379500 -- (-1654.585) (-1655.439) (-1659.373) [-1655.587] * (-1656.341) (-1653.987) (-1656.262) [-1655.266] -- 0:00:40
      380000 -- (-1654.820) (-1655.385) [-1657.708] (-1656.004) * (-1654.605) (-1657.817) (-1656.607) [-1653.781] -- 0:00:40

      Average standard deviation of split frequencies: 0.013457

      380500 -- [-1654.309] (-1655.587) (-1654.467) (-1653.973) * [-1653.728] (-1657.792) (-1655.593) (-1653.567) -- 0:00:40
      381000 -- (-1657.539) (-1656.647) (-1654.930) [-1654.692] * (-1654.887) (-1660.130) (-1653.930) [-1654.443] -- 0:00:40
      381500 -- [-1655.203] (-1656.197) (-1655.655) (-1653.802) * (-1653.670) (-1659.414) (-1653.872) [-1654.548] -- 0:00:40
      382000 -- (-1663.185) [-1658.543] (-1655.460) (-1654.267) * (-1655.032) (-1655.257) [-1653.451] (-1656.023) -- 0:00:40
      382500 -- [-1659.173] (-1655.804) (-1655.390) (-1656.343) * (-1654.478) (-1655.181) [-1654.572] (-1656.027) -- 0:00:40
      383000 -- (-1657.945) [-1654.759] (-1655.650) (-1658.437) * [-1654.168] (-1655.017) (-1656.325) (-1654.580) -- 0:00:40
      383500 -- (-1656.959) (-1655.440) [-1654.675] (-1655.934) * (-1654.897) (-1656.225) (-1654.745) [-1654.780] -- 0:00:40
      384000 -- (-1656.216) [-1655.557] (-1654.678) (-1658.162) * (-1654.847) [-1653.968] (-1654.936) (-1653.666) -- 0:00:40
      384500 -- (-1655.195) [-1654.022] (-1654.297) (-1655.149) * (-1654.121) [-1660.405] (-1654.936) (-1656.917) -- 0:00:40
      385000 -- (-1659.147) [-1654.412] (-1657.132) (-1654.724) * (-1657.790) (-1656.666) [-1654.936] (-1658.322) -- 0:00:39

      Average standard deviation of split frequencies: 0.012864

      385500 -- (-1655.307) (-1655.050) (-1659.464) [-1655.254] * [-1655.795] (-1655.424) (-1656.520) (-1654.501) -- 0:00:39
      386000 -- (-1655.589) (-1654.497) (-1654.810) [-1657.697] * [-1653.635] (-1653.505) (-1657.394) (-1655.297) -- 0:00:39
      386500 -- (-1656.257) [-1656.802] (-1655.279) (-1657.772) * [-1653.687] (-1654.912) (-1659.778) (-1654.631) -- 0:00:39
      387000 -- (-1655.934) (-1656.576) [-1653.624] (-1653.927) * [-1654.499] (-1657.236) (-1654.421) (-1654.187) -- 0:00:39
      387500 -- (-1657.423) [-1655.175] (-1657.559) (-1654.783) * [-1655.472] (-1656.641) (-1654.983) (-1654.718) -- 0:00:39
      388000 -- [-1656.159] (-1656.193) (-1655.130) (-1654.630) * (-1656.355) [-1656.300] (-1656.477) (-1655.333) -- 0:00:39
      388500 -- (-1656.382) (-1654.729) [-1657.297] (-1653.803) * (-1656.673) [-1657.824] (-1655.055) (-1655.286) -- 0:00:39
      389000 -- (-1655.870) [-1654.866] (-1657.565) (-1656.226) * (-1655.348) [-1655.909] (-1653.994) (-1654.040) -- 0:00:39
      389500 -- (-1656.343) [-1655.307] (-1656.913) (-1656.919) * (-1657.033) (-1657.974) [-1653.702] (-1653.966) -- 0:00:39
      390000 -- (-1654.939) (-1656.249) (-1656.003) [-1654.517] * (-1655.417) (-1654.154) [-1653.747] (-1655.752) -- 0:00:39

      Average standard deviation of split frequencies: 0.012710

      390500 -- (-1654.682) (-1655.267) (-1656.645) [-1655.373] * (-1653.979) (-1655.963) [-1656.746] (-1655.837) -- 0:00:39
      391000 -- (-1655.687) (-1658.801) [-1657.951] (-1656.345) * (-1653.624) (-1656.904) [-1656.228] (-1654.627) -- 0:00:38
      391500 -- (-1654.182) (-1653.640) [-1655.679] (-1657.497) * (-1655.668) (-1655.463) [-1657.541] (-1656.126) -- 0:00:38
      392000 -- (-1657.289) (-1653.923) (-1654.772) [-1658.552] * (-1655.175) [-1656.488] (-1656.342) (-1656.006) -- 0:00:38
      392500 -- (-1655.635) [-1655.693] (-1654.695) (-1658.747) * (-1657.225) (-1655.092) [-1658.478] (-1653.743) -- 0:00:38
      393000 -- (-1654.514) (-1655.020) [-1654.605] (-1656.968) * (-1656.668) [-1654.375] (-1654.459) (-1659.095) -- 0:00:38
      393500 -- [-1653.747] (-1655.487) (-1653.805) (-1655.911) * (-1655.971) (-1654.229) (-1653.545) [-1657.134] -- 0:00:38
      394000 -- (-1659.239) [-1654.488] (-1653.539) (-1654.506) * (-1654.456) (-1656.302) [-1653.648] (-1654.636) -- 0:00:38
      394500 -- (-1658.476) [-1654.718] (-1653.554) (-1656.482) * (-1653.582) (-1657.201) (-1655.597) [-1655.765] -- 0:00:39
      395000 -- (-1655.136) (-1655.640) [-1654.786] (-1657.516) * [-1654.931] (-1657.964) (-1656.578) (-1655.498) -- 0:00:39

      Average standard deviation of split frequencies: 0.012142

      395500 -- (-1658.704) [-1659.135] (-1655.218) (-1656.090) * (-1655.616) (-1653.564) [-1654.077] (-1654.848) -- 0:00:39
      396000 -- (-1654.781) (-1657.037) (-1656.445) [-1655.802] * (-1653.550) (-1655.094) [-1654.590] (-1655.691) -- 0:00:39
      396500 -- (-1656.367) [-1656.417] (-1653.588) (-1655.277) * (-1657.662) (-1653.548) (-1658.317) [-1655.707] -- 0:00:39
      397000 -- (-1655.378) [-1657.687] (-1653.754) (-1659.853) * (-1656.220) (-1656.763) (-1654.543) [-1657.799] -- 0:00:39
      397500 -- (-1653.536) (-1657.685) (-1655.194) [-1658.044] * (-1655.549) (-1657.687) (-1655.845) [-1656.897] -- 0:00:39
      398000 -- (-1655.966) (-1657.699) (-1658.074) [-1655.656] * [-1657.369] (-1657.148) (-1658.092) (-1654.805) -- 0:00:39
      398500 -- (-1656.968) (-1656.442) (-1658.200) [-1659.748] * (-1655.650) (-1657.559) (-1657.470) [-1655.326] -- 0:00:39
      399000 -- (-1656.935) (-1660.304) (-1657.619) [-1656.733] * [-1655.789] (-1655.746) (-1657.220) (-1656.857) -- 0:00:39
      399500 -- [-1654.022] (-1655.107) (-1655.587) (-1657.156) * (-1655.068) [-1655.765] (-1656.898) (-1658.375) -- 0:00:39
      400000 -- (-1656.289) (-1654.933) [-1653.703] (-1653.714) * [-1654.990] (-1658.047) (-1658.902) (-1657.870) -- 0:00:39

      Average standard deviation of split frequencies: 0.013020

      400500 -- (-1654.632) (-1657.013) [-1654.002] (-1653.759) * (-1655.531) (-1654.217) [-1655.063] (-1656.992) -- 0:00:38
      401000 -- (-1656.390) [-1655.907] (-1656.877) (-1655.842) * [-1653.999] (-1655.463) (-1659.061) (-1656.433) -- 0:00:38
      401500 -- (-1658.288) (-1656.178) (-1657.496) [-1654.819] * (-1654.591) (-1655.321) [-1655.919] (-1656.785) -- 0:00:38
      402000 -- (-1658.164) (-1656.702) [-1660.329] (-1654.816) * (-1655.293) [-1655.122] (-1654.237) (-1656.117) -- 0:00:38
      402500 -- (-1661.535) (-1656.592) (-1655.806) [-1655.441] * (-1655.086) (-1654.456) (-1655.672) [-1655.198] -- 0:00:38
      403000 -- (-1658.598) (-1656.315) [-1653.556] (-1658.657) * [-1655.628] (-1655.658) (-1654.058) (-1654.344) -- 0:00:38
      403500 -- (-1659.610) (-1656.315) (-1655.418) [-1656.361] * [-1656.587] (-1654.545) (-1653.977) (-1660.711) -- 0:00:38
      404000 -- [-1654.106] (-1658.874) (-1655.118) (-1654.804) * [-1656.456] (-1660.697) (-1654.413) (-1656.144) -- 0:00:38
      404500 -- (-1657.039) (-1654.216) (-1656.047) [-1654.115] * (-1655.756) (-1660.113) [-1656.677] (-1655.513) -- 0:00:38
      405000 -- (-1656.424) (-1654.562) [-1655.771] (-1657.558) * (-1655.578) (-1655.052) (-1656.765) [-1654.919] -- 0:00:38

      Average standard deviation of split frequencies: 0.013236

      405500 -- (-1654.241) (-1654.180) [-1656.127] (-1654.186) * (-1657.940) (-1655.156) [-1656.763] (-1654.681) -- 0:00:38
      406000 -- (-1654.544) [-1656.288] (-1658.540) (-1654.092) * (-1655.154) [-1655.640] (-1656.186) (-1656.186) -- 0:00:38
      406500 -- (-1655.808) (-1656.844) (-1658.083) [-1656.825] * (-1655.383) [-1655.003] (-1656.354) (-1658.307) -- 0:00:37
      407000 -- (-1655.605) [-1654.575] (-1658.655) (-1654.233) * (-1654.085) (-1654.674) [-1655.906] (-1654.348) -- 0:00:37
      407500 -- (-1656.730) (-1657.626) [-1656.514] (-1655.805) * [-1656.426] (-1656.771) (-1653.947) (-1654.319) -- 0:00:37
      408000 -- (-1655.596) (-1655.158) [-1655.749] (-1655.001) * [-1656.904] (-1654.990) (-1655.415) (-1658.397) -- 0:00:37
      408500 -- [-1655.239] (-1654.380) (-1654.269) (-1654.059) * [-1657.102] (-1655.078) (-1656.343) (-1659.173) -- 0:00:37
      409000 -- [-1654.073] (-1655.138) (-1654.835) (-1654.010) * (-1658.145) (-1656.307) [-1656.280] (-1655.607) -- 0:00:37
      409500 -- (-1655.134) (-1654.375) (-1655.936) [-1657.856] * (-1656.971) (-1654.069) (-1655.134) [-1655.454] -- 0:00:37
      410000 -- [-1654.072] (-1654.492) (-1654.674) (-1654.222) * [-1656.201] (-1656.607) (-1654.490) (-1655.629) -- 0:00:38

      Average standard deviation of split frequencies: 0.013469

      410500 -- (-1658.776) [-1656.581] (-1654.675) (-1653.542) * [-1656.364] (-1656.254) (-1653.563) (-1655.363) -- 0:00:38
      411000 -- (-1656.477) (-1655.626) (-1656.602) [-1653.758] * (-1655.355) (-1656.619) [-1657.596] (-1657.650) -- 0:00:38
      411500 -- (-1658.068) (-1659.510) [-1658.284] (-1654.924) * (-1655.944) (-1653.623) (-1657.634) [-1655.119] -- 0:00:38
      412000 -- (-1655.524) [-1655.346] (-1655.798) (-1655.923) * (-1655.039) (-1653.676) [-1656.223] (-1655.341) -- 0:00:38
      412500 -- [-1654.062] (-1654.010) (-1655.793) (-1656.378) * (-1659.865) (-1654.290) [-1657.735] (-1660.227) -- 0:00:38
      413000 -- (-1655.898) [-1653.519] (-1654.526) (-1656.452) * (-1656.061) [-1653.529] (-1655.347) (-1658.517) -- 0:00:38
      413500 -- (-1653.706) (-1653.519) (-1653.896) [-1653.450] * (-1655.739) (-1653.529) (-1655.443) [-1657.198] -- 0:00:38
      414000 -- [-1654.162] (-1654.096) (-1655.531) (-1656.416) * [-1655.302] (-1655.406) (-1656.474) (-1654.939) -- 0:00:38
      414500 -- (-1654.480) (-1664.766) [-1654.223] (-1654.835) * (-1654.163) (-1654.138) [-1659.827] (-1654.651) -- 0:00:38
      415000 -- [-1656.661] (-1657.288) (-1654.730) (-1656.627) * [-1653.933] (-1653.663) (-1661.175) (-1657.022) -- 0:00:38

      Average standard deviation of split frequencies: 0.014051

      415500 -- (-1657.770) (-1654.066) [-1654.031] (-1655.578) * (-1656.520) (-1655.124) [-1656.209] (-1655.360) -- 0:00:37
      416000 -- (-1657.810) (-1654.393) [-1655.230] (-1655.503) * (-1654.378) (-1657.517) (-1657.633) [-1655.190] -- 0:00:37
      416500 -- (-1656.680) (-1655.186) [-1656.134] (-1655.577) * (-1655.314) [-1656.998] (-1654.796) (-1656.330) -- 0:00:37
      417000 -- [-1656.017] (-1659.180) (-1656.542) (-1657.050) * (-1655.389) [-1655.114] (-1654.060) (-1655.367) -- 0:00:37
      417500 -- (-1656.047) (-1657.519) [-1656.710] (-1661.014) * (-1654.976) (-1656.001) [-1654.181] (-1655.965) -- 0:00:37
      418000 -- (-1657.419) (-1657.090) (-1655.238) [-1656.089] * (-1655.137) (-1653.526) (-1655.448) [-1656.372] -- 0:00:37
      418500 -- (-1658.350) [-1656.653] (-1658.641) (-1654.969) * (-1655.031) (-1656.969) [-1656.865] (-1654.454) -- 0:00:37
      419000 -- (-1660.352) (-1656.737) (-1656.844) [-1656.671] * [-1656.236] (-1655.644) (-1656.694) (-1656.958) -- 0:00:37
      419500 -- (-1656.294) [-1654.465] (-1656.721) (-1653.682) * (-1658.927) (-1653.625) [-1654.053] (-1657.701) -- 0:00:37
      420000 -- (-1654.852) (-1658.223) (-1656.818) [-1655.078] * [-1654.933] (-1653.519) (-1656.329) (-1656.166) -- 0:00:37

      Average standard deviation of split frequencies: 0.013597

      420500 -- (-1656.312) [-1657.059] (-1663.041) (-1655.763) * (-1654.870) [-1657.428] (-1656.532) (-1656.564) -- 0:00:37
      421000 -- [-1654.096] (-1657.400) (-1656.479) (-1655.168) * (-1653.786) (-1655.096) (-1657.244) [-1655.920] -- 0:00:37
      421500 -- (-1655.359) (-1654.374) (-1657.168) [-1653.445] * [-1653.994] (-1655.093) (-1659.308) (-1654.484) -- 0:00:37
      422000 -- (-1654.632) (-1654.374) [-1656.389] (-1654.104) * (-1655.615) (-1654.203) (-1657.358) [-1653.586] -- 0:00:36
      422500 -- (-1654.392) (-1655.847) (-1655.385) [-1653.783] * (-1655.539) (-1655.546) (-1654.336) [-1653.578] -- 0:00:36
      423000 -- (-1657.887) (-1656.802) [-1654.908] (-1653.772) * (-1657.678) (-1659.702) (-1654.114) [-1655.812] -- 0:00:36
      423500 -- (-1662.048) (-1656.217) [-1654.569] (-1653.784) * (-1657.678) [-1661.545] (-1655.924) (-1655.470) -- 0:00:36
      424000 -- [-1656.696] (-1657.246) (-1656.215) (-1653.784) * (-1654.142) [-1656.580] (-1655.456) (-1654.559) -- 0:00:36
      424500 -- (-1659.268) (-1660.609) (-1655.557) [-1654.244] * (-1654.728) (-1654.557) (-1654.864) [-1656.752] -- 0:00:36
      425000 -- (-1656.622) (-1656.611) [-1654.936] (-1658.622) * (-1656.153) (-1655.279) (-1654.960) [-1656.337] -- 0:00:36

      Average standard deviation of split frequencies: 0.012689

      425500 -- (-1663.197) (-1654.952) [-1656.370] (-1656.840) * (-1654.340) [-1655.093] (-1654.849) (-1654.223) -- 0:00:37
      426000 -- (-1656.090) [-1653.833] (-1655.161) (-1655.231) * (-1657.176) [-1654.208] (-1657.435) (-1655.354) -- 0:00:37
      426500 -- (-1655.652) [-1653.722] (-1656.579) (-1654.672) * (-1654.771) (-1657.718) (-1658.648) [-1658.891] -- 0:00:37
      427000 -- [-1656.108] (-1654.667) (-1656.736) (-1658.612) * [-1655.425] (-1661.578) (-1654.703) (-1654.788) -- 0:00:37
      427500 -- (-1656.268) [-1655.007] (-1660.466) (-1655.729) * (-1654.279) (-1659.187) [-1655.138] (-1654.565) -- 0:00:37
      428000 -- [-1657.629] (-1653.454) (-1658.438) (-1657.093) * (-1655.025) [-1660.247] (-1656.587) (-1656.702) -- 0:00:37
      428500 -- (-1655.877) (-1655.230) (-1657.149) [-1654.883] * [-1655.349] (-1655.468) (-1656.040) (-1654.911) -- 0:00:37
      429000 -- (-1655.399) [-1656.841] (-1654.757) (-1655.877) * (-1656.525) (-1655.989) [-1653.974] (-1654.121) -- 0:00:37
      429500 -- (-1655.873) (-1659.414) (-1654.424) [-1655.314] * [-1656.056] (-1655.547) (-1657.061) (-1654.762) -- 0:00:37
      430000 -- [-1655.997] (-1655.636) (-1653.635) (-1657.240) * (-1656.045) (-1654.332) [-1655.070] (-1655.864) -- 0:00:37

      Average standard deviation of split frequencies: 0.012259

      430500 -- (-1657.107) (-1659.180) (-1653.650) [-1657.327] * (-1658.050) [-1654.715] (-1655.185) (-1656.746) -- 0:00:37
      431000 -- (-1654.446) (-1656.514) (-1655.356) [-1657.323] * (-1655.198) [-1655.733] (-1656.802) (-1657.207) -- 0:00:36
      431500 -- (-1655.395) (-1656.648) [-1655.392] (-1656.290) * (-1659.271) [-1656.369] (-1654.602) (-1658.584) -- 0:00:36
      432000 -- (-1655.603) (-1656.281) (-1655.898) [-1657.386] * (-1655.751) (-1656.704) [-1655.635] (-1659.432) -- 0:00:36
      432500 -- (-1653.990) [-1653.714] (-1654.573) (-1657.915) * (-1655.761) (-1656.505) (-1654.040) [-1655.867] -- 0:00:36
      433000 -- (-1654.554) [-1653.864] (-1657.635) (-1654.852) * (-1654.426) (-1658.348) [-1654.517] (-1657.060) -- 0:00:36
      433500 -- (-1654.280) (-1655.107) [-1656.116] (-1654.081) * (-1657.887) (-1654.401) (-1654.251) [-1654.937] -- 0:00:36
      434000 -- [-1654.674] (-1655.667) (-1655.310) (-1658.994) * [-1656.426] (-1655.123) (-1654.639) (-1657.353) -- 0:00:36
      434500 -- (-1654.855) (-1660.797) [-1655.696] (-1655.680) * (-1654.935) [-1656.442] (-1655.502) (-1655.389) -- 0:00:36
      435000 -- (-1655.992) [-1657.368] (-1655.210) (-1655.391) * (-1654.549) (-1654.238) [-1655.804] (-1656.988) -- 0:00:36

      Average standard deviation of split frequencies: 0.013119

      435500 -- [-1656.484] (-1657.666) (-1653.373) (-1656.032) * [-1653.724] (-1654.185) (-1658.721) (-1656.362) -- 0:00:36
      436000 -- (-1654.059) (-1654.854) [-1654.702] (-1654.504) * (-1662.521) [-1655.508] (-1656.983) (-1658.118) -- 0:00:36
      436500 -- (-1654.749) (-1654.283) [-1657.377] (-1653.491) * (-1659.518) [-1657.854] (-1657.197) (-1656.731) -- 0:00:36
      437000 -- (-1655.730) [-1654.268] (-1655.506) (-1659.471) * (-1654.700) (-1655.570) [-1654.537] (-1655.645) -- 0:00:36
      437500 -- (-1655.446) (-1653.756) (-1655.478) [-1655.352] * (-1654.598) (-1654.715) [-1654.268] (-1661.340) -- 0:00:36
      438000 -- (-1653.500) (-1653.756) [-1656.623] (-1660.244) * [-1656.263] (-1655.123) (-1656.501) (-1653.401) -- 0:00:35
      438500 -- [-1653.508] (-1656.527) (-1657.787) (-1655.052) * (-1653.412) [-1654.367] (-1653.922) (-1654.141) -- 0:00:35
      439000 -- (-1659.039) (-1657.385) (-1660.591) [-1656.016] * (-1654.154) [-1653.976] (-1656.518) (-1654.285) -- 0:00:35
      439500 -- (-1657.958) [-1655.549] (-1655.898) (-1657.006) * (-1656.309) (-1656.407) (-1663.529) [-1655.235] -- 0:00:35
      440000 -- [-1658.277] (-1656.199) (-1658.148) (-1656.009) * (-1656.909) (-1654.678) (-1657.438) [-1655.087] -- 0:00:35

      Average standard deviation of split frequencies: 0.013051

      440500 -- [-1654.932] (-1654.842) (-1657.485) (-1654.440) * (-1656.376) (-1654.023) [-1654.861] (-1654.870) -- 0:00:35
      441000 -- (-1656.214) [-1653.390] (-1656.721) (-1654.242) * (-1656.749) (-1656.176) [-1656.144] (-1654.608) -- 0:00:36
      441500 -- [-1656.506] (-1655.378) (-1654.540) (-1656.100) * (-1656.246) (-1655.505) [-1656.049] (-1654.853) -- 0:00:36
      442000 -- [-1653.518] (-1654.691) (-1657.261) (-1661.119) * [-1654.771] (-1655.657) (-1655.079) (-1659.344) -- 0:00:36
      442500 -- (-1656.981) [-1657.499] (-1660.045) (-1659.329) * (-1655.385) (-1657.440) (-1657.590) [-1655.562] -- 0:00:36
      443000 -- (-1655.861) (-1655.932) (-1654.794) [-1656.542] * (-1656.231) (-1659.850) (-1655.589) [-1655.543] -- 0:00:36
      443500 -- [-1654.289] (-1656.357) (-1653.841) (-1660.100) * (-1654.842) (-1656.898) (-1654.259) [-1655.845] -- 0:00:36
      444000 -- (-1654.702) (-1656.440) [-1656.485] (-1663.639) * (-1659.443) (-1655.707) (-1654.336) [-1654.212] -- 0:00:36
      444500 -- (-1654.835) (-1654.148) (-1655.247) [-1655.360] * [-1658.045] (-1654.339) (-1658.792) (-1657.701) -- 0:00:36
      445000 -- (-1654.581) (-1664.146) (-1654.050) [-1654.718] * (-1657.291) [-1654.260] (-1656.126) (-1655.248) -- 0:00:36

      Average standard deviation of split frequencies: 0.012684

      445500 -- (-1659.675) (-1656.204) (-1654.630) [-1654.621] * (-1655.986) (-1658.536) (-1653.861) [-1655.070] -- 0:00:36
      446000 -- (-1656.863) (-1655.075) (-1655.106) [-1655.663] * (-1660.998) [-1654.996] (-1654.038) (-1655.860) -- 0:00:36
      446500 -- (-1657.197) (-1654.493) [-1655.261] (-1656.191) * (-1655.880) (-1661.563) (-1654.118) [-1654.795] -- 0:00:35
      447000 -- (-1656.460) (-1657.707) [-1654.809] (-1654.252) * (-1656.766) (-1656.780) (-1655.678) [-1655.391] -- 0:00:35
      447500 -- (-1655.880) (-1657.021) [-1654.120] (-1653.466) * [-1655.789] (-1655.338) (-1654.165) (-1656.018) -- 0:00:35
      448000 -- (-1656.588) (-1655.389) [-1656.505] (-1653.520) * [-1655.099] (-1655.281) (-1654.117) (-1654.609) -- 0:00:35
      448500 -- (-1655.651) [-1655.146] (-1656.543) (-1655.177) * (-1656.175) (-1654.338) (-1656.855) [-1654.648] -- 0:00:35
      449000 -- [-1654.176] (-1654.246) (-1655.055) (-1655.188) * [-1654.030] (-1654.093) (-1656.723) (-1655.415) -- 0:00:35
      449500 -- (-1655.091) (-1653.956) [-1657.289] (-1655.969) * [-1654.122] (-1656.341) (-1654.977) (-1661.910) -- 0:00:35
      450000 -- [-1656.304] (-1655.274) (-1655.232) (-1657.887) * (-1654.630) (-1661.581) [-1656.494] (-1658.745) -- 0:00:35

      Average standard deviation of split frequencies: 0.013319

      450500 -- (-1659.481) (-1656.539) [-1654.272] (-1658.949) * (-1655.246) [-1655.459] (-1659.779) (-1657.727) -- 0:00:35
      451000 -- (-1658.602) (-1656.524) (-1655.576) [-1655.655] * (-1654.976) (-1654.955) (-1658.899) [-1656.045] -- 0:00:35
      451500 -- (-1656.907) (-1654.427) (-1655.168) [-1655.487] * [-1656.815] (-1656.001) (-1657.652) (-1655.941) -- 0:00:35
      452000 -- (-1656.574) [-1656.776] (-1655.101) (-1654.006) * (-1656.515) (-1655.287) [-1658.349] (-1654.477) -- 0:00:35
      452500 -- (-1661.486) (-1656.850) (-1658.484) [-1661.429] * (-1655.088) (-1655.133) [-1656.529] (-1655.328) -- 0:00:35
      453000 -- (-1659.973) (-1653.557) [-1658.501] (-1655.123) * [-1654.381] (-1654.191) (-1655.549) (-1656.394) -- 0:00:35
      453500 -- (-1657.237) (-1655.006) (-1660.491) [-1653.256] * (-1655.033) (-1655.079) (-1658.077) [-1659.234] -- 0:00:34
      454000 -- [-1654.380] (-1654.780) (-1654.715) (-1654.407) * [-1655.738] (-1655.129) (-1656.476) (-1658.716) -- 0:00:34
      454500 -- [-1654.380] (-1655.885) (-1657.037) (-1656.677) * (-1655.227) [-1654.220] (-1653.524) (-1655.486) -- 0:00:34
      455000 -- (-1653.603) (-1655.494) (-1654.613) [-1657.003] * (-1655.214) [-1653.753] (-1653.787) (-1655.992) -- 0:00:34

      Average standard deviation of split frequencies: 0.012858

      455500 -- [-1653.827] (-1655.028) (-1654.667) (-1653.958) * (-1656.392) (-1654.863) [-1655.912] (-1655.713) -- 0:00:34
      456000 -- (-1653.669) (-1654.596) (-1653.930) [-1656.784] * (-1654.963) [-1656.384] (-1655.912) (-1656.646) -- 0:00:34
      456500 -- [-1654.893] (-1654.596) (-1656.722) (-1655.638) * [-1655.156] (-1654.362) (-1654.605) (-1655.214) -- 0:00:35
      457000 -- (-1654.575) (-1654.848) [-1655.338] (-1656.586) * (-1656.228) (-1655.582) (-1653.839) [-1655.441] -- 0:00:35
      457500 -- (-1656.269) (-1655.403) (-1655.468) [-1656.135] * (-1654.728) (-1654.538) (-1656.385) [-1654.573] -- 0:00:35
      458000 -- [-1655.890] (-1657.301) (-1655.471) (-1655.779) * [-1656.546] (-1656.040) (-1656.305) (-1655.684) -- 0:00:35
      458500 -- (-1657.161) (-1655.799) (-1656.393) [-1656.278] * (-1657.328) (-1657.632) [-1654.615] (-1660.135) -- 0:00:35
      459000 -- (-1660.551) [-1658.630] (-1658.354) (-1655.648) * (-1655.027) [-1654.715] (-1658.306) (-1663.858) -- 0:00:35
      459500 -- (-1659.107) [-1658.616] (-1654.402) (-1657.056) * (-1654.159) (-1654.323) (-1655.573) [-1657.913] -- 0:00:35
      460000 -- (-1657.361) [-1657.923] (-1654.272) (-1657.429) * [-1656.169] (-1656.781) (-1656.314) (-1655.213) -- 0:00:35

      Average standard deviation of split frequencies: 0.013367

      460500 -- (-1655.863) (-1654.257) (-1654.693) [-1654.777] * [-1653.831] (-1655.458) (-1656.379) (-1655.704) -- 0:00:35
      461000 -- (-1658.976) (-1657.850) (-1656.097) [-1654.475] * [-1655.388] (-1655.267) (-1657.207) (-1654.843) -- 0:00:35
      461500 -- (-1655.191) (-1655.240) [-1654.270] (-1654.349) * (-1657.342) (-1653.684) [-1655.207] (-1654.912) -- 0:00:35
      462000 -- (-1656.638) (-1655.945) [-1655.213] (-1660.594) * (-1658.064) (-1653.474) [-1657.097] (-1658.083) -- 0:00:34
      462500 -- (-1657.423) (-1656.255) (-1653.501) [-1655.584] * (-1656.957) [-1653.892] (-1657.189) (-1657.677) -- 0:00:34
      463000 -- (-1658.790) [-1657.099] (-1654.406) (-1655.868) * (-1657.633) (-1654.037) (-1658.933) [-1657.812] -- 0:00:34
      463500 -- (-1655.077) [-1654.542] (-1654.247) (-1658.048) * [-1657.535] (-1658.244) (-1656.068) (-1653.533) -- 0:00:34
      464000 -- (-1654.452) [-1657.011] (-1655.450) (-1656.310) * [-1656.169] (-1659.660) (-1656.265) (-1653.684) -- 0:00:34
      464500 -- [-1654.302] (-1657.743) (-1