--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 09:50:32 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/1res/argJ/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1654.87 -1658.34 2 -1654.84 -1658.49 -------------------------------------- TOTAL -1654.85 -1658.42 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.889681 0.091695 0.389242 1.542722 0.850085 1219.54 1360.27 1.000 r(A<->C){all} 0.152530 0.016973 0.000003 0.412429 0.119664 237.50 313.49 1.003 r(A<->G){all} 0.157362 0.019032 0.000071 0.452048 0.115957 172.84 235.17 1.006 r(A<->T){all} 0.168736 0.020781 0.000238 0.461045 0.130486 138.06 199.75 1.004 r(C<->G){all} 0.163163 0.019469 0.000004 0.443007 0.126294 205.02 234.54 1.009 r(C<->T){all} 0.169643 0.020161 0.000006 0.455073 0.132258 257.78 296.88 1.000 r(G<->T){all} 0.188566 0.023112 0.000134 0.487209 0.153423 246.35 250.11 1.010 pi(A){all} 0.184447 0.000120 0.163761 0.206430 0.184279 979.76 1172.11 1.000 pi(C){all} 0.312679 0.000182 0.286489 0.338848 0.312443 1243.43 1276.71 1.000 pi(G){all} 0.313480 0.000174 0.286628 0.338104 0.313384 1208.35 1292.00 1.000 pi(T){all} 0.189395 0.000127 0.168177 0.211697 0.189077 1187.56 1344.28 1.000 alpha{1,2} 0.431072 0.250555 0.000156 1.442221 0.248825 979.73 1240.36 1.000 alpha{3} 0.455859 0.229197 0.000266 1.436078 0.303634 1350.60 1390.80 1.000 pinvar{all} 0.998762 0.000002 0.996078 0.999999 0.999253 1172.27 1181.39 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1580.964085 Model 2: PositiveSelection -1580.964087 Model 0: one-ratio -1580.964097 Model 7: beta -1580.96408 Model 8: beta&w>1 -1580.964073 Model 0 vs 1 2.3999999939405825E-5 Model 2 vs 1 3.999999989900971E-6 Model 8 vs 7 1.3999999737279722E-5
>C1 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS >C2 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS >C3 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS >C4 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS >C5 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS >C6 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=407 C1 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP C2 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP C3 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP C4 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP C5 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP C6 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP ************************************************** C1 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ C2 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ C3 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ C4 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ C5 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ C6 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ ************************************************** C1 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV C2 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV C3 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV C4 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV C5 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV C6 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV ************************************************** C1 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS C2 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS C3 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS C4 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS C5 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS C6 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS ************************************************** C1 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA C2 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA C3 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA C4 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA C5 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA C6 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA ************************************************** C1 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD C2 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD C3 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD C4 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD C5 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD C6 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD ************************************************** C1 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN C2 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN C3 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN C4 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN C5 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN C6 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN ************************************************** C1 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE C2 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE C3 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE C4 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE C5 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE C6 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ************************************************** C1 ENSAYSS C2 ENSAYSS C3 ENSAYSS C4 ENSAYSS C5 ENSAYSS C6 ENSAYSS ******* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 407 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 407 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12210] Library Relaxation: Multi_proc [96] Relaxation Summary: [12210]--->[12210] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.535 Mb, Max= 30.989 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP C2 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP C3 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP C4 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP C5 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP C6 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP ************************************************** C1 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ C2 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ C3 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ C4 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ C5 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ C6 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ ************************************************** C1 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV C2 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV C3 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV C4 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV C5 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV C6 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV ************************************************** C1 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS C2 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS C3 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS C4 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS C5 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS C6 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS ************************************************** C1 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA C2 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA C3 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA C4 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA C5 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA C6 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA ************************************************** C1 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD C2 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD C3 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD C4 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD C5 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD C6 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD ************************************************** C1 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN C2 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN C3 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN C4 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN C5 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN C6 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN ************************************************** C1 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE C2 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE C3 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE C4 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE C5 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE C6 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ************************************************** C1 ENSAYSS C2 ENSAYSS C3 ENSAYSS C4 ENSAYSS C5 ENSAYSS C6 ENSAYSS ******* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA C2 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA C3 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA C4 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA C5 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA C6 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA ************************************************** C1 GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA C2 GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA C3 GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA C4 GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA C5 GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA C6 GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA ************************************************** C1 TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC C2 TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC C3 TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC C4 TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC C5 TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC C6 TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC ************************************************** C1 GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC C2 GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC C3 GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC C4 GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC C5 GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC C6 GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC ************************************************** C1 GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA C2 GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA C3 GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA C4 GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA C5 GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA C6 GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA ************************************************** C1 TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG C2 TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG C3 TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG C4 TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG C5 TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG C6 TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG ************************************************** C1 GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG C2 GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG C3 GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG C4 GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG C5 GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG C6 GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG ************************************************** C1 AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG C2 AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG C3 AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG C4 AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG C5 AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG C6 AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG ************************************************** C1 GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG C2 GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG C3 GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG C4 GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG C5 GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG C6 GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG ************************************************** C1 CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT C2 CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT C3 CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT C4 CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT C5 CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT C6 CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT ************************************************** C1 CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA C2 CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA C3 CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA C4 CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA C5 CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA C6 CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA ************************************************** C1 AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG C2 AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG C3 AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG C4 AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG C5 AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG C6 AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG ************************************************** C1 CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC C2 CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC C3 CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC C4 CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC C5 CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC C6 CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC ************************************************** C1 GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC C2 GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC C3 GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC C4 GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC C5 GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC C6 GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC ************************************************** C1 TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA C2 TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA C3 TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA C4 TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA C5 TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA C6 TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA ************************************************** C1 TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT C2 TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT C3 TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT C4 TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT C5 TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT C6 TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT ************************************************** C1 ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG C2 ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG C3 ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG C4 ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG C5 ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG C6 ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG ************************************************** C1 GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC C2 GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC C3 GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC C4 GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC C5 GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC C6 GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC ************************************************** C1 GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC C2 GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC C3 GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC C4 GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC C5 GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC C6 GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC ************************************************** C1 CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG C2 CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG C3 CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG C4 CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG C5 CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG C6 CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG ************************************************** C1 GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC C2 GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC C3 GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC C4 GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC C5 GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC C6 GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC ************************************************** C1 GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT C2 GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT C3 GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT C4 GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT C5 GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT C6 GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT ************************************************** C1 GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG C2 GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG C3 GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG C4 GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG C5 GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG C6 GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG ************************************************** C1 ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA C2 ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA C3 ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA C4 ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA C5 ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA C6 ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA ************************************************** C1 GAGAATTCGGCCTACAGTTCG C2 GAGAATTCGGCCTACAGTTCG C3 GAGAATTCGGCCTACAGTTCG C4 GAGAATTCGGCCTACAGTTCG C5 GAGAATTCGGCCTACAGTTCG C6 GAGAATTCGGCCTACAGTTCG ********************* >C1 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA GAGAATTCGGCCTACAGTTCG >C2 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA GAGAATTCGGCCTACAGTTCG >C3 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA GAGAATTCGGCCTACAGTTCG >C4 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA GAGAATTCGGCCTACAGTTCG >C5 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA GAGAATTCGGCCTACAGTTCG >C6 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA GAGAATTCGGCCTACAGTTCG >C1 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS >C2 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS >C3 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS >C4 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS >C5 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS >C6 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1221 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579772956 Setting output file names to "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1388241175 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 8446504401 Seed = 2011405613 Swapseed = 1579772956 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2732.656380 -- -24.965149 Chain 2 -- -2732.656537 -- -24.965149 Chain 3 -- -2732.656537 -- -24.965149 Chain 4 -- -2732.656537 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2732.656537 -- -24.965149 Chain 2 -- -2732.656537 -- -24.965149 Chain 3 -- -2732.656537 -- -24.965149 Chain 4 -- -2732.656537 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2732.656] (-2732.657) (-2732.657) (-2732.657) * [-2732.657] (-2732.657) (-2732.657) (-2732.657) 500 -- (-1675.446) (-1671.942) (-1704.055) [-1663.165] * (-1681.809) (-1698.936) [-1674.259] (-1689.580) -- 0:00:00 1000 -- [-1666.416] (-1667.094) (-1680.554) (-1665.810) * (-1667.642) (-1683.535) [-1663.324] (-1668.913) -- 0:00:00 1500 -- (-1659.248) (-1660.936) (-1671.446) [-1664.373] * (-1659.624) (-1670.430) [-1664.011] (-1674.232) -- 0:00:00 2000 -- (-1668.241) (-1670.226) [-1661.955] (-1671.894) * (-1669.408) (-1661.231) (-1668.694) [-1665.729] -- 0:00:00 2500 -- [-1663.070] (-1673.678) (-1662.403) (-1669.639) * [-1658.453] (-1669.676) (-1660.489) (-1662.179) -- 0:00:00 3000 -- (-1666.104) (-1664.902) (-1667.806) [-1659.541] * (-1665.068) (-1667.616) (-1662.893) [-1663.514] -- 0:05:32 3500 -- (-1664.913) [-1664.545] (-1660.795) (-1660.305) * (-1665.485) (-1664.839) [-1660.705] (-1662.979) -- 0:04:44 4000 -- (-1667.066) (-1663.208) (-1661.811) [-1662.940] * (-1661.645) (-1668.231) [-1665.597] (-1659.166) -- 0:04:09 4500 -- (-1672.107) (-1668.278) [-1663.388] (-1658.767) * [-1659.741] (-1662.747) (-1664.714) (-1664.422) -- 0:03:41 5000 -- (-1674.936) (-1659.708) [-1658.304] (-1667.699) * (-1674.136) (-1654.983) (-1662.972) [-1661.927] -- 0:03:19 Average standard deviation of split frequencies: 0.087996 5500 -- (-1665.223) (-1665.533) [-1665.984] (-1672.131) * (-1661.758) [-1655.041] (-1668.919) (-1676.857) -- 0:03:00 6000 -- [-1660.963] (-1666.828) (-1670.591) (-1671.413) * [-1658.851] (-1654.349) (-1665.243) (-1664.596) -- 0:02:45 6500 -- (-1665.737) [-1663.689] (-1665.045) (-1670.977) * (-1665.837) [-1654.225] (-1670.493) (-1663.324) -- 0:02:32 7000 -- (-1668.532) [-1672.201] (-1667.381) (-1665.511) * (-1659.955) (-1654.199) (-1661.972) [-1660.547] -- 0:02:21 7500 -- (-1667.032) [-1677.098] (-1669.744) (-1661.670) * (-1664.789) (-1657.118) [-1660.275] (-1670.359) -- 0:02:12 8000 -- (-1673.048) [-1663.534] (-1657.918) (-1669.697) * (-1669.600) (-1654.320) [-1656.421] (-1670.755) -- 0:02:04 8500 -- (-1666.677) (-1662.708) (-1656.470) [-1660.280] * (-1670.675) (-1654.187) [-1662.475] (-1665.501) -- 0:01:56 9000 -- (-1668.414) (-1661.831) [-1656.757] (-1661.283) * (-1674.802) (-1656.162) [-1657.702] (-1669.112) -- 0:01:50 9500 -- (-1660.551) (-1667.059) [-1655.391] (-1662.299) * [-1667.665] (-1656.042) (-1662.127) (-1668.241) -- 0:01:44 10000 -- (-1660.934) (-1667.230) (-1656.537) [-1667.683] * (-1657.835) [-1654.580] (-1661.514) (-1675.924) -- 0:01:39 Average standard deviation of split frequencies: 0.068300 10500 -- (-1657.701) (-1667.483) [-1654.671] (-1664.271) * [-1659.194] (-1654.253) (-1678.850) (-1671.352) -- 0:01:34 11000 -- (-1660.102) (-1666.705) [-1655.291] (-1671.479) * (-1665.786) [-1655.601] (-1662.231) (-1662.497) -- 0:01:29 11500 -- (-1657.052) [-1662.395] (-1658.777) (-1664.914) * (-1668.214) (-1655.527) [-1666.196] (-1672.538) -- 0:01:25 12000 -- (-1656.715) (-1660.174) (-1658.784) [-1663.028] * (-1662.468) (-1654.280) (-1660.933) [-1669.179] -- 0:01:22 12500 -- (-1656.625) (-1665.791) [-1657.324] (-1662.686) * (-1662.311) (-1656.374) (-1665.640) [-1671.165] -- 0:01:19 13000 -- [-1658.388] (-1664.911) (-1659.049) (-1661.069) * (-1659.948) (-1654.852) (-1663.924) [-1664.433] -- 0:01:15 13500 -- (-1658.503) [-1658.269] (-1656.628) (-1665.712) * (-1665.238) (-1654.400) [-1663.943] (-1667.203) -- 0:01:13 14000 -- [-1656.536] (-1664.165) (-1658.066) (-1666.096) * (-1670.454) [-1653.885] (-1662.638) (-1666.850) -- 0:01:10 14500 -- (-1656.869) [-1663.298] (-1657.925) (-1673.232) * (-1666.769) [-1655.202] (-1669.349) (-1664.758) -- 0:01:07 15000 -- (-1659.897) (-1678.528) [-1656.616] (-1670.054) * (-1663.435) (-1656.741) (-1679.068) [-1663.756] -- 0:01:05 Average standard deviation of split frequencies: 0.047702 15500 -- (-1656.675) [-1659.840] (-1655.465) (-1660.240) * (-1663.508) [-1657.132] (-1668.043) (-1666.847) -- 0:01:03 16000 -- (-1661.399) [-1657.773] (-1656.152) (-1664.762) * (-1665.969) (-1655.805) (-1662.658) [-1665.889] -- 0:01:01 16500 -- (-1658.838) [-1661.673] (-1656.362) (-1668.844) * (-1672.075) [-1657.002] (-1669.993) (-1673.454) -- 0:00:59 17000 -- [-1654.716] (-1661.737) (-1654.312) (-1663.719) * (-1663.924) [-1654.847] (-1661.678) (-1667.438) -- 0:00:57 17500 -- (-1657.306) (-1657.399) (-1654.176) [-1666.205] * [-1665.422] (-1656.923) (-1671.286) (-1668.398) -- 0:00:56 18000 -- [-1653.489] (-1665.840) (-1654.175) (-1666.472) * (-1667.993) (-1657.075) [-1662.714] (-1672.501) -- 0:00:54 18500 -- (-1654.499) (-1666.325) (-1654.141) [-1668.622] * [-1678.473] (-1658.319) (-1662.056) (-1671.849) -- 0:01:46 19000 -- (-1654.714) [-1659.391] (-1654.418) (-1667.055) * (-1659.039) [-1655.852] (-1669.874) (-1663.151) -- 0:01:43 19500 -- [-1656.480] (-1671.524) (-1654.418) (-1661.994) * (-1661.569) [-1656.045] (-1669.240) (-1659.648) -- 0:01:40 20000 -- (-1661.356) [-1661.437] (-1655.657) (-1660.310) * (-1664.783) (-1656.922) [-1664.837] (-1658.474) -- 0:01:38 Average standard deviation of split frequencies: 0.052463 20500 -- [-1655.125] (-1664.084) (-1655.620) (-1666.607) * (-1664.302) [-1657.616] (-1666.375) (-1666.566) -- 0:01:35 21000 -- (-1655.657) (-1666.256) [-1655.923] (-1666.213) * (-1663.141) (-1657.683) (-1664.505) [-1662.203] -- 0:01:33 21500 -- (-1655.505) [-1661.564] (-1660.240) (-1663.252) * (-1666.623) (-1659.151) (-1664.423) [-1659.969] -- 0:01:31 22000 -- (-1656.597) (-1667.114) [-1656.376] (-1665.602) * [-1662.102] (-1655.056) (-1655.726) (-1666.590) -- 0:01:28 22500 -- (-1655.105) [-1663.249] (-1656.131) (-1665.943) * (-1665.026) (-1654.221) [-1656.638] (-1664.495) -- 0:01:26 23000 -- [-1655.145] (-1668.583) (-1657.672) (-1668.459) * (-1668.568) (-1656.447) [-1655.456] (-1664.004) -- 0:01:24 23500 -- (-1655.595) (-1664.702) [-1656.404] (-1661.289) * [-1670.333] (-1655.175) (-1657.491) (-1670.533) -- 0:01:23 24000 -- (-1656.491) [-1668.102] (-1654.631) (-1660.743) * (-1669.782) (-1655.353) [-1653.592] (-1675.257) -- 0:01:21 24500 -- (-1655.549) (-1662.227) (-1654.933) [-1660.961] * (-1663.916) [-1655.126] (-1653.779) (-1661.551) -- 0:01:19 25000 -- (-1656.754) [-1654.997] (-1655.702) (-1662.731) * (-1666.345) (-1654.764) [-1654.688] (-1672.076) -- 0:01:18 Average standard deviation of split frequencies: 0.037838 25500 -- (-1653.808) (-1654.681) [-1655.989] (-1671.497) * (-1661.849) (-1655.234) (-1653.684) [-1663.722] -- 0:01:16 26000 -- (-1654.618) (-1655.933) (-1655.886) [-1657.552] * [-1661.519] (-1654.856) (-1656.013) (-1664.035) -- 0:01:14 26500 -- (-1656.521) (-1654.403) [-1654.366] (-1661.837) * (-1667.130) [-1655.734] (-1655.397) (-1668.632) -- 0:01:13 27000 -- (-1654.399) [-1655.043] (-1657.807) (-1668.691) * (-1662.208) [-1654.931] (-1656.233) (-1666.749) -- 0:01:12 27500 -- [-1657.528] (-1654.983) (-1660.025) (-1667.026) * [-1666.162] (-1654.786) (-1656.436) (-1663.931) -- 0:01:10 28000 -- (-1654.905) (-1656.283) (-1657.124) [-1663.744] * (-1667.068) [-1655.562] (-1656.655) (-1661.035) -- 0:01:09 28500 -- (-1654.649) (-1655.653) (-1655.342) [-1660.402] * (-1664.009) (-1655.076) (-1653.814) [-1671.112] -- 0:01:08 29000 -- [-1658.630] (-1656.885) (-1655.577) (-1668.972) * [-1658.454] (-1658.406) (-1655.199) (-1667.071) -- 0:01:06 29500 -- (-1657.560) (-1656.342) [-1654.688] (-1669.146) * (-1672.533) (-1656.569) (-1655.252) [-1665.572] -- 0:01:05 30000 -- (-1657.312) (-1657.620) [-1655.216] (-1669.102) * [-1663.501] (-1656.569) (-1655.256) (-1663.447) -- 0:01:04 Average standard deviation of split frequencies: 0.029280 30500 -- (-1657.812) (-1655.100) [-1654.595] (-1666.121) * (-1665.428) (-1656.230) (-1657.967) [-1657.679] -- 0:01:03 31000 -- (-1656.761) (-1654.149) [-1654.268] (-1662.428) * (-1674.881) [-1656.327] (-1657.437) (-1660.739) -- 0:01:02 31500 -- (-1658.117) [-1654.283] (-1654.061) (-1666.550) * [-1669.545] (-1656.569) (-1655.078) (-1670.600) -- 0:01:01 32000 -- (-1653.971) (-1654.409) [-1655.324] (-1670.571) * (-1675.321) [-1656.127] (-1657.451) (-1666.859) -- 0:01:00 32500 -- [-1655.493] (-1655.759) (-1654.767) (-1663.599) * (-1665.739) [-1655.318] (-1655.960) (-1659.047) -- 0:00:59 33000 -- (-1656.901) (-1655.706) [-1658.648] (-1665.282) * (-1678.713) [-1654.447] (-1658.451) (-1663.285) -- 0:00:58 33500 -- (-1655.583) (-1654.474) [-1654.735] (-1661.610) * (-1662.871) [-1656.171] (-1660.260) (-1672.814) -- 0:01:26 34000 -- (-1656.398) (-1654.649) (-1656.135) [-1660.225] * (-1657.159) (-1657.942) (-1656.429) [-1658.573] -- 0:01:25 34500 -- (-1655.232) (-1653.693) (-1658.484) [-1659.353] * [-1656.354] (-1657.581) (-1660.381) (-1661.383) -- 0:01:23 35000 -- (-1656.303) (-1655.854) (-1662.366) [-1660.719] * [-1656.521] (-1654.588) (-1657.898) (-1666.257) -- 0:01:22 Average standard deviation of split frequencies: 0.038037 35500 -- (-1654.681) [-1656.033] (-1657.194) (-1669.861) * (-1657.149) (-1654.726) [-1657.023] (-1671.465) -- 0:01:21 36000 -- (-1654.943) (-1653.419) [-1654.956] (-1661.695) * [-1658.256] (-1654.829) (-1657.005) (-1664.525) -- 0:01:20 36500 -- (-1657.279) [-1653.595] (-1656.327) (-1662.001) * (-1662.418) (-1662.545) (-1657.353) [-1661.727] -- 0:01:19 37000 -- (-1656.150) [-1653.894] (-1655.473) (-1662.731) * (-1658.427) (-1658.029) (-1654.256) [-1665.853] -- 0:01:18 37500 -- (-1659.028) (-1656.763) (-1654.597) [-1665.092] * [-1659.576] (-1654.629) (-1656.129) (-1661.967) -- 0:01:17 38000 -- (-1654.559) (-1654.009) [-1653.370] (-1666.730) * (-1657.020) (-1656.981) (-1657.398) [-1660.109] -- 0:01:15 38500 -- (-1655.603) (-1654.092) (-1655.596) [-1667.782] * (-1656.452) (-1656.604) [-1655.233] (-1663.453) -- 0:01:14 39000 -- (-1657.596) [-1655.291] (-1654.220) (-1663.952) * [-1657.733] (-1655.772) (-1656.046) (-1668.889) -- 0:01:13 39500 -- (-1655.836) (-1655.384) (-1655.003) [-1662.743] * (-1657.668) (-1653.945) [-1656.218] (-1671.424) -- 0:01:12 40000 -- (-1657.060) (-1655.427) (-1657.792) [-1666.706] * (-1658.120) [-1654.327] (-1655.947) (-1664.207) -- 0:01:12 Average standard deviation of split frequencies: 0.036139 40500 -- (-1655.677) (-1656.594) [-1655.445] (-1670.706) * (-1653.651) (-1655.567) (-1657.572) [-1664.510] -- 0:01:11 41000 -- (-1654.335) [-1653.577] (-1656.463) (-1662.585) * (-1656.011) [-1659.510] (-1656.152) (-1663.571) -- 0:01:10 41500 -- (-1654.145) [-1654.360] (-1658.007) (-1664.673) * (-1654.953) (-1657.224) [-1656.364] (-1663.548) -- 0:01:09 42000 -- (-1654.959) (-1654.754) (-1658.436) [-1666.900] * (-1658.664) (-1656.890) [-1656.201] (-1662.252) -- 0:01:08 42500 -- (-1654.916) (-1658.205) (-1659.822) [-1665.236] * (-1657.935) (-1657.928) [-1656.644] (-1671.396) -- 0:01:07 43000 -- (-1654.783) (-1659.252) (-1656.256) [-1661.246] * (-1657.800) (-1656.472) (-1656.928) [-1663.528] -- 0:01:06 43500 -- (-1655.675) (-1656.149) (-1659.914) [-1664.397] * (-1656.720) (-1655.637) (-1658.866) [-1664.367] -- 0:01:05 44000 -- (-1654.301) (-1654.050) [-1656.593] (-1664.339) * [-1655.877] (-1655.870) (-1655.086) (-1664.190) -- 0:01:05 44500 -- [-1654.313] (-1654.250) (-1663.270) (-1667.880) * (-1655.968) (-1655.712) [-1654.901] (-1671.743) -- 0:01:04 45000 -- (-1655.467) (-1653.838) [-1656.676] (-1682.518) * (-1654.378) (-1655.648) (-1654.707) [-1664.983] -- 0:01:03 Average standard deviation of split frequencies: 0.031232 45500 -- (-1654.962) [-1655.250] (-1654.709) (-1660.699) * [-1655.484] (-1656.524) (-1654.551) (-1670.497) -- 0:01:02 46000 -- (-1654.778) (-1655.218) [-1653.749] (-1666.055) * [-1655.215] (-1656.531) (-1654.384) (-1657.010) -- 0:01:02 46500 -- [-1656.489] (-1656.490) (-1659.497) (-1656.268) * (-1654.768) (-1658.450) (-1654.727) [-1654.753] -- 0:01:01 47000 -- [-1654.373] (-1654.999) (-1655.520) (-1656.076) * (-1653.646) [-1657.302] (-1657.387) (-1655.922) -- 0:01:00 47500 -- (-1655.590) (-1660.661) [-1654.045] (-1656.289) * (-1654.805) (-1657.023) [-1656.704] (-1656.532) -- 0:01:00 48000 -- (-1654.844) (-1659.250) [-1653.468] (-1656.833) * (-1656.264) (-1658.568) (-1655.876) [-1657.751] -- 0:00:59 48500 -- (-1656.285) (-1657.467) (-1653.450) [-1656.659] * (-1658.133) (-1659.944) (-1655.433) [-1654.457] -- 0:00:58 49000 -- (-1659.397) (-1659.142) [-1653.668] (-1653.679) * (-1656.619) (-1659.175) [-1654.806] (-1658.779) -- 0:00:58 49500 -- (-1654.578) (-1656.056) (-1655.413) [-1658.034] * (-1662.488) [-1654.837] (-1654.699) (-1655.220) -- 0:01:16 50000 -- (-1653.817) (-1656.349) [-1653.314] (-1657.415) * (-1659.367) [-1655.606] (-1654.526) (-1657.590) -- 0:01:16 Average standard deviation of split frequencies: 0.031169 50500 -- (-1654.414) [-1655.265] (-1655.018) (-1656.664) * [-1654.662] (-1656.694) (-1656.747) (-1653.831) -- 0:01:15 51000 -- (-1655.533) (-1655.576) [-1657.398] (-1654.319) * (-1654.524) (-1659.995) (-1660.984) [-1655.298] -- 0:01:14 51500 -- (-1655.695) (-1657.919) [-1657.755] (-1656.980) * (-1654.455) (-1660.045) (-1659.001) [-1655.062] -- 0:01:13 52000 -- (-1656.222) (-1657.929) [-1656.555] (-1657.969) * (-1655.407) (-1660.251) (-1656.227) [-1655.363] -- 0:01:12 52500 -- (-1654.722) [-1654.057] (-1655.770) (-1654.275) * (-1654.190) [-1658.046] (-1655.790) (-1657.809) -- 0:01:12 53000 -- (-1658.496) [-1653.625] (-1653.686) (-1655.276) * (-1654.202) (-1657.596) [-1657.423] (-1655.274) -- 0:01:11 53500 -- [-1653.941] (-1653.752) (-1658.959) (-1656.180) * (-1654.752) [-1655.167] (-1658.826) (-1657.263) -- 0:01:10 54000 -- (-1654.070) [-1654.872] (-1658.265) (-1656.168) * [-1654.498] (-1657.059) (-1656.962) (-1660.402) -- 0:01:10 54500 -- (-1656.037) (-1657.856) (-1659.307) [-1655.823] * (-1654.678) [-1656.876] (-1656.640) (-1656.542) -- 0:01:09 55000 -- (-1657.285) [-1656.278] (-1660.335) (-1655.268) * (-1654.384) (-1658.331) [-1655.537] (-1660.340) -- 0:01:08 Average standard deviation of split frequencies: 0.034607 55500 -- (-1657.192) [-1654.273] (-1660.040) (-1655.763) * [-1653.867] (-1656.160) (-1660.052) (-1662.544) -- 0:01:08 56000 -- (-1657.270) (-1653.942) (-1662.767) [-1656.491] * (-1654.367) (-1655.424) [-1654.883] (-1657.373) -- 0:01:07 56500 -- [-1658.488] (-1654.345) (-1657.004) (-1654.892) * [-1653.961] (-1656.161) (-1653.539) (-1655.259) -- 0:01:06 57000 -- [-1659.954] (-1655.165) (-1657.010) (-1655.226) * (-1653.905) (-1658.440) (-1653.476) [-1653.603] -- 0:01:06 57500 -- (-1659.531) (-1653.987) [-1658.522] (-1654.265) * (-1654.190) (-1657.085) (-1654.209) [-1654.063] -- 0:01:05 58000 -- (-1660.305) [-1654.659] (-1657.768) (-1654.265) * (-1655.994) [-1656.683] (-1655.723) (-1656.330) -- 0:01:04 58500 -- [-1657.244] (-1654.867) (-1656.432) (-1654.318) * (-1656.766) (-1656.330) [-1657.290] (-1656.689) -- 0:01:04 59000 -- (-1657.024) [-1653.522] (-1659.922) (-1656.123) * (-1656.548) (-1656.132) (-1658.421) [-1655.055] -- 0:01:03 59500 -- [-1654.139] (-1659.864) (-1657.102) (-1656.962) * (-1657.256) (-1654.892) [-1660.100] (-1654.837) -- 0:01:03 60000 -- (-1653.665) [-1655.812] (-1655.595) (-1655.343) * (-1655.948) (-1655.842) (-1657.974) [-1655.928] -- 0:01:02 Average standard deviation of split frequencies: 0.034738 60500 -- [-1654.354] (-1654.023) (-1657.083) (-1654.912) * [-1656.789] (-1656.646) (-1656.395) (-1656.310) -- 0:01:02 61000 -- [-1654.205] (-1653.811) (-1658.264) (-1654.259) * (-1657.196) (-1655.987) (-1654.774) [-1656.255] -- 0:01:01 61500 -- (-1656.284) [-1654.651] (-1654.717) (-1655.677) * [-1657.993] (-1656.252) (-1655.905) (-1658.673) -- 0:01:01 62000 -- (-1658.039) (-1654.265) (-1654.530) [-1653.646] * (-1656.802) (-1654.985) (-1657.704) [-1658.374] -- 0:01:00 62500 -- [-1654.344] (-1654.193) (-1655.319) (-1655.720) * (-1656.073) (-1657.252) (-1657.699) [-1655.260] -- 0:01:00 63000 -- [-1654.013] (-1656.254) (-1656.386) (-1655.720) * (-1657.282) [-1653.787] (-1660.810) (-1654.544) -- 0:00:59 63500 -- (-1654.406) [-1656.334] (-1655.487) (-1654.541) * (-1661.848) (-1653.600) (-1659.105) [-1654.173] -- 0:00:58 64000 -- (-1656.160) [-1656.607] (-1659.805) (-1657.409) * (-1656.528) (-1653.721) [-1656.711] (-1654.821) -- 0:00:58 64500 -- (-1656.674) [-1656.844] (-1655.451) (-1654.957) * (-1657.356) (-1653.897) [-1658.234] (-1658.411) -- 0:00:58 65000 -- (-1658.098) [-1658.239] (-1655.070) (-1654.292) * (-1655.775) [-1653.894] (-1657.325) (-1656.602) -- 0:00:57 Average standard deviation of split frequencies: 0.032651 65500 -- (-1655.200) [-1656.406] (-1654.829) (-1654.619) * (-1657.041) (-1658.204) [-1658.510] (-1653.845) -- 0:01:11 66000 -- [-1659.026] (-1658.024) (-1660.280) (-1654.670) * (-1655.403) (-1657.905) [-1656.411] (-1654.830) -- 0:01:10 66500 -- [-1657.279] (-1657.307) (-1655.484) (-1654.051) * (-1656.161) [-1655.140] (-1656.788) (-1660.601) -- 0:01:10 67000 -- [-1660.177] (-1657.200) (-1657.574) (-1654.050) * (-1658.033) (-1653.483) [-1656.907] (-1654.346) -- 0:01:09 67500 -- (-1654.221) [-1653.645] (-1654.073) (-1654.100) * (-1658.070) (-1656.145) (-1653.813) [-1654.346] -- 0:01:09 68000 -- [-1656.123] (-1654.923) (-1655.218) (-1655.279) * (-1654.683) (-1656.535) [-1656.408] (-1653.615) -- 0:01:08 68500 -- [-1655.429] (-1654.799) (-1654.868) (-1656.423) * (-1655.203) (-1657.489) [-1655.352] (-1654.315) -- 0:01:07 69000 -- (-1655.317) [-1656.546] (-1654.384) (-1657.900) * (-1655.805) [-1658.524] (-1654.395) (-1654.736) -- 0:01:07 69500 -- (-1655.077) (-1656.442) (-1654.159) [-1654.276] * [-1655.342] (-1659.860) (-1653.910) (-1655.555) -- 0:01:06 70000 -- [-1654.025] (-1657.004) (-1654.380) (-1654.608) * (-1656.138) (-1655.396) [-1653.853] (-1654.229) -- 0:01:06 Average standard deviation of split frequencies: 0.037567 70500 -- (-1656.239) (-1654.552) (-1656.189) [-1656.519] * (-1657.363) (-1655.953) [-1654.036] (-1654.621) -- 0:01:05 71000 -- (-1658.684) (-1654.280) [-1655.226] (-1657.002) * (-1659.668) (-1655.130) (-1657.077) [-1655.215] -- 0:01:05 71500 -- (-1657.252) [-1654.601] (-1656.576) (-1654.801) * (-1658.380) [-1654.760] (-1655.817) (-1657.073) -- 0:01:04 72000 -- (-1659.189) (-1654.781) (-1657.881) [-1654.225] * (-1660.436) (-1653.879) (-1657.666) [-1655.708] -- 0:01:04 72500 -- (-1659.587) (-1655.203) [-1658.560] (-1654.195) * [-1656.255] (-1653.645) (-1654.101) (-1655.819) -- 0:01:03 73000 -- (-1657.897) (-1654.486) [-1657.630] (-1654.250) * (-1654.468) [-1653.515] (-1655.843) (-1653.805) -- 0:01:03 73500 -- [-1654.681] (-1655.900) (-1655.247) (-1655.549) * (-1654.934) (-1654.838) (-1658.548) [-1655.883] -- 0:01:03 74000 -- (-1656.274) [-1654.379] (-1654.451) (-1656.404) * (-1655.199) (-1655.253) [-1657.111] (-1663.825) -- 0:01:02 74500 -- (-1657.037) [-1656.817] (-1658.162) (-1657.397) * (-1655.195) [-1657.282] (-1661.646) (-1658.795) -- 0:01:02 75000 -- (-1656.781) (-1655.989) (-1656.528) [-1655.137] * (-1655.106) (-1658.370) (-1661.493) [-1654.691] -- 0:01:01 Average standard deviation of split frequencies: 0.036182 75500 -- (-1654.936) [-1653.912] (-1654.851) (-1654.680) * (-1655.687) (-1654.370) (-1656.804) [-1655.014] -- 0:01:01 76000 -- (-1653.420) (-1653.924) (-1654.925) [-1655.519] * (-1658.941) (-1656.923) (-1657.520) [-1655.461] -- 0:01:00 76500 -- (-1655.030) (-1654.796) [-1656.148] (-1658.313) * [-1656.829] (-1656.397) (-1658.073) (-1654.887) -- 0:01:00 77000 -- (-1653.757) (-1654.920) [-1653.579] (-1662.111) * [-1654.784] (-1655.002) (-1655.652) (-1655.590) -- 0:00:59 77500 -- (-1653.838) [-1657.533] (-1657.305) (-1663.268) * (-1654.685) (-1658.096) (-1653.837) [-1657.504] -- 0:00:59 78000 -- (-1653.838) (-1654.527) (-1655.573) [-1658.667] * (-1654.462) [-1657.856] (-1657.643) (-1654.192) -- 0:00:59 78500 -- (-1654.084) [-1654.548] (-1655.257) (-1655.564) * [-1657.032] (-1660.077) (-1656.146) (-1654.219) -- 0:00:58 79000 -- (-1654.062) [-1654.547] (-1654.469) (-1657.809) * (-1657.858) (-1658.757) [-1654.967] (-1656.622) -- 0:00:58 79500 -- (-1655.298) [-1654.748] (-1655.109) (-1657.612) * [-1653.987] (-1660.726) (-1656.671) (-1654.598) -- 0:00:57 80000 -- (-1656.317) (-1654.475) (-1653.981) [-1657.196] * (-1655.396) (-1661.181) [-1658.002] (-1654.987) -- 0:00:57 Average standard deviation of split frequencies: 0.037469 80500 -- (-1655.495) (-1653.432) (-1657.121) [-1658.467] * (-1654.844) (-1660.382) (-1655.695) [-1654.611] -- 0:00:57 81000 -- (-1655.383) [-1653.421] (-1654.597) (-1661.953) * [-1654.669] (-1659.697) (-1654.631) (-1654.665) -- 0:01:08 81500 -- (-1658.209) [-1654.302] (-1655.410) (-1658.969) * [-1654.716] (-1659.038) (-1654.721) (-1655.033) -- 0:01:07 82000 -- (-1658.793) (-1657.134) [-1655.553] (-1654.173) * (-1654.805) (-1654.062) [-1656.698] (-1655.512) -- 0:01:07 82500 -- [-1657.810] (-1654.866) (-1655.314) (-1653.624) * [-1657.994] (-1654.457) (-1654.845) (-1656.256) -- 0:01:06 83000 -- (-1657.900) [-1656.264] (-1655.453) (-1659.354) * (-1657.726) (-1655.272) [-1656.105] (-1655.476) -- 0:01:06 83500 -- (-1657.347) [-1657.747] (-1660.391) (-1656.396) * (-1656.906) (-1655.727) (-1656.589) [-1655.046] -- 0:01:05 84000 -- (-1657.480) [-1653.857] (-1656.914) (-1656.226) * (-1657.452) (-1654.721) [-1655.590] (-1654.632) -- 0:01:05 84500 -- (-1656.950) (-1655.803) [-1654.988] (-1657.473) * (-1658.021) (-1655.743) [-1654.461] (-1654.123) -- 0:01:05 85000 -- (-1657.656) (-1656.876) (-1656.095) [-1656.326] * (-1657.967) (-1654.586) [-1655.699] (-1655.324) -- 0:01:04 Average standard deviation of split frequencies: 0.039893 85500 -- (-1656.040) (-1654.241) (-1657.799) [-1657.442] * [-1655.736] (-1656.954) (-1656.449) (-1659.188) -- 0:01:04 86000 -- (-1659.355) (-1657.675) [-1654.269] (-1654.950) * (-1657.390) (-1656.411) [-1654.430] (-1656.700) -- 0:01:03 86500 -- (-1654.233) (-1656.939) [-1654.670] (-1654.932) * (-1654.882) (-1656.603) (-1657.432) [-1654.918] -- 0:01:03 87000 -- (-1656.817) (-1657.153) [-1658.886] (-1656.608) * (-1654.963) (-1656.878) (-1653.596) [-1654.073] -- 0:01:02 87500 -- [-1654.448] (-1654.312) (-1656.061) (-1654.473) * (-1655.092) (-1657.519) (-1656.871) [-1655.249] -- 0:01:02 88000 -- (-1653.572) (-1654.189) [-1654.068] (-1656.701) * (-1655.334) (-1657.448) [-1657.373] (-1654.216) -- 0:01:02 88500 -- (-1655.006) (-1654.210) [-1655.781] (-1654.649) * [-1654.260] (-1659.020) (-1654.623) (-1653.613) -- 0:01:01 89000 -- [-1656.152] (-1653.717) (-1655.291) (-1656.113) * (-1654.571) [-1656.825] (-1654.623) (-1658.015) -- 0:01:01 89500 -- (-1656.020) [-1658.996] (-1655.905) (-1653.975) * [-1656.037] (-1657.145) (-1654.500) (-1653.835) -- 0:01:01 90000 -- (-1654.724) (-1657.219) [-1659.342] (-1654.114) * (-1654.131) (-1656.313) (-1656.653) [-1654.667] -- 0:01:00 Average standard deviation of split frequencies: 0.034662 90500 -- (-1653.705) (-1654.948) (-1655.870) [-1654.666] * [-1653.721] (-1654.644) (-1655.781) (-1657.030) -- 0:01:00 91000 -- (-1654.197) (-1655.067) [-1657.728] (-1654.561) * (-1653.800) (-1653.486) (-1656.757) [-1658.041] -- 0:00:59 91500 -- (-1656.653) (-1654.456) (-1658.799) [-1655.933] * (-1656.153) [-1653.947] (-1655.112) (-1654.862) -- 0:00:59 92000 -- (-1656.659) [-1653.491] (-1663.921) (-1656.780) * (-1656.277) [-1655.894] (-1656.445) (-1654.972) -- 0:00:59 92500 -- (-1654.759) (-1653.530) (-1661.860) [-1657.039] * [-1657.120] (-1655.079) (-1656.127) (-1654.332) -- 0:00:58 93000 -- (-1653.713) (-1655.462) [-1658.499] (-1658.409) * [-1655.919] (-1654.394) (-1655.804) (-1655.056) -- 0:00:58 93500 -- (-1655.882) [-1654.353] (-1661.849) (-1657.068) * [-1655.191] (-1654.132) (-1654.870) (-1657.999) -- 0:00:58 94000 -- (-1653.790) (-1654.206) [-1655.796] (-1657.314) * (-1655.138) (-1655.210) (-1655.863) [-1655.098] -- 0:00:57 94500 -- (-1653.694) (-1654.543) (-1654.562) [-1655.241] * [-1661.557] (-1657.458) (-1655.444) (-1654.472) -- 0:00:57 95000 -- (-1655.531) (-1654.140) (-1657.904) [-1656.829] * [-1656.792] (-1658.982) (-1654.640) (-1657.246) -- 0:00:57 Average standard deviation of split frequencies: 0.030497 95500 -- [-1654.949] (-1657.235) (-1655.074) (-1657.372) * (-1655.515) (-1655.687) [-1656.109] (-1665.070) -- 0:00:56 96000 -- (-1658.998) [-1658.139] (-1653.641) (-1654.288) * (-1655.325) [-1655.716] (-1656.156) (-1656.057) -- 0:00:56 96500 -- (-1654.247) (-1655.824) [-1654.233] (-1655.358) * (-1658.727) (-1656.504) (-1654.815) [-1655.221] -- 0:01:05 97000 -- [-1654.143] (-1653.798) (-1653.920) (-1659.110) * (-1656.401) (-1656.362) [-1655.491] (-1657.484) -- 0:01:05 97500 -- (-1653.419) (-1653.614) (-1658.052) [-1655.854] * (-1656.978) [-1656.579] (-1658.788) (-1656.981) -- 0:01:04 98000 -- (-1654.304) [-1654.128] (-1655.227) (-1657.541) * (-1655.580) [-1660.082] (-1653.918) (-1656.149) -- 0:01:04 98500 -- [-1655.158] (-1656.421) (-1654.796) (-1653.759) * (-1657.425) (-1654.993) (-1653.764) [-1654.077] -- 0:01:04 99000 -- (-1654.424) (-1654.910) (-1654.147) [-1653.216] * [-1656.386] (-1655.765) (-1655.822) (-1654.743) -- 0:01:03 99500 -- (-1655.454) (-1655.568) (-1660.508) [-1653.208] * (-1655.951) [-1656.924] (-1655.720) (-1655.865) -- 0:01:03 100000 -- [-1653.831] (-1657.183) (-1656.037) (-1653.348) * (-1660.858) (-1655.139) (-1655.720) [-1655.356] -- 0:01:02 Average standard deviation of split frequencies: 0.034601 100500 -- (-1656.332) (-1656.979) (-1663.095) [-1657.978] * (-1662.006) (-1654.514) (-1655.205) [-1654.070] -- 0:01:02 101000 -- (-1657.618) [-1655.107] (-1661.807) (-1654.516) * (-1664.059) [-1654.347] (-1655.547) (-1654.144) -- 0:01:02 101500 -- (-1654.224) (-1656.388) (-1655.295) [-1654.249] * [-1660.745] (-1653.735) (-1655.936) (-1659.308) -- 0:01:01 102000 -- [-1653.931] (-1656.262) (-1654.444) (-1653.351) * (-1657.161) (-1655.989) [-1655.223] (-1657.219) -- 0:01:01 102500 -- [-1656.640] (-1657.551) (-1654.773) (-1654.696) * [-1656.643] (-1654.663) (-1655.603) (-1658.492) -- 0:01:01 103000 -- [-1656.730] (-1658.232) (-1655.272) (-1657.074) * (-1657.882) (-1656.474) (-1655.251) [-1655.981] -- 0:01:00 103500 -- (-1657.731) (-1655.849) [-1655.063] (-1655.446) * (-1657.624) [-1654.705] (-1655.282) (-1656.673) -- 0:01:00 104000 -- [-1659.639] (-1655.446) (-1655.537) (-1655.719) * (-1655.213) (-1656.302) (-1654.921) [-1658.584] -- 0:01:00 104500 -- (-1658.897) [-1654.340] (-1655.847) (-1653.545) * (-1655.224) (-1655.537) (-1655.808) [-1654.289] -- 0:00:59 105000 -- (-1657.984) [-1654.763] (-1655.928) (-1658.263) * (-1656.655) [-1654.465] (-1655.242) (-1654.222) -- 0:00:59 Average standard deviation of split frequencies: 0.029492 105500 -- (-1656.954) [-1656.887] (-1655.791) (-1659.323) * (-1657.443) (-1653.732) [-1655.583] (-1654.107) -- 0:00:59 106000 -- [-1654.351] (-1656.940) (-1657.671) (-1656.709) * (-1657.269) (-1655.438) [-1656.227] (-1653.775) -- 0:00:59 106500 -- (-1655.350) (-1656.100) (-1655.341) [-1653.836] * (-1654.984) [-1657.081] (-1655.966) (-1654.921) -- 0:00:58 107000 -- (-1654.282) (-1654.920) [-1656.959] (-1654.005) * (-1659.255) (-1654.938) (-1659.358) [-1655.276] -- 0:00:58 107500 -- [-1659.381] (-1653.365) (-1656.854) (-1653.974) * (-1656.059) (-1655.273) (-1659.791) [-1655.533] -- 0:00:58 108000 -- (-1667.490) [-1655.712] (-1657.432) (-1654.750) * (-1655.784) (-1657.298) [-1659.621] (-1658.444) -- 0:00:57 108500 -- (-1656.301) (-1665.397) [-1657.833] (-1653.690) * (-1656.757) [-1657.026] (-1655.184) (-1659.057) -- 0:00:57 109000 -- (-1654.469) [-1661.607] (-1657.194) (-1653.396) * (-1655.055) (-1655.151) (-1655.247) [-1658.812] -- 0:00:57 109500 -- (-1656.355) (-1653.819) (-1658.458) [-1654.901] * (-1655.525) (-1655.196) (-1654.941) [-1658.607] -- 0:00:56 110000 -- (-1658.812) (-1654.916) (-1662.548) [-1658.158] * (-1654.699) (-1654.829) (-1660.556) [-1658.897] -- 0:00:56 Average standard deviation of split frequencies: 0.031474 110500 -- (-1661.711) [-1656.256] (-1656.369) (-1657.670) * (-1655.005) (-1654.880) (-1660.473) [-1654.677] -- 0:00:56 111000 -- (-1654.125) (-1657.500) (-1656.530) [-1658.518] * (-1655.484) (-1655.317) [-1655.293] (-1654.707) -- 0:00:56 111500 -- (-1654.323) [-1654.777] (-1655.653) (-1658.001) * (-1654.931) (-1655.651) (-1654.624) [-1657.773] -- 0:00:55 112000 -- (-1654.207) (-1654.245) [-1656.862] (-1657.126) * [-1655.225] (-1655.323) (-1654.757) (-1654.051) -- 0:01:03 112500 -- (-1654.202) [-1656.728] (-1657.965) (-1653.981) * [-1654.636] (-1655.528) (-1655.633) (-1653.652) -- 0:01:03 113000 -- (-1655.037) (-1655.531) (-1657.201) [-1654.601] * (-1655.245) (-1654.851) (-1655.595) [-1653.825] -- 0:01:02 113500 -- (-1655.337) (-1657.389) (-1660.203) [-1654.574] * (-1656.016) (-1654.933) (-1658.008) [-1653.825] -- 0:01:02 114000 -- (-1655.969) (-1659.988) (-1658.439) [-1655.245] * (-1655.955) [-1654.384] (-1654.644) (-1655.122) -- 0:01:02 114500 -- (-1654.209) (-1656.056) (-1658.467) [-1654.665] * [-1655.679] (-1654.537) (-1655.413) (-1654.665) -- 0:01:01 115000 -- (-1659.074) [-1654.784] (-1658.331) (-1653.454) * (-1654.013) [-1654.639] (-1656.021) (-1655.594) -- 0:01:01 Average standard deviation of split frequencies: 0.030837 115500 -- (-1662.092) (-1655.983) [-1654.154] (-1653.563) * [-1659.951] (-1655.093) (-1654.781) (-1656.002) -- 0:01:01 116000 -- (-1656.714) [-1654.833] (-1654.753) (-1659.581) * [-1653.970] (-1659.459) (-1656.768) (-1657.027) -- 0:01:00 116500 -- (-1657.921) (-1654.765) [-1654.694] (-1656.100) * (-1655.012) (-1654.321) [-1655.082] (-1654.761) -- 0:01:00 117000 -- (-1655.595) [-1654.979] (-1653.973) (-1657.816) * (-1653.162) (-1654.603) (-1655.782) [-1653.555] -- 0:01:00 117500 -- (-1655.186) (-1654.985) (-1653.925) [-1657.104] * (-1653.877) (-1656.152) (-1656.617) [-1653.602] -- 0:01:00 118000 -- (-1656.205) [-1654.726] (-1653.777) (-1656.670) * (-1653.942) (-1655.300) [-1656.032] (-1654.353) -- 0:00:59 118500 -- (-1655.280) (-1654.734) (-1654.630) [-1654.944] * (-1653.157) [-1654.645] (-1655.087) (-1655.438) -- 0:00:59 119000 -- [-1653.906] (-1654.708) (-1654.440) (-1656.179) * [-1654.311] (-1654.635) (-1659.095) (-1655.616) -- 0:00:59 119500 -- (-1656.668) [-1656.865] (-1656.370) (-1656.407) * (-1653.523) [-1654.241] (-1657.328) (-1657.789) -- 0:00:58 120000 -- (-1654.232) [-1657.297] (-1655.841) (-1657.129) * (-1654.773) (-1654.024) (-1659.386) [-1655.959] -- 0:00:58 Average standard deviation of split frequencies: 0.029734 120500 -- (-1654.250) (-1658.155) (-1655.792) [-1657.448] * [-1653.909] (-1654.479) (-1655.084) (-1657.300) -- 0:00:58 121000 -- (-1654.255) [-1657.590] (-1656.218) (-1659.271) * (-1653.780) [-1653.426] (-1657.194) (-1654.089) -- 0:00:58 121500 -- (-1655.777) (-1658.058) [-1654.917] (-1657.802) * (-1653.291) (-1654.984) [-1657.713] (-1653.332) -- 0:00:57 122000 -- [-1655.246] (-1657.375) (-1654.992) (-1655.182) * (-1653.879) (-1654.205) [-1655.399] (-1654.817) -- 0:00:57 122500 -- [-1655.386] (-1659.923) (-1653.786) (-1654.021) * (-1655.625) (-1654.043) [-1655.097] (-1655.436) -- 0:00:57 123000 -- (-1656.369) (-1657.447) [-1653.751] (-1654.700) * (-1658.031) [-1654.528] (-1654.578) (-1659.530) -- 0:00:57 123500 -- (-1656.840) [-1660.690] (-1653.757) (-1655.622) * (-1655.487) (-1657.328) (-1656.592) [-1658.989] -- 0:00:56 124000 -- (-1655.450) (-1654.389) [-1655.168] (-1655.009) * (-1657.266) (-1657.261) [-1655.710] (-1655.509) -- 0:00:56 124500 -- (-1654.419) (-1654.843) (-1655.264) [-1653.464] * (-1662.279) [-1655.203] (-1655.121) (-1655.146) -- 0:00:56 125000 -- (-1653.534) (-1654.575) (-1654.364) [-1653.383] * (-1657.905) (-1654.341) [-1654.771] (-1654.123) -- 0:00:56 Average standard deviation of split frequencies: 0.024408 125500 -- (-1654.760) [-1654.533] (-1654.622) (-1654.439) * (-1659.512) (-1653.283) [-1653.677] (-1654.429) -- 0:00:55 126000 -- (-1654.070) (-1653.639) (-1657.846) [-1654.512] * (-1657.859) (-1657.720) [-1654.842] (-1655.995) -- 0:00:55 126500 -- (-1654.355) (-1653.897) (-1662.434) [-1656.145] * [-1656.150] (-1656.074) (-1654.577) (-1655.618) -- 0:00:55 127000 -- (-1658.144) (-1654.172) (-1660.905) [-1655.351] * (-1656.624) (-1654.143) (-1654.639) [-1655.109] -- 0:00:54 127500 -- [-1657.835] (-1654.700) (-1655.100) (-1654.780) * (-1657.003) (-1654.002) (-1654.382) [-1655.244] -- 0:00:54 128000 -- (-1655.311) [-1654.015] (-1655.475) (-1655.922) * (-1659.141) [-1653.716] (-1655.004) (-1658.708) -- 0:01:01 128500 -- [-1655.692] (-1655.885) (-1654.766) (-1655.298) * [-1658.581] (-1653.440) (-1654.517) (-1656.481) -- 0:01:01 129000 -- (-1661.051) [-1656.745] (-1654.738) (-1659.089) * [-1660.081] (-1653.439) (-1656.818) (-1654.419) -- 0:01:00 129500 -- (-1658.459) (-1655.776) [-1656.733] (-1655.717) * [-1657.246] (-1653.421) (-1655.602) (-1654.748) -- 0:01:00 130000 -- [-1654.888] (-1658.861) (-1654.747) (-1665.472) * (-1654.272) (-1653.327) (-1655.595) [-1655.441] -- 0:01:00 Average standard deviation of split frequencies: 0.023089 130500 -- (-1655.721) (-1659.028) [-1654.220] (-1661.458) * (-1654.516) [-1653.353] (-1658.699) (-1654.134) -- 0:00:59 131000 -- [-1655.862] (-1655.962) (-1655.265) (-1653.424) * (-1657.313) [-1653.655] (-1660.483) (-1654.857) -- 0:00:59 131500 -- (-1656.012) (-1655.432) (-1654.817) [-1653.845] * [-1655.543] (-1653.419) (-1656.877) (-1655.753) -- 0:00:59 132000 -- (-1657.534) [-1653.765] (-1654.480) (-1658.483) * (-1655.274) [-1653.969] (-1656.580) (-1654.353) -- 0:00:59 132500 -- [-1655.171] (-1656.408) (-1653.830) (-1658.234) * [-1656.432] (-1653.963) (-1657.887) (-1654.571) -- 0:00:58 133000 -- (-1654.364) (-1655.814) (-1655.349) [-1656.792] * (-1656.021) [-1654.482] (-1654.852) (-1657.006) -- 0:00:58 133500 -- (-1655.730) [-1655.208] (-1658.322) (-1655.583) * (-1657.336) [-1655.185] (-1655.606) (-1656.769) -- 0:00:58 134000 -- (-1655.772) (-1664.299) [-1655.140] (-1660.501) * (-1657.795) [-1656.062] (-1663.089) (-1656.513) -- 0:00:58 134500 -- (-1656.510) (-1661.701) [-1658.123] (-1658.620) * (-1658.750) (-1660.026) [-1656.564] (-1656.647) -- 0:00:57 135000 -- (-1653.847) (-1655.356) (-1655.792) [-1658.097] * (-1656.516) (-1656.162) [-1654.334] (-1655.210) -- 0:00:57 Average standard deviation of split frequencies: 0.020432 135500 -- (-1654.591) (-1654.397) [-1654.574] (-1656.004) * [-1657.051] (-1656.016) (-1656.024) (-1658.145) -- 0:00:57 136000 -- [-1655.593] (-1655.605) (-1654.941) (-1654.123) * (-1655.133) (-1657.863) (-1656.895) [-1657.740] -- 0:00:57 136500 -- [-1653.131] (-1654.798) (-1654.867) (-1654.863) * (-1654.640) (-1656.940) (-1655.152) [-1660.067] -- 0:00:56 137000 -- (-1656.588) (-1656.748) (-1656.834) [-1656.844] * (-1654.596) (-1654.629) (-1655.841) [-1658.311] -- 0:00:56 137500 -- (-1653.682) (-1655.619) [-1657.044] (-1655.166) * (-1655.552) (-1654.485) (-1654.629) [-1655.594] -- 0:00:56 138000 -- (-1654.220) (-1655.759) (-1655.683) [-1656.679] * (-1654.931) (-1653.856) [-1654.401] (-1654.429) -- 0:00:56 138500 -- (-1654.234) [-1654.413] (-1655.722) (-1655.287) * [-1654.316] (-1654.365) (-1656.192) (-1656.438) -- 0:00:55 139000 -- [-1653.992] (-1654.416) (-1653.293) (-1655.573) * (-1655.201) [-1654.983] (-1655.278) (-1656.494) -- 0:00:55 139500 -- (-1657.182) (-1655.157) [-1656.122] (-1654.323) * (-1656.104) [-1654.843] (-1654.095) (-1655.153) -- 0:00:55 140000 -- (-1657.416) [-1656.095] (-1654.340) (-1654.588) * (-1654.468) (-1655.796) [-1655.477] (-1654.548) -- 0:00:55 Average standard deviation of split frequencies: 0.020293 140500 -- (-1657.682) (-1656.969) [-1655.295] (-1654.955) * [-1654.530] (-1654.363) (-1653.871) (-1654.321) -- 0:00:55 141000 -- (-1657.174) (-1656.164) [-1653.344] (-1654.232) * (-1656.104) [-1654.613] (-1655.184) (-1654.321) -- 0:00:54 141500 -- [-1657.662] (-1659.425) (-1653.903) (-1653.781) * (-1657.603) [-1654.348] (-1656.433) (-1654.802) -- 0:00:54 142000 -- (-1660.631) (-1656.324) [-1654.836] (-1654.404) * [-1655.972] (-1653.832) (-1654.396) (-1656.742) -- 0:00:54 142500 -- (-1656.736) (-1656.114) (-1654.000) [-1654.078] * (-1655.841) (-1654.019) (-1657.057) [-1655.389] -- 0:00:54 143000 -- [-1653.909] (-1655.871) (-1658.096) (-1657.240) * (-1657.167) (-1653.894) [-1655.404] (-1655.364) -- 0:00:53 143500 -- [-1653.704] (-1653.991) (-1655.198) (-1656.873) * (-1654.103) (-1665.714) [-1654.025] (-1656.640) -- 0:00:53 144000 -- (-1657.845) (-1654.154) (-1654.601) [-1656.797] * (-1654.499) (-1663.582) [-1655.373] (-1655.640) -- 0:00:59 144500 -- (-1653.925) (-1656.032) [-1654.390] (-1655.771) * [-1655.259] (-1654.298) (-1655.485) (-1654.201) -- 0:00:59 145000 -- (-1657.201) (-1654.307) [-1654.360] (-1656.570) * (-1655.838) (-1653.595) (-1654.576) [-1654.449] -- 0:00:58 Average standard deviation of split frequencies: 0.019680 145500 -- (-1655.174) [-1654.009] (-1654.572) (-1655.487) * (-1658.167) (-1656.322) [-1654.951] (-1655.527) -- 0:00:58 146000 -- (-1656.946) [-1654.605] (-1656.223) (-1656.727) * (-1655.222) (-1654.808) (-1655.572) [-1657.403] -- 0:00:58 146500 -- (-1656.080) [-1656.222] (-1655.533) (-1653.483) * [-1656.614] (-1655.828) (-1659.970) (-1654.304) -- 0:00:58 147000 -- (-1655.701) (-1660.566) [-1655.343] (-1653.573) * [-1657.241] (-1654.503) (-1657.218) (-1654.756) -- 0:00:58 147500 -- (-1657.753) (-1655.164) [-1657.287] (-1656.913) * (-1656.332) (-1659.360) [-1656.972] (-1654.483) -- 0:00:57 148000 -- (-1657.307) (-1656.107) [-1654.095] (-1655.396) * (-1659.087) [-1660.806] (-1654.522) (-1655.283) -- 0:00:57 148500 -- (-1654.946) [-1654.576] (-1654.852) (-1655.893) * (-1657.881) [-1657.281] (-1654.776) (-1656.681) -- 0:00:57 149000 -- (-1655.095) (-1655.540) [-1659.141] (-1654.836) * (-1658.478) (-1655.837) (-1656.755) [-1656.913] -- 0:00:57 149500 -- (-1657.041) [-1654.886] (-1656.648) (-1654.837) * (-1659.048) (-1657.691) [-1657.179] (-1656.455) -- 0:00:56 150000 -- (-1655.347) [-1654.398] (-1656.969) (-1654.777) * (-1653.613) (-1658.637) [-1656.139] (-1655.765) -- 0:00:56 Average standard deviation of split frequencies: 0.018177 150500 -- (-1654.065) (-1658.378) [-1658.845] (-1654.368) * [-1654.295] (-1658.146) (-1657.346) (-1655.264) -- 0:00:56 151000 -- (-1655.720) (-1655.579) (-1656.760) [-1654.160] * (-1654.509) [-1654.702] (-1653.940) (-1655.909) -- 0:00:56 151500 -- (-1654.470) (-1655.387) (-1655.697) [-1656.266] * (-1655.816) (-1654.861) [-1653.271] (-1655.506) -- 0:00:56 152000 -- [-1656.218] (-1661.287) (-1656.267) (-1658.780) * [-1655.748] (-1654.347) (-1654.311) (-1658.056) -- 0:00:55 152500 -- [-1657.991] (-1658.474) (-1655.732) (-1657.968) * (-1657.999) (-1660.411) [-1653.849] (-1654.278) -- 0:00:55 153000 -- (-1660.910) (-1657.036) (-1657.155) [-1657.311] * (-1655.200) (-1654.474) (-1654.087) [-1655.188] -- 0:00:55 153500 -- [-1657.360] (-1655.485) (-1655.253) (-1657.520) * (-1660.301) [-1655.444] (-1654.028) (-1654.655) -- 0:00:55 154000 -- (-1654.106) (-1656.903) [-1658.133] (-1657.363) * [-1659.089] (-1657.148) (-1656.699) (-1656.130) -- 0:00:54 154500 -- (-1654.112) [-1654.632] (-1656.811) (-1655.797) * [-1654.430] (-1658.771) (-1654.086) (-1656.139) -- 0:00:54 155000 -- (-1653.985) [-1654.434] (-1655.792) (-1656.296) * (-1654.430) (-1655.746) [-1656.474] (-1653.471) -- 0:00:54 Average standard deviation of split frequencies: 0.017527 155500 -- (-1654.031) [-1656.414] (-1654.170) (-1657.451) * [-1654.429] (-1657.265) (-1659.146) (-1654.871) -- 0:00:54 156000 -- (-1665.159) (-1656.814) [-1653.736] (-1654.901) * (-1655.645) (-1655.873) (-1657.142) [-1653.974] -- 0:00:54 156500 -- (-1659.155) (-1657.843) (-1656.091) [-1655.003] * (-1657.486) (-1659.865) (-1656.345) [-1655.103] -- 0:00:53 157000 -- (-1655.627) [-1655.882] (-1654.057) (-1657.877) * [-1653.793] (-1663.313) (-1654.681) (-1655.311) -- 0:00:53 157500 -- (-1656.114) (-1662.571) (-1654.702) [-1657.004] * (-1655.891) (-1665.798) [-1654.467] (-1655.552) -- 0:00:53 158000 -- (-1657.468) (-1658.349) [-1654.107] (-1658.079) * [-1656.308] (-1657.254) (-1653.910) (-1654.636) -- 0:00:53 158500 -- [-1658.708] (-1654.874) (-1655.187) (-1659.683) * (-1656.538) (-1655.592) (-1655.057) [-1657.103] -- 0:00:53 159000 -- [-1658.989] (-1655.770) (-1655.254) (-1657.903) * (-1656.399) (-1655.391) (-1654.535) [-1655.422] -- 0:00:52 159500 -- (-1661.290) (-1655.833) [-1653.957] (-1657.840) * (-1657.717) [-1655.489] (-1656.625) (-1654.953) -- 0:00:57 160000 -- (-1655.059) [-1654.523] (-1655.085) (-1658.838) * (-1657.080) (-1655.155) (-1657.527) [-1656.123] -- 0:00:57 Average standard deviation of split frequencies: 0.018068 160500 -- (-1655.655) (-1654.672) (-1654.752) [-1659.436] * (-1658.012) [-1654.295] (-1655.539) (-1656.064) -- 0:00:57 161000 -- (-1658.102) [-1654.369] (-1654.934) (-1663.118) * [-1656.045] (-1654.952) (-1660.237) (-1656.880) -- 0:00:57 161500 -- (-1656.605) (-1656.655) [-1653.625] (-1664.233) * (-1655.673) (-1653.994) [-1654.714] (-1657.810) -- 0:00:57 162000 -- (-1657.091) [-1654.364] (-1655.725) (-1656.458) * (-1657.135) (-1655.497) (-1654.518) [-1657.365] -- 0:00:56 162500 -- (-1658.195) (-1654.429) (-1654.587) [-1655.902] * [-1659.500] (-1654.722) (-1655.893) (-1654.739) -- 0:00:56 163000 -- (-1654.169) (-1654.925) (-1655.533) [-1655.411] * (-1659.036) (-1654.611) (-1655.175) [-1655.781] -- 0:00:56 163500 -- (-1654.065) (-1654.841) (-1654.121) [-1654.515] * (-1657.854) (-1653.780) (-1656.757) [-1656.184] -- 0:00:56 164000 -- (-1654.793) (-1656.369) [-1654.966] (-1654.249) * (-1656.888) (-1654.169) (-1655.727) [-1655.796] -- 0:00:56 164500 -- (-1654.141) (-1655.931) (-1655.151) [-1655.930] * (-1656.830) [-1658.379] (-1657.153) (-1653.702) -- 0:00:55 165000 -- (-1656.122) [-1654.754] (-1655.687) (-1655.592) * (-1656.993) [-1655.821] (-1657.006) (-1657.701) -- 0:00:55 Average standard deviation of split frequencies: 0.017813 165500 -- (-1654.303) (-1655.082) (-1655.038) [-1655.173] * (-1656.553) (-1655.659) (-1659.275) [-1653.976] -- 0:00:55 166000 -- [-1656.394] (-1654.718) (-1656.555) (-1655.367) * (-1660.182) (-1655.881) [-1655.252] (-1657.529) -- 0:00:55 166500 -- [-1656.550] (-1654.741) (-1654.396) (-1657.325) * (-1655.310) (-1653.552) [-1655.186] (-1654.270) -- 0:00:55 167000 -- (-1661.090) (-1654.270) (-1658.401) [-1653.554] * (-1655.379) (-1654.039) (-1655.428) [-1654.570] -- 0:00:54 167500 -- (-1656.104) (-1653.958) (-1654.919) [-1653.948] * (-1656.393) (-1654.406) [-1656.191] (-1653.656) -- 0:00:54 168000 -- (-1655.556) [-1657.185] (-1655.174) (-1654.532) * (-1655.922) [-1654.773] (-1655.574) (-1656.288) -- 0:00:54 168500 -- (-1654.478) [-1654.833] (-1655.147) (-1653.779) * (-1653.966) [-1656.647] (-1655.572) (-1654.452) -- 0:00:54 169000 -- (-1654.348) [-1654.614] (-1655.713) (-1661.904) * (-1653.844) (-1660.019) [-1656.596] (-1654.604) -- 0:00:54 169500 -- [-1654.125] (-1654.993) (-1656.374) (-1657.604) * (-1654.844) (-1657.116) (-1658.054) [-1654.969] -- 0:00:53 170000 -- (-1654.721) [-1655.588] (-1655.062) (-1656.590) * (-1654.640) (-1655.036) [-1655.106] (-1654.265) -- 0:00:53 Average standard deviation of split frequencies: 0.018368 170500 -- (-1659.027) (-1654.716) (-1653.785) [-1657.071] * (-1655.062) [-1654.010] (-1653.349) (-1654.281) -- 0:00:53 171000 -- (-1655.706) [-1655.392] (-1657.765) (-1653.727) * [-1654.237] (-1654.020) (-1655.351) (-1655.456) -- 0:00:53 171500 -- [-1657.411] (-1655.331) (-1657.863) (-1654.278) * [-1654.513] (-1654.437) (-1653.722) (-1658.266) -- 0:00:53 172000 -- (-1654.492) [-1658.785] (-1655.072) (-1654.199) * (-1656.100) [-1654.932] (-1657.609) (-1656.587) -- 0:00:52 172500 -- (-1657.362) (-1654.244) [-1656.238] (-1655.818) * (-1655.115) (-1655.158) (-1654.583) [-1653.682] -- 0:00:52 173000 -- (-1661.410) (-1656.034) (-1656.595) [-1660.006] * (-1654.642) (-1654.657) (-1655.518) [-1654.784] -- 0:00:52 173500 -- (-1657.028) (-1656.700) (-1654.976) [-1660.851] * (-1654.766) [-1655.251] (-1656.536) (-1653.939) -- 0:00:52 174000 -- (-1655.159) [-1654.261] (-1656.027) (-1657.122) * [-1653.785] (-1656.583) (-1655.812) (-1653.984) -- 0:00:52 174500 -- (-1655.022) (-1655.273) (-1653.336) [-1655.568] * (-1656.149) (-1663.571) (-1654.709) [-1654.346] -- 0:00:52 175000 -- (-1655.015) (-1658.012) (-1656.385) [-1656.167] * [-1656.140] (-1658.809) (-1656.194) (-1657.122) -- 0:00:56 Average standard deviation of split frequencies: 0.017198 175500 -- (-1655.404) (-1657.799) (-1655.880) [-1656.206] * (-1658.651) (-1657.035) (-1653.508) [-1653.957] -- 0:00:56 176000 -- [-1658.309] (-1656.933) (-1657.814) (-1656.854) * (-1658.056) (-1656.485) (-1653.508) [-1654.583] -- 0:00:56 176500 -- [-1659.030] (-1655.917) (-1654.892) (-1656.106) * (-1656.117) (-1657.806) [-1653.535] (-1653.516) -- 0:00:55 177000 -- [-1657.040] (-1654.260) (-1657.096) (-1656.232) * [-1659.189] (-1661.628) (-1653.566) (-1655.590) -- 0:00:55 177500 -- (-1654.274) (-1653.908) (-1655.590) [-1654.865] * (-1656.376) (-1661.500) (-1655.528) [-1657.350] -- 0:00:55 178000 -- (-1654.792) (-1656.790) (-1657.407) [-1654.668] * (-1655.418) (-1663.279) [-1653.828] (-1659.156) -- 0:00:55 178500 -- (-1654.875) (-1655.630) (-1659.140) [-1654.262] * (-1657.418) (-1658.173) [-1654.148] (-1658.137) -- 0:00:55 179000 -- (-1656.476) (-1655.392) (-1656.988) [-1655.165] * (-1655.368) (-1658.065) [-1653.641] (-1654.665) -- 0:00:55 179500 -- (-1653.995) (-1653.823) (-1658.838) [-1655.326] * [-1658.648] (-1659.455) (-1660.089) (-1656.700) -- 0:00:54 180000 -- (-1655.739) (-1653.966) [-1654.789] (-1654.882) * (-1656.115) [-1655.595] (-1657.151) (-1654.102) -- 0:00:54 Average standard deviation of split frequencies: 0.018410 180500 -- (-1655.846) (-1654.430) [-1657.077] (-1654.208) * (-1657.813) [-1655.779] (-1657.176) (-1655.215) -- 0:00:54 181000 -- (-1655.789) [-1654.983] (-1655.428) (-1657.119) * [-1655.657] (-1655.215) (-1658.566) (-1654.341) -- 0:00:54 181500 -- (-1659.202) (-1658.227) (-1659.552) [-1653.591] * (-1655.938) (-1655.290) [-1658.767] (-1656.020) -- 0:00:54 182000 -- (-1657.167) [-1659.086] (-1654.532) (-1656.082) * (-1656.554) (-1655.306) (-1654.532) [-1655.169] -- 0:00:53 182500 -- (-1653.864) (-1655.567) [-1655.269] (-1656.971) * (-1654.198) (-1656.032) (-1653.869) [-1655.225] -- 0:00:53 183000 -- (-1654.121) [-1654.480] (-1654.704) (-1655.905) * (-1655.733) [-1655.769] (-1654.022) (-1654.089) -- 0:00:53 183500 -- [-1653.549] (-1654.685) (-1656.696) (-1653.770) * [-1655.583] (-1656.215) (-1655.720) (-1655.346) -- 0:00:53 184000 -- [-1656.136] (-1655.755) (-1660.250) (-1653.961) * (-1654.179) (-1656.022) [-1655.547] (-1656.778) -- 0:00:53 184500 -- (-1655.214) (-1654.371) [-1655.980] (-1653.596) * [-1653.850] (-1654.501) (-1656.566) (-1655.667) -- 0:00:53 185000 -- (-1654.441) (-1657.472) [-1654.550] (-1660.005) * (-1654.286) (-1654.592) [-1655.379] (-1658.925) -- 0:00:52 Average standard deviation of split frequencies: 0.017614 185500 -- (-1656.423) [-1657.223] (-1655.135) (-1655.875) * [-1653.560] (-1654.602) (-1654.470) (-1659.031) -- 0:00:52 186000 -- (-1654.173) [-1653.912] (-1655.575) (-1660.374) * (-1653.462) [-1655.620] (-1659.349) (-1655.347) -- 0:00:52 186500 -- (-1656.750) [-1654.678] (-1654.572) (-1658.241) * [-1655.043] (-1654.068) (-1657.880) (-1655.745) -- 0:00:52 187000 -- (-1656.078) [-1654.571] (-1655.554) (-1664.288) * (-1656.252) [-1655.547] (-1658.589) (-1656.735) -- 0:00:52 187500 -- (-1655.895) [-1654.411] (-1655.681) (-1656.093) * (-1658.085) [-1655.607] (-1658.625) (-1656.477) -- 0:00:52 188000 -- (-1654.538) [-1655.530] (-1655.074) (-1656.093) * (-1657.555) (-1655.555) (-1655.294) [-1655.415] -- 0:00:51 188500 -- [-1654.888] (-1654.421) (-1655.072) (-1655.725) * (-1654.180) (-1657.145) [-1654.967] (-1654.562) -- 0:00:51 189000 -- [-1653.623] (-1654.529) (-1655.197) (-1657.327) * (-1654.253) (-1653.938) (-1658.397) [-1657.612] -- 0:00:51 189500 -- (-1654.926) (-1653.873) [-1655.891] (-1657.289) * (-1655.715) (-1654.760) [-1655.056] (-1660.729) -- 0:00:51 190000 -- (-1653.550) (-1655.787) (-1655.515) [-1655.064] * (-1654.595) [-1653.895] (-1654.397) (-1659.788) -- 0:00:51 Average standard deviation of split frequencies: 0.019408 190500 -- (-1656.109) (-1656.324) [-1654.666] (-1655.478) * (-1654.398) (-1654.249) [-1655.167] (-1656.297) -- 0:00:50 191000 -- [-1659.897] (-1658.085) (-1655.527) (-1655.999) * (-1655.672) (-1653.575) (-1656.097) [-1659.237] -- 0:00:55 191500 -- (-1658.430) (-1656.708) [-1657.263] (-1656.812) * (-1657.731) (-1653.551) [-1654.414] (-1657.036) -- 0:00:54 192000 -- (-1657.067) (-1655.479) [-1653.257] (-1655.088) * (-1656.930) (-1653.372) [-1654.618] (-1656.504) -- 0:00:54 192500 -- (-1655.316) (-1655.479) [-1655.614] (-1653.991) * (-1662.518) (-1655.356) (-1655.451) [-1655.338] -- 0:00:54 193000 -- [-1655.305] (-1653.921) (-1654.920) (-1656.522) * (-1660.994) (-1654.757) (-1656.522) [-1655.437] -- 0:00:54 193500 -- (-1660.599) (-1653.899) (-1654.822) [-1654.372] * (-1661.276) (-1657.225) (-1658.926) [-1660.702] -- 0:00:54 194000 -- (-1659.992) [-1655.269] (-1654.962) (-1656.865) * (-1655.875) [-1653.562] (-1655.128) (-1655.260) -- 0:00:54 194500 -- (-1660.365) [-1655.269] (-1654.485) (-1657.343) * (-1656.289) [-1655.376] (-1654.590) (-1655.211) -- 0:00:53 195000 -- [-1657.907] (-1654.807) (-1654.027) (-1654.032) * (-1657.570) (-1657.555) (-1654.622) [-1655.320] -- 0:00:53 Average standard deviation of split frequencies: 0.020887 195500 -- [-1659.767] (-1656.479) (-1654.458) (-1655.256) * (-1654.824) (-1655.038) (-1656.918) [-1654.425] -- 0:00:53 196000 -- (-1659.076) [-1656.487] (-1653.489) (-1654.639) * (-1659.407) (-1654.573) (-1656.265) [-1654.602] -- 0:00:53 196500 -- (-1655.012) (-1658.797) (-1653.947) [-1657.547] * (-1655.428) (-1653.947) (-1653.453) [-1656.769] -- 0:00:53 197000 -- (-1656.169) (-1656.736) [-1655.022] (-1658.022) * (-1658.366) (-1653.651) [-1653.453] (-1656.769) -- 0:00:52 197500 -- [-1657.011] (-1655.997) (-1655.697) (-1654.685) * [-1660.161] (-1656.207) (-1654.577) (-1660.370) -- 0:00:52 198000 -- (-1659.263) (-1663.400) (-1654.919) [-1654.775] * (-1658.681) (-1659.736) (-1654.501) [-1654.021] -- 0:00:52 198500 -- (-1657.357) (-1660.892) (-1654.352) [-1653.857] * [-1656.583] (-1659.983) (-1655.180) (-1654.556) -- 0:00:52 199000 -- [-1654.006] (-1659.882) (-1654.737) (-1653.973) * [-1656.731] (-1656.546) (-1654.005) (-1655.974) -- 0:00:52 199500 -- (-1656.111) (-1655.153) (-1655.042) [-1654.884] * (-1654.872) [-1655.684] (-1653.775) (-1656.581) -- 0:00:52 200000 -- [-1656.314] (-1653.792) (-1654.454) (-1655.767) * (-1653.932) (-1658.163) (-1656.008) [-1656.721] -- 0:00:51 Average standard deviation of split frequencies: 0.019707 200500 -- [-1655.828] (-1653.774) (-1654.990) (-1659.352) * (-1653.811) (-1656.100) [-1658.030] (-1655.971) -- 0:00:51 201000 -- (-1657.180) (-1653.747) (-1656.652) [-1657.074] * (-1656.687) [-1653.885] (-1653.896) (-1655.973) -- 0:00:51 201500 -- (-1654.432) [-1658.807] (-1656.441) (-1657.305) * (-1655.870) (-1653.940) [-1654.642] (-1654.797) -- 0:00:51 202000 -- (-1653.531) [-1655.222] (-1654.391) (-1659.079) * (-1655.028) [-1656.665] (-1654.427) (-1658.509) -- 0:00:51 202500 -- (-1653.461) (-1657.039) (-1654.363) [-1655.737] * [-1654.307] (-1656.139) (-1654.622) (-1654.382) -- 0:00:51 203000 -- (-1653.443) (-1654.961) (-1655.025) [-1657.929] * (-1657.484) [-1654.639] (-1654.554) (-1657.322) -- 0:00:51 203500 -- (-1655.401) (-1654.097) [-1654.860] (-1655.635) * (-1653.885) (-1655.873) [-1653.692] (-1655.101) -- 0:00:50 204000 -- (-1655.425) [-1654.038] (-1654.560) (-1657.307) * (-1655.347) [-1654.840] (-1654.967) (-1653.815) -- 0:00:50 204500 -- [-1655.358] (-1653.768) (-1655.475) (-1657.353) * [-1654.208] (-1654.631) (-1654.985) (-1654.411) -- 0:00:50 205000 -- [-1655.598] (-1657.554) (-1655.323) (-1656.908) * (-1654.149) (-1654.698) [-1655.004] (-1655.259) -- 0:00:50 Average standard deviation of split frequencies: 0.019752 205500 -- (-1656.787) [-1657.891] (-1655.683) (-1655.047) * (-1655.145) (-1654.937) [-1653.979] (-1657.390) -- 0:00:50 206000 -- [-1657.103] (-1657.414) (-1655.901) (-1655.275) * [-1655.299] (-1656.029) (-1653.999) (-1655.560) -- 0:00:50 206500 -- (-1655.707) [-1659.447] (-1655.158) (-1655.404) * (-1655.709) [-1658.096] (-1654.706) (-1655.160) -- 0:00:53 207000 -- (-1657.021) (-1660.402) [-1655.903] (-1655.398) * (-1659.157) (-1656.042) (-1653.957) [-1657.206] -- 0:00:53 207500 -- (-1655.220) (-1654.194) [-1655.806] (-1653.595) * (-1655.934) (-1658.172) [-1655.022] (-1657.172) -- 0:00:53 208000 -- (-1654.363) (-1653.990) [-1655.430] (-1655.771) * (-1657.151) (-1654.639) (-1654.984) [-1655.121] -- 0:00:53 208500 -- (-1654.786) [-1653.279] (-1655.416) (-1655.984) * (-1656.582) [-1655.033] (-1659.667) (-1656.730) -- 0:00:53 209000 -- (-1653.850) (-1653.623) [-1656.696] (-1654.632) * (-1656.938) [-1654.657] (-1657.377) (-1661.445) -- 0:00:52 209500 -- [-1653.575] (-1655.856) (-1659.913) (-1656.845) * (-1657.301) (-1656.861) [-1657.442] (-1655.309) -- 0:00:52 210000 -- (-1657.061) (-1655.923) (-1659.339) [-1656.704] * (-1656.581) (-1656.104) (-1655.840) [-1654.895] -- 0:00:52 Average standard deviation of split frequencies: 0.021317 210500 -- (-1654.422) [-1654.078] (-1656.669) (-1655.086) * [-1653.874] (-1655.643) (-1658.355) (-1656.326) -- 0:00:52 211000 -- (-1654.946) (-1655.068) (-1655.551) [-1653.786] * [-1653.928] (-1655.749) (-1661.132) (-1653.769) -- 0:00:52 211500 -- (-1654.716) (-1655.979) [-1660.222] (-1655.618) * [-1656.651] (-1657.673) (-1657.971) (-1654.900) -- 0:00:52 212000 -- (-1654.440) [-1655.578] (-1657.015) (-1658.157) * (-1655.330) [-1654.868] (-1660.399) (-1655.291) -- 0:00:52 212500 -- [-1657.989] (-1660.849) (-1656.012) (-1658.324) * [-1656.931] (-1655.057) (-1660.045) (-1654.805) -- 0:00:51 213000 -- (-1657.634) (-1660.511) [-1657.074] (-1656.594) * (-1659.193) (-1662.335) [-1658.645] (-1655.504) -- 0:00:51 213500 -- (-1659.066) [-1654.550] (-1657.253) (-1656.623) * [-1656.601] (-1658.909) (-1657.295) (-1654.176) -- 0:00:51 214000 -- (-1655.871) (-1653.639) [-1655.383] (-1653.742) * [-1655.003] (-1654.712) (-1656.243) (-1658.265) -- 0:00:51 214500 -- [-1655.642] (-1654.753) (-1655.392) (-1654.697) * [-1656.251] (-1654.612) (-1659.411) (-1657.356) -- 0:00:51 215000 -- (-1655.280) (-1657.615) (-1655.619) [-1659.772] * (-1654.876) (-1654.061) (-1657.408) [-1656.337] -- 0:00:51 Average standard deviation of split frequencies: 0.021939 215500 -- [-1654.871] (-1657.473) (-1655.366) (-1657.130) * [-1655.584] (-1654.570) (-1658.791) (-1656.096) -- 0:00:50 216000 -- (-1655.909) (-1657.388) (-1655.507) [-1655.346] * [-1655.265] (-1653.970) (-1660.251) (-1660.736) -- 0:00:50 216500 -- (-1656.688) [-1657.838] (-1655.365) (-1654.664) * [-1655.891] (-1654.956) (-1660.070) (-1655.791) -- 0:00:50 217000 -- (-1656.131) [-1657.099] (-1656.808) (-1656.947) * [-1660.383] (-1654.933) (-1657.842) (-1656.440) -- 0:00:50 217500 -- (-1655.988) (-1656.665) [-1658.419] (-1655.593) * [-1656.122] (-1654.205) (-1659.275) (-1657.579) -- 0:00:50 218000 -- [-1656.236] (-1655.937) (-1655.851) (-1657.489) * (-1655.229) [-1655.046] (-1657.317) (-1659.969) -- 0:00:50 218500 -- [-1659.174] (-1656.052) (-1655.016) (-1655.359) * (-1659.838) (-1655.128) [-1655.449] (-1654.892) -- 0:00:50 219000 -- (-1658.512) (-1656.654) (-1654.804) [-1656.844] * (-1658.391) [-1656.934] (-1657.648) (-1654.791) -- 0:00:49 219500 -- (-1654.973) [-1656.640] (-1657.116) (-1656.141) * (-1656.323) (-1654.825) [-1656.135] (-1654.187) -- 0:00:49 220000 -- (-1654.144) (-1657.259) [-1654.187] (-1655.485) * (-1656.791) (-1654.472) [-1657.239] (-1653.731) -- 0:00:49 Average standard deviation of split frequencies: 0.022150 220500 -- [-1655.998] (-1656.045) (-1656.850) (-1655.160) * (-1658.867) (-1654.559) (-1657.509) [-1655.260] -- 0:00:49 221000 -- (-1655.242) (-1655.627) (-1654.483) [-1656.004] * (-1658.472) [-1658.084] (-1660.083) (-1654.516) -- 0:00:49 221500 -- (-1655.303) [-1657.194] (-1655.243) (-1654.453) * (-1655.716) [-1656.103] (-1656.441) (-1656.342) -- 0:00:49 222000 -- [-1655.002] (-1654.303) (-1653.504) (-1655.031) * [-1654.437] (-1660.646) (-1655.687) (-1654.510) -- 0:00:49 222500 -- [-1658.718] (-1653.854) (-1654.288) (-1655.196) * [-1654.592] (-1657.747) (-1655.587) (-1654.521) -- 0:00:52 223000 -- (-1657.447) (-1654.938) (-1654.191) [-1654.675] * (-1656.204) [-1654.791] (-1658.844) (-1654.090) -- 0:00:52 223500 -- (-1656.942) (-1653.909) [-1656.728] (-1653.866) * (-1657.083) (-1654.397) (-1658.107) [-1654.221] -- 0:00:52 224000 -- (-1655.445) (-1653.813) (-1654.217) [-1655.277] * [-1656.851] (-1656.894) (-1660.056) (-1656.190) -- 0:00:51 224500 -- (-1655.797) (-1656.009) [-1657.399] (-1657.638) * (-1659.158) [-1655.833] (-1666.793) (-1656.115) -- 0:00:51 225000 -- (-1656.749) (-1656.488) (-1659.690) [-1656.043] * (-1654.393) (-1657.301) (-1662.002) [-1657.490] -- 0:00:51 Average standard deviation of split frequencies: 0.023384 225500 -- [-1656.857] (-1656.322) (-1656.977) (-1654.192) * (-1658.975) (-1656.761) [-1654.978] (-1658.127) -- 0:00:51 226000 -- (-1656.318) (-1654.547) (-1654.499) [-1654.865] * (-1656.099) (-1655.067) [-1653.652] (-1656.673) -- 0:00:51 226500 -- (-1658.624) (-1654.677) (-1653.866) [-1657.072] * (-1658.314) (-1657.365) (-1654.110) [-1655.079] -- 0:00:51 227000 -- [-1658.255] (-1655.476) (-1653.863) (-1658.126) * (-1657.371) [-1657.274] (-1654.115) (-1654.837) -- 0:00:51 227500 -- (-1654.072) (-1659.134) [-1654.151] (-1658.340) * (-1655.395) (-1655.733) (-1654.016) [-1655.873] -- 0:00:50 228000 -- (-1654.239) (-1653.793) (-1663.654) [-1658.584] * (-1659.913) (-1654.315) [-1656.100] (-1655.441) -- 0:00:50 228500 -- (-1653.762) (-1657.627) (-1656.129) [-1655.495] * (-1657.815) (-1656.736) [-1656.673] (-1655.759) -- 0:00:50 229000 -- [-1653.627] (-1656.623) (-1654.009) (-1657.564) * (-1658.617) (-1660.942) [-1658.668] (-1657.063) -- 0:00:50 229500 -- (-1657.454) [-1653.264] (-1654.965) (-1655.701) * (-1659.768) (-1655.394) (-1660.675) [-1656.738] -- 0:00:50 230000 -- (-1655.328) [-1655.044] (-1653.730) (-1653.835) * [-1655.734] (-1655.145) (-1655.705) (-1659.795) -- 0:00:50 Average standard deviation of split frequencies: 0.022158 230500 -- (-1654.389) (-1654.388) [-1655.078] (-1654.392) * (-1655.781) [-1654.194] (-1658.898) (-1663.447) -- 0:00:50 231000 -- (-1654.905) (-1654.936) [-1655.469] (-1654.287) * (-1656.921) (-1654.329) [-1657.984] (-1661.339) -- 0:00:49 231500 -- (-1655.438) (-1657.149) (-1653.850) [-1654.059] * (-1654.945) (-1655.177) (-1659.190) [-1655.974] -- 0:00:49 232000 -- (-1657.356) (-1655.698) (-1653.850) [-1654.093] * [-1653.607] (-1656.862) (-1657.056) (-1655.761) -- 0:00:49 232500 -- (-1655.747) (-1655.826) [-1656.032] (-1655.631) * [-1654.162] (-1656.333) (-1655.735) (-1661.186) -- 0:00:49 233000 -- [-1653.818] (-1662.958) (-1656.632) (-1655.595) * (-1654.697) (-1656.269) (-1655.872) [-1655.685] -- 0:00:49 233500 -- (-1653.418) (-1657.399) (-1655.819) [-1656.886] * (-1658.060) [-1655.229] (-1659.392) (-1655.188) -- 0:00:49 234000 -- (-1655.699) (-1656.990) (-1654.775) [-1655.973] * (-1658.112) (-1655.620) [-1662.269] (-1657.582) -- 0:00:49 234500 -- [-1660.541] (-1653.350) (-1654.718) (-1658.135) * (-1656.775) (-1655.655) (-1659.483) [-1655.826] -- 0:00:48 235000 -- (-1657.939) (-1655.193) [-1656.669] (-1657.669) * (-1655.461) (-1654.587) (-1653.938) [-1655.028] -- 0:00:48 Average standard deviation of split frequencies: 0.022077 235500 -- (-1654.460) [-1656.157] (-1655.995) (-1659.031) * [-1654.538] (-1654.724) (-1655.425) (-1656.266) -- 0:00:48 236000 -- (-1655.312) (-1653.347) (-1654.008) [-1656.312] * (-1655.092) (-1655.877) [-1653.724] (-1653.966) -- 0:00:48 236500 -- (-1654.358) (-1654.159) (-1655.151) [-1654.557] * [-1653.488] (-1656.473) (-1654.221) (-1653.816) -- 0:00:48 237000 -- (-1655.501) (-1657.134) (-1655.159) [-1655.555] * (-1653.729) [-1657.161] (-1654.159) (-1658.679) -- 0:00:48 237500 -- (-1654.708) (-1655.976) (-1654.796) [-1657.320] * (-1654.597) (-1657.178) (-1654.135) [-1653.939] -- 0:00:48 238000 -- (-1653.973) (-1655.768) (-1654.531) [-1653.996] * (-1654.391) (-1664.458) (-1654.209) [-1654.484] -- 0:00:51 238500 -- [-1654.199] (-1656.294) (-1654.299) (-1655.506) * [-1656.361] (-1659.465) (-1661.130) (-1656.381) -- 0:00:51 239000 -- (-1654.835) (-1657.599) (-1655.443) [-1655.419] * (-1655.001) [-1656.407] (-1660.517) (-1654.628) -- 0:00:50 239500 -- [-1655.006] (-1661.693) (-1655.568) (-1655.186) * (-1655.836) (-1653.869) (-1658.007) [-1653.743] -- 0:00:50 240000 -- [-1656.554] (-1655.541) (-1655.585) (-1654.915) * (-1654.461) (-1656.229) (-1658.720) [-1656.457] -- 0:00:50 Average standard deviation of split frequencies: 0.023711 240500 -- [-1655.647] (-1654.394) (-1654.831) (-1654.266) * [-1653.745] (-1655.807) (-1659.790) (-1657.519) -- 0:00:50 241000 -- [-1653.475] (-1659.558) (-1656.329) (-1656.501) * (-1653.756) [-1655.474] (-1657.765) (-1655.923) -- 0:00:50 241500 -- [-1653.574] (-1660.105) (-1658.125) (-1655.247) * (-1653.676) (-1656.256) [-1656.112] (-1655.793) -- 0:00:50 242000 -- (-1654.552) [-1655.144] (-1658.328) (-1656.550) * (-1657.232) [-1653.673] (-1654.713) (-1656.625) -- 0:00:50 242500 -- (-1655.782) (-1656.044) [-1655.597] (-1654.386) * [-1657.899] (-1656.599) (-1655.598) (-1657.857) -- 0:00:49 243000 -- (-1654.496) (-1655.431) (-1659.462) [-1654.375] * (-1657.701) (-1654.555) (-1657.428) [-1655.034] -- 0:00:49 243500 -- [-1655.433] (-1657.380) (-1658.245) (-1657.757) * (-1654.834) [-1655.728] (-1658.257) (-1654.147) -- 0:00:49 244000 -- (-1660.043) [-1655.957] (-1657.852) (-1659.058) * (-1658.347) [-1654.757] (-1657.244) (-1654.423) -- 0:00:49 244500 -- (-1656.185) (-1654.392) [-1657.534] (-1658.722) * (-1663.312) [-1655.519] (-1654.550) (-1659.233) -- 0:00:49 245000 -- (-1654.343) (-1655.993) (-1656.910) [-1656.188] * (-1656.804) [-1656.106] (-1657.256) (-1659.879) -- 0:00:49 Average standard deviation of split frequencies: 0.022083 245500 -- (-1654.485) (-1655.111) (-1657.797) [-1653.979] * [-1659.660] (-1657.051) (-1656.462) (-1656.157) -- 0:00:49 246000 -- (-1656.378) (-1654.284) [-1657.734] (-1654.215) * (-1660.340) (-1654.603) [-1655.354] (-1654.108) -- 0:00:49 246500 -- (-1655.741) (-1657.078) [-1659.577] (-1654.465) * (-1659.214) (-1654.147) [-1654.939] (-1654.425) -- 0:00:48 247000 -- (-1656.274) [-1655.625] (-1655.613) (-1653.931) * (-1654.770) (-1654.527) [-1656.247] (-1655.759) -- 0:00:48 247500 -- (-1659.245) [-1655.973] (-1661.548) (-1654.344) * (-1655.166) [-1655.835] (-1655.157) (-1656.019) -- 0:00:48 248000 -- [-1658.836] (-1654.950) (-1658.166) (-1656.864) * (-1657.912) (-1656.529) [-1654.735] (-1655.768) -- 0:00:48 248500 -- (-1656.332) (-1655.777) (-1657.587) [-1655.275] * [-1654.768] (-1653.352) (-1655.908) (-1655.142) -- 0:00:48 249000 -- (-1656.492) [-1654.022] (-1655.466) (-1667.069) * (-1653.654) (-1655.240) [-1656.033] (-1658.362) -- 0:00:48 249500 -- (-1654.236) [-1653.685] (-1656.618) (-1662.454) * (-1656.276) (-1655.296) (-1659.360) [-1654.693] -- 0:00:48 250000 -- (-1654.083) (-1657.656) (-1657.731) [-1654.382] * [-1654.431] (-1657.372) (-1659.519) (-1656.905) -- 0:00:48 Average standard deviation of split frequencies: 0.023062 250500 -- (-1654.585) (-1655.377) [-1655.426] (-1654.382) * [-1655.984] (-1655.268) (-1657.470) (-1656.774) -- 0:00:47 251000 -- (-1658.378) [-1654.323] (-1654.739) (-1655.535) * (-1657.104) (-1655.800) [-1654.691] (-1654.294) -- 0:00:47 251500 -- (-1659.489) [-1653.674] (-1656.213) (-1655.307) * [-1655.979] (-1655.939) (-1654.439) (-1653.488) -- 0:00:47 252000 -- (-1659.979) (-1656.685) [-1656.774] (-1657.063) * (-1656.226) (-1654.189) [-1653.377] (-1659.074) -- 0:00:47 252500 -- [-1658.860] (-1656.204) (-1657.801) (-1654.311) * (-1658.361) [-1654.162] (-1655.556) (-1654.208) -- 0:00:47 253000 -- (-1659.977) [-1655.891] (-1657.145) (-1653.708) * (-1656.837) [-1654.274] (-1656.713) (-1655.106) -- 0:00:47 253500 -- [-1654.106] (-1655.802) (-1656.164) (-1654.205) * (-1654.905) [-1653.444] (-1658.338) (-1655.738) -- 0:00:47 254000 -- (-1655.334) (-1654.195) (-1658.284) [-1658.163] * (-1654.592) [-1656.886] (-1653.703) (-1654.318) -- 0:00:49 254500 -- (-1655.741) (-1657.163) (-1656.647) [-1653.615] * (-1655.664) (-1656.169) [-1656.139] (-1654.302) -- 0:00:49 255000 -- (-1656.180) (-1657.252) (-1661.612) [-1653.797] * (-1654.587) (-1656.480) [-1654.562] (-1655.628) -- 0:00:49 Average standard deviation of split frequencies: 0.022609 255500 -- (-1656.304) [-1656.125] (-1660.662) (-1653.653) * (-1655.346) (-1656.945) (-1654.275) [-1662.355] -- 0:00:49 256000 -- (-1656.030) [-1657.106] (-1653.895) (-1654.258) * (-1654.366) (-1657.165) (-1655.280) [-1657.039] -- 0:00:49 256500 -- [-1656.412] (-1656.525) (-1655.694) (-1653.935) * [-1654.711] (-1655.312) (-1657.816) (-1655.410) -- 0:00:49 257000 -- (-1655.718) (-1661.629) (-1656.466) [-1653.555] * (-1653.361) [-1655.257] (-1662.740) (-1654.989) -- 0:00:49 257500 -- [-1656.572] (-1661.805) (-1662.526) (-1660.979) * (-1653.797) (-1654.916) (-1655.714) [-1654.880] -- 0:00:49 258000 -- (-1656.167) [-1658.291] (-1659.874) (-1655.532) * (-1654.890) (-1655.954) [-1653.748] (-1654.927) -- 0:00:48 258500 -- (-1657.044) [-1656.511] (-1660.491) (-1657.445) * (-1654.891) (-1658.336) (-1654.265) [-1655.073] -- 0:00:48 259000 -- [-1661.292] (-1657.055) (-1657.866) (-1655.310) * (-1655.144) [-1656.123] (-1655.913) (-1654.796) -- 0:00:48 259500 -- (-1657.737) (-1656.069) (-1655.827) [-1655.853] * [-1656.465] (-1654.668) (-1655.891) (-1654.142) -- 0:00:48 260000 -- [-1657.979] (-1657.226) (-1656.801) (-1654.957) * (-1655.231) (-1654.656) [-1654.527] (-1654.336) -- 0:00:48 Average standard deviation of split frequencies: 0.020750 260500 -- (-1654.453) (-1660.714) (-1659.519) [-1655.077] * (-1655.080) [-1654.785] (-1654.927) (-1654.147) -- 0:00:48 261000 -- (-1655.517) [-1656.814] (-1660.564) (-1655.011) * (-1653.919) (-1656.955) (-1655.275) [-1655.161] -- 0:00:48 261500 -- (-1653.403) (-1654.600) (-1656.181) [-1655.593] * (-1656.080) [-1655.976] (-1654.990) (-1656.799) -- 0:00:48 262000 -- (-1662.221) (-1654.947) (-1658.235) [-1654.582] * (-1658.171) (-1654.904) [-1654.816] (-1653.632) -- 0:00:47 262500 -- [-1657.873] (-1655.601) (-1657.862) (-1653.925) * (-1656.154) (-1654.529) [-1653.888] (-1655.974) -- 0:00:47 263000 -- [-1656.626] (-1656.529) (-1655.515) (-1659.709) * (-1655.162) [-1655.238] (-1656.027) (-1654.569) -- 0:00:47 263500 -- [-1655.133] (-1657.571) (-1654.001) (-1656.423) * [-1654.786] (-1655.266) (-1662.643) (-1653.907) -- 0:00:47 264000 -- (-1655.398) (-1659.249) (-1654.722) [-1655.636] * (-1658.673) [-1653.648] (-1661.842) (-1655.899) -- 0:00:47 264500 -- (-1654.379) (-1662.516) [-1657.412] (-1655.573) * (-1655.999) [-1653.832] (-1656.820) (-1653.961) -- 0:00:47 265000 -- (-1656.567) [-1658.689] (-1655.863) (-1656.721) * [-1653.619] (-1654.147) (-1656.652) (-1656.158) -- 0:00:47 Average standard deviation of split frequencies: 0.019849 265500 -- (-1657.976) (-1653.899) [-1653.646] (-1655.044) * (-1653.484) (-1657.104) (-1653.880) [-1654.546] -- 0:00:47 266000 -- (-1659.183) (-1653.611) (-1653.617) [-1655.436] * (-1658.887) (-1655.444) (-1656.885) [-1655.344] -- 0:00:46 266500 -- (-1658.903) (-1657.670) (-1658.636) [-1656.889] * (-1662.829) (-1654.745) (-1656.794) [-1654.045] -- 0:00:46 267000 -- (-1657.680) (-1659.794) [-1654.218] (-1656.544) * (-1657.208) [-1653.442] (-1656.893) (-1654.037) -- 0:00:46 267500 -- [-1654.452] (-1653.690) (-1654.824) (-1657.115) * (-1655.887) [-1654.044] (-1654.155) (-1654.017) -- 0:00:46 268000 -- (-1655.609) (-1654.658) (-1655.031) [-1656.889] * (-1657.369) [-1655.459] (-1655.300) (-1653.718) -- 0:00:46 268500 -- (-1657.423) [-1654.590] (-1654.122) (-1655.145) * (-1655.433) [-1654.187] (-1654.327) (-1655.724) -- 0:00:46 269000 -- (-1658.968) (-1655.970) (-1655.316) [-1656.947] * (-1656.012) [-1655.373] (-1656.100) (-1654.719) -- 0:00:48 269500 -- (-1655.089) [-1653.863] (-1654.808) (-1656.019) * (-1654.150) (-1655.798) [-1661.677] (-1655.007) -- 0:00:48 270000 -- [-1653.866] (-1653.975) (-1655.733) (-1654.457) * (-1655.830) (-1655.594) [-1657.155] (-1655.854) -- 0:00:48 Average standard deviation of split frequencies: 0.020258 270500 -- (-1657.398) [-1654.385] (-1658.959) (-1656.249) * [-1653.287] (-1655.535) (-1656.317) (-1656.647) -- 0:00:48 271000 -- (-1656.463) (-1653.480) [-1654.014] (-1658.548) * (-1653.356) [-1657.259] (-1656.403) (-1656.965) -- 0:00:48 271500 -- (-1654.432) (-1653.964) (-1653.547) [-1656.388] * (-1654.276) (-1654.222) [-1655.952] (-1658.015) -- 0:00:48 272000 -- (-1655.072) (-1655.295) [-1658.167] (-1657.822) * (-1655.513) (-1655.930) [-1654.106] (-1657.837) -- 0:00:48 272500 -- (-1659.885) [-1653.965] (-1653.874) (-1657.919) * (-1656.277) (-1654.473) [-1654.192] (-1655.987) -- 0:00:48 273000 -- (-1658.443) (-1653.868) (-1655.883) [-1656.412] * (-1656.524) (-1654.864) [-1655.964] (-1657.737) -- 0:00:47 273500 -- (-1657.693) [-1655.203] (-1657.718) (-1654.300) * (-1661.471) [-1655.334] (-1655.417) (-1655.719) -- 0:00:47 274000 -- [-1654.828] (-1657.216) (-1655.500) (-1653.702) * (-1655.120) (-1657.935) (-1658.113) [-1655.816] -- 0:00:47 274500 -- (-1654.216) [-1660.593] (-1660.911) (-1658.381) * (-1655.568) [-1654.574] (-1656.322) (-1656.582) -- 0:00:47 275000 -- (-1655.131) (-1655.008) [-1654.575] (-1656.970) * [-1654.910] (-1660.580) (-1656.565) (-1656.833) -- 0:00:47 Average standard deviation of split frequencies: 0.018338 275500 -- (-1656.968) (-1654.566) [-1655.232] (-1654.241) * (-1656.962) [-1658.801] (-1656.934) (-1656.490) -- 0:00:47 276000 -- [-1655.886] (-1654.267) (-1655.805) (-1654.613) * (-1655.157) (-1664.643) (-1657.664) [-1653.426] -- 0:00:47 276500 -- [-1654.400] (-1653.941) (-1654.240) (-1654.943) * (-1654.941) (-1656.640) [-1658.034] (-1653.636) -- 0:00:47 277000 -- (-1655.957) (-1654.809) [-1655.678] (-1653.564) * (-1654.287) (-1654.328) [-1654.893] (-1655.283) -- 0:00:46 277500 -- (-1655.736) (-1653.688) (-1654.239) [-1654.110] * (-1654.340) (-1655.213) [-1656.462] (-1655.405) -- 0:00:46 278000 -- (-1655.731) (-1653.512) (-1656.271) [-1658.632] * (-1655.224) (-1654.324) (-1658.763) [-1653.962] -- 0:00:46 278500 -- (-1654.738) (-1654.399) [-1653.902] (-1656.180) * (-1654.660) (-1653.875) [-1657.975] (-1660.736) -- 0:00:46 279000 -- (-1654.500) (-1654.339) [-1654.132] (-1655.521) * (-1658.674) [-1655.236] (-1662.845) (-1663.442) -- 0:00:46 279500 -- (-1654.486) [-1654.339] (-1654.728) (-1657.311) * (-1658.811) (-1653.528) (-1655.770) [-1654.279] -- 0:00:46 280000 -- (-1655.555) (-1656.402) [-1654.262] (-1658.120) * (-1655.998) (-1653.528) [-1655.724] (-1654.518) -- 0:00:46 Average standard deviation of split frequencies: 0.016973 280500 -- (-1654.473) (-1658.750) (-1655.677) [-1655.125] * [-1655.236] (-1653.535) (-1656.060) (-1654.705) -- 0:00:46 281000 -- (-1655.079) (-1656.306) [-1657.114] (-1655.781) * (-1654.130) (-1654.659) (-1656.744) [-1653.894] -- 0:00:46 281500 -- (-1657.898) [-1656.065] (-1657.041) (-1656.491) * (-1655.711) (-1656.054) (-1656.623) [-1655.570] -- 0:00:45 282000 -- (-1654.842) [-1656.189] (-1656.459) (-1655.564) * [-1653.919] (-1655.947) (-1661.082) (-1656.173) -- 0:00:45 282500 -- (-1658.320) (-1655.199) (-1656.395) [-1655.233] * (-1654.083) (-1655.665) (-1657.831) [-1657.189] -- 0:00:45 283000 -- [-1653.893] (-1656.938) (-1655.453) (-1655.323) * (-1654.277) (-1655.608) [-1656.707] (-1659.111) -- 0:00:45 283500 -- (-1657.884) (-1654.769) (-1655.722) [-1657.901] * [-1655.153] (-1653.798) (-1655.542) (-1655.206) -- 0:00:45 284000 -- (-1654.119) (-1655.602) (-1655.581) [-1655.228] * [-1658.923] (-1653.354) (-1654.126) (-1656.605) -- 0:00:45 284500 -- (-1654.315) (-1655.244) [-1655.555] (-1662.232) * [-1656.387] (-1656.047) (-1654.776) (-1655.869) -- 0:00:47 285000 -- [-1655.262] (-1654.522) (-1656.347) (-1655.334) * (-1653.671) (-1654.661) (-1654.611) [-1654.879] -- 0:00:47 Average standard deviation of split frequencies: 0.014748 285500 -- (-1656.928) (-1654.330) (-1655.580) [-1654.923] * (-1657.172) (-1657.954) (-1655.565) [-1658.082] -- 0:00:47 286000 -- [-1655.914] (-1654.283) (-1656.006) (-1655.541) * (-1659.709) [-1656.826] (-1655.810) (-1655.019) -- 0:00:47 286500 -- [-1655.507] (-1654.340) (-1655.174) (-1656.764) * (-1657.833) (-1659.053) [-1656.209] (-1655.689) -- 0:00:47 287000 -- (-1654.312) (-1653.721) (-1655.442) [-1655.409] * (-1655.534) (-1654.635) (-1654.531) [-1658.024] -- 0:00:47 287500 -- (-1656.313) [-1654.921] (-1656.146) (-1654.488) * (-1657.867) (-1653.547) [-1655.894] (-1659.012) -- 0:00:47 288000 -- [-1657.422] (-1655.347) (-1656.786) (-1655.341) * (-1657.761) (-1653.470) (-1654.610) [-1655.874] -- 0:00:46 288500 -- [-1654.033] (-1655.827) (-1655.604) (-1654.542) * [-1653.960] (-1653.444) (-1654.898) (-1655.965) -- 0:00:46 289000 -- [-1656.240] (-1655.821) (-1655.235) (-1656.176) * (-1655.289) (-1654.543) [-1655.911] (-1655.968) -- 0:00:46 289500 -- (-1658.298) [-1655.821] (-1655.841) (-1654.200) * (-1655.483) (-1658.188) [-1654.665] (-1654.672) -- 0:00:46 290000 -- (-1658.180) (-1655.821) [-1656.903] (-1654.771) * (-1654.062) (-1657.217) [-1654.823] (-1655.289) -- 0:00:46 Average standard deviation of split frequencies: 0.015587 290500 -- [-1653.963] (-1656.855) (-1658.312) (-1657.997) * (-1654.419) (-1654.428) (-1658.797) [-1655.386] -- 0:00:46 291000 -- [-1653.870] (-1654.200) (-1655.820) (-1655.841) * (-1654.619) (-1655.011) [-1655.566] (-1655.816) -- 0:00:46 291500 -- (-1653.850) (-1657.056) (-1654.642) [-1655.421] * (-1655.257) (-1654.220) [-1660.570] (-1655.839) -- 0:00:46 292000 -- (-1657.124) [-1657.070] (-1653.958) (-1654.772) * (-1656.186) [-1654.458] (-1654.589) (-1654.809) -- 0:00:46 292500 -- (-1658.465) [-1655.976] (-1655.628) (-1654.412) * [-1655.389] (-1655.248) (-1654.589) (-1657.259) -- 0:00:45 293000 -- [-1655.164] (-1656.032) (-1655.786) (-1654.265) * [-1653.845] (-1657.554) (-1658.441) (-1658.061) -- 0:00:45 293500 -- [-1656.589] (-1655.828) (-1656.538) (-1654.237) * (-1656.970) (-1656.945) [-1655.394] (-1655.305) -- 0:00:45 294000 -- (-1656.063) (-1656.765) (-1660.137) [-1655.222] * (-1661.344) (-1655.065) (-1657.090) [-1654.640] -- 0:00:45 294500 -- (-1654.255) (-1655.354) [-1656.489] (-1654.497) * [-1655.309] (-1659.640) (-1657.405) (-1659.406) -- 0:00:45 295000 -- (-1656.804) (-1655.098) [-1653.974] (-1653.273) * (-1654.745) (-1658.555) (-1656.279) [-1654.837] -- 0:00:45 Average standard deviation of split frequencies: 0.015826 295500 -- (-1655.274) (-1655.097) (-1655.270) [-1654.509] * [-1655.959] (-1657.422) (-1658.143) (-1654.462) -- 0:00:45 296000 -- (-1656.105) (-1654.689) [-1655.931] (-1654.573) * (-1657.914) [-1657.029] (-1656.050) (-1654.701) -- 0:00:45 296500 -- (-1658.537) [-1656.863] (-1659.159) (-1654.496) * (-1655.710) [-1653.727] (-1656.012) (-1654.826) -- 0:00:45 297000 -- (-1656.118) (-1655.691) (-1665.468) [-1655.933] * (-1656.745) [-1653.801] (-1654.154) (-1657.613) -- 0:00:44 297500 -- (-1657.689) (-1655.151) [-1659.139] (-1655.408) * (-1656.972) (-1653.906) (-1655.243) [-1656.593] -- 0:00:44 298000 -- (-1656.815) (-1658.725) (-1659.161) [-1655.736] * (-1659.178) [-1653.873] (-1658.821) (-1654.696) -- 0:00:44 298500 -- (-1655.404) [-1657.500] (-1654.664) (-1660.150) * (-1654.253) (-1654.028) (-1656.178) [-1654.920] -- 0:00:44 299000 -- (-1657.034) (-1657.568) [-1658.685] (-1654.716) * (-1656.514) [-1654.655] (-1654.489) (-1656.749) -- 0:00:44 299500 -- (-1653.917) (-1657.568) (-1658.241) [-1654.294] * (-1656.818) [-1654.316] (-1654.471) (-1656.193) -- 0:00:44 300000 -- (-1653.917) (-1655.483) (-1660.743) [-1654.920] * (-1657.187) [-1654.365] (-1655.648) (-1658.428) -- 0:00:44 Average standard deviation of split frequencies: 0.015875 300500 -- (-1654.753) (-1655.226) [-1657.379] (-1656.500) * (-1656.247) [-1654.684] (-1654.640) (-1656.221) -- 0:00:46 301000 -- (-1654.189) [-1656.729] (-1656.683) (-1658.108) * [-1656.092] (-1655.466) (-1656.577) (-1655.384) -- 0:00:46 301500 -- [-1655.135] (-1656.489) (-1657.845) (-1658.209) * [-1654.642] (-1655.759) (-1656.537) (-1657.093) -- 0:00:46 302000 -- [-1656.347] (-1656.065) (-1655.946) (-1655.987) * [-1654.726] (-1656.377) (-1658.933) (-1655.082) -- 0:00:46 302500 -- (-1654.745) (-1654.271) [-1654.383] (-1654.022) * [-1656.813] (-1654.410) (-1658.073) (-1655.702) -- 0:00:46 303000 -- (-1659.026) (-1655.281) (-1656.132) [-1653.919] * (-1655.338) (-1653.760) (-1655.874) [-1659.007] -- 0:00:46 303500 -- (-1655.983) [-1657.520] (-1654.862) (-1654.797) * (-1654.941) (-1654.425) [-1657.204] (-1655.181) -- 0:00:45 304000 -- (-1656.337) [-1656.819] (-1654.823) (-1654.987) * (-1657.104) [-1654.328] (-1655.279) (-1660.008) -- 0:00:45 304500 -- (-1656.153) (-1657.937) [-1654.568] (-1659.690) * (-1658.626) (-1655.648) [-1655.077] (-1656.469) -- 0:00:45 305000 -- (-1657.989) [-1661.235] (-1657.157) (-1661.357) * (-1657.666) (-1655.641) (-1655.933) [-1654.101] -- 0:00:45 Average standard deviation of split frequencies: 0.016221 305500 -- [-1654.756] (-1654.776) (-1654.245) (-1656.542) * (-1655.626) (-1659.188) [-1655.204] (-1658.239) -- 0:00:45 306000 -- (-1659.254) [-1654.115] (-1654.243) (-1658.258) * [-1654.558] (-1655.608) (-1654.471) (-1655.162) -- 0:00:45 306500 -- (-1655.235) (-1655.484) [-1653.673] (-1656.405) * (-1656.292) [-1656.091] (-1655.487) (-1653.922) -- 0:00:45 307000 -- (-1654.916) (-1655.283) [-1654.429] (-1656.983) * (-1658.030) [-1655.235] (-1654.453) (-1653.484) -- 0:00:45 307500 -- [-1653.909] (-1654.624) (-1653.818) (-1656.557) * (-1657.318) [-1655.585] (-1655.358) (-1654.176) -- 0:00:45 308000 -- (-1654.260) (-1654.433) (-1656.083) [-1658.896] * (-1658.181) (-1656.968) (-1656.693) [-1654.081] -- 0:00:44 308500 -- [-1654.140] (-1654.631) (-1654.060) (-1654.072) * (-1656.001) (-1654.284) (-1656.956) [-1654.761] -- 0:00:44 309000 -- (-1654.554) [-1655.625] (-1655.233) (-1654.054) * [-1656.026] (-1653.916) (-1656.210) (-1655.684) -- 0:00:44 309500 -- (-1654.332) (-1655.325) (-1658.389) [-1654.520] * [-1654.649] (-1656.149) (-1654.119) (-1654.368) -- 0:00:44 310000 -- (-1655.125) [-1655.216] (-1655.346) (-1655.804) * (-1653.579) (-1656.824) [-1654.236] (-1654.123) -- 0:00:44 Average standard deviation of split frequencies: 0.015090 310500 -- (-1655.256) [-1654.371] (-1655.677) (-1653.906) * (-1654.714) (-1654.745) (-1655.891) [-1655.194] -- 0:00:44 311000 -- (-1655.320) (-1654.140) (-1655.139) [-1655.209] * (-1657.309) (-1654.652) [-1656.746] (-1654.622) -- 0:00:44 311500 -- [-1657.131] (-1654.570) (-1653.714) (-1656.131) * [-1654.621] (-1656.392) (-1654.885) (-1659.084) -- 0:00:44 312000 -- (-1656.325) (-1655.101) (-1655.107) [-1660.863] * (-1655.112) (-1656.476) (-1654.890) [-1658.848] -- 0:00:44 312500 -- [-1654.271] (-1654.882) (-1655.602) (-1656.559) * [-1654.983] (-1655.833) (-1654.459) (-1659.145) -- 0:00:44 313000 -- (-1655.309) (-1653.447) [-1658.677] (-1656.568) * [-1654.527] (-1653.699) (-1655.635) (-1658.544) -- 0:00:43 313500 -- (-1655.215) [-1654.741] (-1654.410) (-1656.391) * (-1656.203) (-1653.368) [-1656.467] (-1655.567) -- 0:00:43 314000 -- (-1654.797) [-1653.440] (-1656.968) (-1657.202) * (-1655.138) (-1653.368) [-1658.018] (-1655.819) -- 0:00:43 314500 -- [-1654.066] (-1655.900) (-1657.489) (-1657.358) * (-1654.835) [-1655.625] (-1655.285) (-1657.926) -- 0:00:43 315000 -- [-1654.228] (-1655.802) (-1656.512) (-1660.877) * (-1656.235) (-1654.483) (-1655.275) [-1654.851] -- 0:00:43 Average standard deviation of split frequencies: 0.014830 315500 -- (-1655.699) (-1654.431) (-1656.606) [-1654.794] * [-1654.734] (-1653.508) (-1653.881) (-1654.241) -- 0:00:45 316000 -- (-1657.299) (-1653.761) (-1655.667) [-1656.366] * (-1656.466) [-1653.548] (-1654.218) (-1654.531) -- 0:00:45 316500 -- (-1657.725) [-1657.072] (-1658.940) (-1659.945) * (-1656.547) (-1655.169) (-1653.976) [-1656.089] -- 0:00:45 317000 -- [-1654.784] (-1657.365) (-1656.209) (-1655.358) * (-1653.685) (-1657.061) [-1654.492] (-1654.169) -- 0:00:45 317500 -- [-1660.388] (-1653.979) (-1657.805) (-1659.663) * (-1653.814) (-1655.449) (-1657.352) [-1654.152] -- 0:00:45 318000 -- (-1653.790) [-1654.719] (-1659.401) (-1656.805) * (-1654.323) (-1656.414) (-1656.764) [-1653.892] -- 0:00:45 318500 -- (-1656.244) [-1655.847] (-1655.185) (-1654.958) * (-1656.839) [-1656.521] (-1657.142) (-1656.044) -- 0:00:44 319000 -- (-1655.832) (-1656.530) (-1653.817) [-1655.419] * [-1660.069] (-1655.032) (-1655.117) (-1655.755) -- 0:00:44 319500 -- (-1656.086) (-1656.126) (-1655.620) [-1654.255] * (-1655.555) [-1656.119] (-1654.597) (-1656.800) -- 0:00:44 320000 -- (-1655.642) (-1656.020) (-1659.340) [-1656.862] * (-1656.522) (-1655.659) [-1656.760] (-1657.485) -- 0:00:44 Average standard deviation of split frequencies: 0.015306 320500 -- [-1653.780] (-1655.802) (-1659.612) (-1656.988) * [-1655.785] (-1653.800) (-1657.943) (-1662.557) -- 0:00:44 321000 -- (-1653.543) (-1657.265) (-1655.930) [-1655.392] * (-1656.138) [-1654.348] (-1661.933) (-1658.206) -- 0:00:44 321500 -- (-1653.420) [-1657.476] (-1654.457) (-1654.178) * [-1657.692] (-1656.098) (-1655.053) (-1656.253) -- 0:00:44 322000 -- (-1654.187) (-1656.531) (-1654.046) [-1654.165] * (-1655.048) (-1654.462) (-1654.900) [-1655.542] -- 0:00:44 322500 -- (-1655.764) (-1654.700) (-1654.596) [-1655.470] * [-1655.152] (-1654.390) (-1656.470) (-1654.301) -- 0:00:44 323000 -- [-1653.454] (-1654.559) (-1655.212) (-1655.328) * [-1653.503] (-1654.462) (-1655.057) (-1654.610) -- 0:00:44 323500 -- (-1655.227) (-1654.866) [-1654.700] (-1659.080) * (-1654.478) (-1654.351) [-1656.260] (-1653.449) -- 0:00:43 324000 -- (-1655.692) [-1655.705] (-1655.911) (-1660.854) * (-1654.208) (-1654.701) (-1656.063) [-1653.942] -- 0:00:43 324500 -- [-1655.656] (-1656.251) (-1656.662) (-1657.784) * (-1654.197) (-1654.473) [-1657.625] (-1654.582) -- 0:00:43 325000 -- (-1658.126) (-1655.102) [-1654.814] (-1657.486) * [-1653.987] (-1660.189) (-1658.877) (-1655.247) -- 0:00:43 Average standard deviation of split frequencies: 0.014942 325500 -- [-1656.407] (-1653.995) (-1657.987) (-1654.238) * [-1654.013] (-1656.444) (-1655.916) (-1657.613) -- 0:00:43 326000 -- (-1653.860) [-1653.686] (-1658.828) (-1655.119) * [-1654.289] (-1656.850) (-1654.714) (-1660.448) -- 0:00:43 326500 -- [-1655.470] (-1655.756) (-1655.274) (-1656.166) * (-1655.788) [-1654.345] (-1659.871) (-1660.457) -- 0:00:43 327000 -- [-1655.772] (-1654.074) (-1658.980) (-1657.791) * (-1655.543) [-1655.544] (-1659.579) (-1658.972) -- 0:00:43 327500 -- (-1656.089) (-1653.497) (-1656.800) [-1655.348] * [-1656.121] (-1654.636) (-1654.790) (-1657.593) -- 0:00:43 328000 -- [-1659.922] (-1657.166) (-1655.391) (-1655.873) * (-1656.113) (-1654.484) [-1653.987] (-1660.908) -- 0:00:43 328500 -- (-1655.724) (-1656.532) [-1654.566] (-1653.771) * (-1654.918) [-1653.836] (-1655.772) (-1661.542) -- 0:00:42 329000 -- [-1658.304] (-1657.385) (-1654.995) (-1654.086) * (-1659.374) (-1654.717) (-1655.784) [-1658.457] -- 0:00:42 329500 -- [-1654.612] (-1656.430) (-1659.035) (-1657.203) * (-1657.996) (-1653.930) [-1656.413] (-1655.463) -- 0:00:42 330000 -- [-1655.125] (-1656.799) (-1655.860) (-1655.517) * (-1656.030) (-1653.930) (-1660.149) [-1654.292] -- 0:00:42 Average standard deviation of split frequencies: 0.014508 330500 -- (-1654.950) (-1654.871) [-1655.307] (-1662.569) * (-1655.247) (-1655.212) [-1656.768] (-1656.634) -- 0:00:42 331000 -- (-1655.264) (-1654.040) [-1654.319] (-1656.133) * (-1655.828) (-1654.561) (-1655.731) [-1654.326] -- 0:00:42 331500 -- [-1657.159] (-1654.595) (-1653.613) (-1653.974) * (-1655.783) (-1656.423) [-1655.944] (-1654.660) -- 0:00:44 332000 -- (-1653.560) (-1654.335) [-1654.733] (-1653.952) * (-1658.589) (-1656.613) (-1655.570) [-1654.747] -- 0:00:44 332500 -- (-1655.160) (-1655.137) (-1655.401) [-1653.315] * [-1655.673] (-1655.477) (-1655.201) (-1659.844) -- 0:00:44 333000 -- (-1655.342) [-1655.470] (-1656.446) (-1653.316) * (-1655.712) [-1655.896] (-1655.094) (-1657.698) -- 0:00:44 333500 -- [-1654.757] (-1656.104) (-1655.418) (-1653.312) * (-1654.709) [-1656.985] (-1654.332) (-1654.497) -- 0:00:43 334000 -- [-1654.802] (-1659.477) (-1654.846) (-1653.591) * (-1657.371) (-1657.982) [-1655.618] (-1658.537) -- 0:00:43 334500 -- (-1654.952) (-1654.916) (-1658.588) [-1654.634] * (-1657.472) (-1662.418) [-1653.986] (-1656.971) -- 0:00:43 335000 -- (-1654.952) (-1655.880) [-1657.924] (-1654.524) * (-1657.161) (-1655.079) [-1654.208] (-1657.927) -- 0:00:43 Average standard deviation of split frequencies: 0.014731 335500 -- [-1655.397] (-1654.650) (-1656.347) (-1656.778) * (-1654.442) (-1655.755) (-1654.290) [-1654.670] -- 0:00:43 336000 -- [-1654.664] (-1655.614) (-1659.936) (-1658.796) * (-1654.573) (-1656.869) [-1655.371] (-1655.927) -- 0:00:43 336500 -- [-1653.873] (-1653.256) (-1658.471) (-1655.270) * [-1654.374] (-1655.417) (-1657.000) (-1657.665) -- 0:00:43 337000 -- (-1654.701) [-1653.251] (-1653.791) (-1658.036) * (-1655.293) (-1656.157) [-1656.253] (-1656.055) -- 0:00:43 337500 -- (-1653.987) (-1654.171) [-1654.508] (-1654.326) * (-1657.530) [-1654.805] (-1656.248) (-1657.430) -- 0:00:43 338000 -- (-1654.837) (-1654.743) [-1654.448] (-1655.955) * (-1659.077) (-1656.242) [-1654.615] (-1657.392) -- 0:00:43 338500 -- [-1656.168] (-1656.239) (-1654.225) (-1654.401) * (-1656.941) (-1654.378) (-1656.758) [-1656.118] -- 0:00:42 339000 -- (-1656.129) [-1657.223] (-1654.035) (-1653.863) * (-1655.437) (-1656.651) (-1655.109) [-1654.911] -- 0:00:42 339500 -- (-1654.640) (-1656.901) (-1655.543) [-1655.810] * (-1655.351) (-1655.411) (-1657.421) [-1654.051] -- 0:00:42 340000 -- (-1654.557) (-1660.783) [-1654.139] (-1654.656) * (-1654.333) (-1657.414) [-1657.006] (-1653.899) -- 0:00:42 Average standard deviation of split frequencies: 0.012886 340500 -- (-1657.672) (-1656.243) [-1654.303] (-1655.031) * (-1653.990) (-1657.471) (-1654.597) [-1654.912] -- 0:00:42 341000 -- (-1655.481) [-1655.054] (-1653.986) (-1655.162) * (-1654.177) [-1655.021] (-1655.019) (-1655.505) -- 0:00:42 341500 -- (-1660.742) (-1655.629) (-1656.620) [-1655.423] * (-1658.989) (-1655.064) [-1655.090] (-1654.727) -- 0:00:42 342000 -- (-1657.992) [-1655.004] (-1657.755) (-1653.309) * (-1656.014) (-1658.408) [-1655.090] (-1655.450) -- 0:00:42 342500 -- (-1659.282) [-1653.759] (-1657.593) (-1653.315) * (-1654.711) (-1655.463) [-1655.523] (-1662.322) -- 0:00:42 343000 -- (-1659.733) (-1655.530) (-1658.895) [-1657.859] * (-1653.433) (-1654.228) [-1660.575] (-1661.125) -- 0:00:42 343500 -- (-1653.958) [-1654.629] (-1656.701) (-1655.870) * [-1653.469] (-1654.140) (-1656.907) (-1657.508) -- 0:00:42 344000 -- (-1654.941) (-1657.890) (-1658.573) [-1654.178] * (-1653.508) (-1656.851) [-1657.404] (-1654.031) -- 0:00:41 344500 -- (-1653.445) (-1658.626) (-1658.150) [-1653.843] * [-1657.257] (-1656.665) (-1654.867) (-1653.903) -- 0:00:41 345000 -- (-1655.208) [-1656.169] (-1657.914) (-1653.963) * (-1659.063) [-1655.559] (-1656.741) (-1654.708) -- 0:00:41 Average standard deviation of split frequencies: 0.013028 345500 -- (-1655.326) (-1656.002) [-1658.907] (-1653.857) * (-1657.329) (-1657.921) [-1656.265] (-1656.684) -- 0:00:41 346000 -- [-1654.033] (-1655.466) (-1657.042) (-1653.900) * (-1656.094) (-1655.583) [-1654.389] (-1658.348) -- 0:00:41 346500 -- (-1654.890) [-1655.412] (-1653.181) (-1653.900) * [-1656.094] (-1654.814) (-1654.719) (-1658.948) -- 0:00:41 347000 -- (-1656.290) (-1653.526) [-1653.828] (-1656.950) * (-1654.740) (-1654.901) [-1656.231] (-1658.311) -- 0:00:43 347500 -- (-1660.577) (-1653.526) [-1655.457] (-1664.311) * (-1656.903) [-1656.570] (-1655.131) (-1661.102) -- 0:00:43 348000 -- (-1654.583) [-1654.052] (-1656.871) (-1661.380) * [-1655.249] (-1657.939) (-1657.058) (-1656.243) -- 0:00:43 348500 -- [-1654.794] (-1654.343) (-1656.049) (-1655.182) * (-1654.360) [-1656.529] (-1655.456) (-1654.280) -- 0:00:42 349000 -- (-1655.052) (-1653.998) (-1658.445) [-1655.050] * [-1654.390] (-1657.462) (-1654.226) (-1657.934) -- 0:00:42 349500 -- (-1653.843) (-1653.750) [-1654.859] (-1654.025) * (-1657.106) (-1657.935) (-1654.503) [-1656.235] -- 0:00:42 350000 -- [-1655.751] (-1657.827) (-1655.986) (-1654.802) * (-1655.927) (-1654.063) [-1655.893] (-1657.967) -- 0:00:42 Average standard deviation of split frequencies: 0.012267 350500 -- (-1655.976) (-1655.283) [-1653.930] (-1656.513) * [-1656.315] (-1655.204) (-1653.601) (-1655.169) -- 0:00:42 351000 -- (-1658.446) (-1656.203) (-1656.093) [-1655.877] * (-1656.317) (-1658.872) (-1654.407) [-1655.110] -- 0:00:42 351500 -- (-1656.025) [-1655.707] (-1656.597) (-1654.205) * (-1658.807) (-1658.421) (-1655.045) [-1653.437] -- 0:00:42 352000 -- (-1658.553) [-1655.725] (-1656.953) (-1655.050) * (-1656.860) [-1659.134] (-1659.295) (-1655.785) -- 0:00:42 352500 -- [-1654.657] (-1655.292) (-1656.828) (-1657.466) * (-1657.449) (-1658.163) (-1660.893) [-1654.026] -- 0:00:42 353000 -- (-1655.192) (-1657.212) (-1657.279) [-1654.951] * [-1654.137] (-1658.453) (-1660.727) (-1653.340) -- 0:00:42 353500 -- (-1656.222) (-1656.422) (-1656.456) [-1654.646] * (-1655.670) [-1658.126] (-1656.782) (-1653.372) -- 0:00:42 354000 -- [-1654.866] (-1655.002) (-1659.180) (-1657.345) * [-1653.349] (-1656.773) (-1653.414) (-1654.100) -- 0:00:41 354500 -- (-1661.358) (-1655.369) (-1656.090) [-1657.846] * (-1655.476) (-1655.758) [-1655.363] (-1657.600) -- 0:00:41 355000 -- (-1656.671) [-1658.622] (-1654.696) (-1657.848) * (-1655.476) (-1657.272) (-1654.001) [-1656.308] -- 0:00:41 Average standard deviation of split frequencies: 0.012580 355500 -- (-1656.158) (-1654.510) (-1659.394) [-1655.807] * (-1655.430) (-1655.135) [-1654.127] (-1654.224) -- 0:00:41 356000 -- (-1655.928) (-1654.358) (-1653.686) [-1654.743] * [-1655.577] (-1658.337) (-1654.610) (-1653.825) -- 0:00:41 356500 -- (-1655.568) (-1655.917) [-1653.683] (-1653.522) * (-1655.577) (-1658.755) [-1656.326] (-1655.429) -- 0:00:41 357000 -- [-1654.685] (-1658.054) (-1653.940) (-1654.392) * [-1656.574] (-1665.774) (-1658.087) (-1658.110) -- 0:00:41 357500 -- [-1659.151] (-1659.314) (-1653.857) (-1654.444) * [-1654.815] (-1659.971) (-1653.833) (-1665.039) -- 0:00:41 358000 -- [-1654.472] (-1653.865) (-1654.850) (-1654.279) * (-1656.238) (-1655.679) [-1654.047] (-1663.201) -- 0:00:41 358500 -- (-1655.718) (-1655.642) [-1654.505] (-1654.317) * [-1655.320] (-1653.586) (-1653.828) (-1655.474) -- 0:00:41 359000 -- (-1656.457) [-1655.563] (-1654.882) (-1656.358) * (-1656.059) (-1655.304) [-1653.703] (-1654.446) -- 0:00:41 359500 -- (-1655.380) (-1654.860) [-1653.526] (-1655.576) * [-1655.158] (-1656.796) (-1655.501) (-1655.838) -- 0:00:40 360000 -- [-1658.716] (-1657.642) (-1653.544) (-1654.202) * [-1655.315] (-1656.794) (-1654.833) (-1655.429) -- 0:00:40 Average standard deviation of split frequencies: 0.012580 360500 -- (-1658.361) (-1661.733) (-1655.231) [-1655.874] * (-1654.640) (-1657.632) (-1655.209) [-1655.007] -- 0:00:40 361000 -- (-1654.685) (-1658.759) (-1655.320) [-1655.331] * (-1654.591) (-1661.317) (-1654.907) [-1654.874] -- 0:00:40 361500 -- [-1656.740] (-1656.360) (-1656.424) (-1655.889) * (-1655.517) [-1657.757] (-1655.549) (-1655.275) -- 0:00:40 362000 -- [-1656.536] (-1655.444) (-1655.930) (-1655.030) * (-1656.100) (-1654.247) (-1656.031) [-1655.296] -- 0:00:40 362500 -- (-1656.630) (-1653.930) [-1656.515] (-1655.046) * (-1657.671) (-1654.169) [-1654.316] (-1654.402) -- 0:00:40 363000 -- [-1660.423] (-1653.667) (-1656.588) (-1654.145) * (-1655.734) [-1654.683] (-1654.373) (-1656.969) -- 0:00:42 363500 -- [-1654.983] (-1655.120) (-1656.117) (-1654.139) * (-1655.505) (-1655.994) [-1654.339] (-1655.908) -- 0:00:42 364000 -- (-1659.001) (-1653.722) (-1654.249) [-1657.918] * (-1655.963) (-1658.881) [-1654.830] (-1655.159) -- 0:00:41 364500 -- (-1656.784) [-1653.695] (-1656.337) (-1659.287) * (-1657.013) (-1656.668) (-1655.738) [-1656.907] -- 0:00:41 365000 -- (-1656.142) (-1655.164) [-1654.912] (-1657.778) * (-1659.150) (-1656.110) (-1655.258) [-1654.124] -- 0:00:41 Average standard deviation of split frequencies: 0.012653 365500 -- (-1655.772) (-1656.689) (-1655.123) [-1656.765] * (-1662.895) (-1656.148) [-1654.517] (-1653.296) -- 0:00:41 366000 -- (-1654.596) (-1659.049) [-1655.194] (-1654.275) * (-1658.222) (-1654.655) [-1656.197] (-1653.344) -- 0:00:41 366500 -- (-1654.534) (-1655.571) (-1658.976) [-1655.375] * (-1656.559) (-1657.091) [-1655.712] (-1656.515) -- 0:00:41 367000 -- (-1659.152) (-1654.153) [-1658.753] (-1654.430) * (-1655.501) [-1656.951] (-1655.084) (-1658.389) -- 0:00:41 367500 -- [-1657.730] (-1653.411) (-1657.151) (-1654.924) * (-1656.052) (-1657.419) (-1654.495) [-1655.235] -- 0:00:41 368000 -- (-1654.822) (-1654.032) (-1656.850) [-1655.598] * (-1655.314) [-1655.914] (-1655.605) (-1655.262) -- 0:00:41 368500 -- [-1654.826] (-1654.031) (-1655.854) (-1655.246) * (-1656.726) (-1656.356) [-1654.288] (-1654.868) -- 0:00:41 369000 -- (-1656.036) (-1654.608) (-1656.777) [-1654.628] * [-1655.548] (-1657.449) (-1654.257) (-1657.678) -- 0:00:41 369500 -- (-1654.373) [-1656.278] (-1656.145) (-1656.482) * (-1655.657) (-1655.319) (-1654.101) [-1655.758] -- 0:00:40 370000 -- [-1655.866] (-1654.629) (-1656.431) (-1655.885) * (-1655.840) [-1654.089] (-1654.878) (-1655.755) -- 0:00:40 Average standard deviation of split frequencies: 0.013274 370500 -- [-1656.343] (-1654.973) (-1657.344) (-1657.709) * (-1656.569) (-1657.880) [-1657.619] (-1655.402) -- 0:00:40 371000 -- (-1655.491) (-1655.882) (-1655.319) [-1655.928] * (-1656.353) (-1654.904) [-1655.534] (-1658.183) -- 0:00:40 371500 -- (-1653.796) (-1654.678) [-1653.240] (-1656.304) * (-1653.661) (-1653.373) (-1656.731) [-1654.326] -- 0:00:40 372000 -- (-1654.501) (-1657.959) (-1654.267) [-1653.678] * (-1653.658) (-1655.337) (-1655.368) [-1655.567] -- 0:00:40 372500 -- (-1657.663) (-1655.754) [-1654.509] (-1655.628) * (-1653.971) (-1655.038) (-1655.453) [-1656.979] -- 0:00:40 373000 -- (-1655.158) [-1654.599] (-1657.456) (-1653.418) * (-1654.384) (-1657.263) (-1655.110) [-1654.488] -- 0:00:40 373500 -- (-1655.430) [-1654.301] (-1655.239) (-1654.907) * [-1655.092] (-1654.717) (-1655.839) (-1655.014) -- 0:00:40 374000 -- (-1654.801) [-1653.666] (-1654.343) (-1657.303) * (-1655.821) (-1655.053) (-1654.030) [-1653.525] -- 0:00:40 374500 -- (-1656.796) (-1659.267) (-1655.033) [-1654.255] * (-1657.530) (-1664.591) [-1654.673] (-1654.182) -- 0:00:40 375000 -- (-1654.254) (-1657.477) [-1656.100] (-1659.129) * [-1654.667] (-1659.906) (-1656.482) (-1653.327) -- 0:00:40 Average standard deviation of split frequencies: 0.013869 375500 -- [-1653.681] (-1653.636) (-1654.864) (-1659.066) * (-1659.482) (-1657.565) [-1655.294] (-1658.286) -- 0:00:39 376000 -- (-1656.208) [-1655.289] (-1660.169) (-1656.473) * (-1656.427) (-1656.109) [-1658.146] (-1658.634) -- 0:00:39 376500 -- (-1655.959) (-1658.392) (-1656.743) [-1656.049] * (-1654.977) (-1655.019) [-1654.534] (-1658.359) -- 0:00:39 377000 -- [-1655.063] (-1658.543) (-1656.107) (-1656.420) * (-1655.410) (-1655.879) (-1658.198) [-1655.556] -- 0:00:39 377500 -- (-1653.785) (-1659.536) (-1661.342) [-1656.758] * (-1657.216) (-1655.866) (-1658.700) [-1655.546] -- 0:00:39 378000 -- (-1654.804) (-1655.350) (-1657.156) [-1653.807] * (-1657.134) [-1655.466] (-1657.370) (-1656.367) -- 0:00:39 378500 -- (-1659.483) (-1656.262) (-1661.064) [-1655.330] * (-1654.974) (-1654.831) [-1656.270] (-1657.937) -- 0:00:41 379000 -- (-1655.069) (-1655.938) (-1656.686) [-1656.814] * [-1654.449] (-1654.107) (-1656.605) (-1655.009) -- 0:00:40 379500 -- (-1654.585) (-1655.439) (-1659.373) [-1655.587] * (-1656.341) (-1653.987) (-1656.262) [-1655.266] -- 0:00:40 380000 -- (-1654.820) (-1655.385) [-1657.708] (-1656.004) * (-1654.605) (-1657.817) (-1656.607) [-1653.781] -- 0:00:40 Average standard deviation of split frequencies: 0.013457 380500 -- [-1654.309] (-1655.587) (-1654.467) (-1653.973) * [-1653.728] (-1657.792) (-1655.593) (-1653.567) -- 0:00:40 381000 -- (-1657.539) (-1656.647) (-1654.930) [-1654.692] * (-1654.887) (-1660.130) (-1653.930) [-1654.443] -- 0:00:40 381500 -- [-1655.203] (-1656.197) (-1655.655) (-1653.802) * (-1653.670) (-1659.414) (-1653.872) [-1654.548] -- 0:00:40 382000 -- (-1663.185) [-1658.543] (-1655.460) (-1654.267) * (-1655.032) (-1655.257) [-1653.451] (-1656.023) -- 0:00:40 382500 -- [-1659.173] (-1655.804) (-1655.390) (-1656.343) * (-1654.478) (-1655.181) [-1654.572] (-1656.027) -- 0:00:40 383000 -- (-1657.945) [-1654.759] (-1655.650) (-1658.437) * [-1654.168] (-1655.017) (-1656.325) (-1654.580) -- 0:00:40 383500 -- (-1656.959) (-1655.440) [-1654.675] (-1655.934) * (-1654.897) (-1656.225) (-1654.745) [-1654.780] -- 0:00:40 384000 -- (-1656.216) [-1655.557] (-1654.678) (-1658.162) * (-1654.847) [-1653.968] (-1654.936) (-1653.666) -- 0:00:40 384500 -- (-1655.195) [-1654.022] (-1654.297) (-1655.149) * (-1654.121) [-1660.405] (-1654.936) (-1656.917) -- 0:00:40 385000 -- (-1659.147) [-1654.412] (-1657.132) (-1654.724) * (-1657.790) (-1656.666) [-1654.936] (-1658.322) -- 0:00:39 Average standard deviation of split frequencies: 0.012864 385500 -- (-1655.307) (-1655.050) (-1659.464) [-1655.254] * [-1655.795] (-1655.424) (-1656.520) (-1654.501) -- 0:00:39 386000 -- (-1655.589) (-1654.497) (-1654.810) [-1657.697] * [-1653.635] (-1653.505) (-1657.394) (-1655.297) -- 0:00:39 386500 -- (-1656.257) [-1656.802] (-1655.279) (-1657.772) * [-1653.687] (-1654.912) (-1659.778) (-1654.631) -- 0:00:39 387000 -- (-1655.934) (-1656.576) [-1653.624] (-1653.927) * [-1654.499] (-1657.236) (-1654.421) (-1654.187) -- 0:00:39 387500 -- (-1657.423) [-1655.175] (-1657.559) (-1654.783) * [-1655.472] (-1656.641) (-1654.983) (-1654.718) -- 0:00:39 388000 -- [-1656.159] (-1656.193) (-1655.130) (-1654.630) * (-1656.355) [-1656.300] (-1656.477) (-1655.333) -- 0:00:39 388500 -- (-1656.382) (-1654.729) [-1657.297] (-1653.803) * (-1656.673) [-1657.824] (-1655.055) (-1655.286) -- 0:00:39 389000 -- (-1655.870) [-1654.866] (-1657.565) (-1656.226) * (-1655.348) [-1655.909] (-1653.994) (-1654.040) -- 0:00:39 389500 -- (-1656.343) [-1655.307] (-1656.913) (-1656.919) * (-1657.033) (-1657.974) [-1653.702] (-1653.966) -- 0:00:39 390000 -- (-1654.939) (-1656.249) (-1656.003) [-1654.517] * (-1655.417) (-1654.154) [-1653.747] (-1655.752) -- 0:00:39 Average standard deviation of split frequencies: 0.012710 390500 -- (-1654.682) (-1655.267) (-1656.645) [-1655.373] * (-1653.979) (-1655.963) [-1656.746] (-1655.837) -- 0:00:39 391000 -- (-1655.687) (-1658.801) [-1657.951] (-1656.345) * (-1653.624) (-1656.904) [-1656.228] (-1654.627) -- 0:00:38 391500 -- (-1654.182) (-1653.640) [-1655.679] (-1657.497) * (-1655.668) (-1655.463) [-1657.541] (-1656.126) -- 0:00:38 392000 -- (-1657.289) (-1653.923) (-1654.772) [-1658.552] * (-1655.175) [-1656.488] (-1656.342) (-1656.006) -- 0:00:38 392500 -- (-1655.635) [-1655.693] (-1654.695) (-1658.747) * (-1657.225) (-1655.092) [-1658.478] (-1653.743) -- 0:00:38 393000 -- (-1654.514) (-1655.020) [-1654.605] (-1656.968) * (-1656.668) [-1654.375] (-1654.459) (-1659.095) -- 0:00:38 393500 -- [-1653.747] (-1655.487) (-1653.805) (-1655.911) * (-1655.971) (-1654.229) (-1653.545) [-1657.134] -- 0:00:38 394000 -- (-1659.239) [-1654.488] (-1653.539) (-1654.506) * (-1654.456) (-1656.302) [-1653.648] (-1654.636) -- 0:00:38 394500 -- (-1658.476) [-1654.718] (-1653.554) (-1656.482) * (-1653.582) (-1657.201) (-1655.597) [-1655.765] -- 0:00:39 395000 -- (-1655.136) (-1655.640) [-1654.786] (-1657.516) * [-1654.931] (-1657.964) (-1656.578) (-1655.498) -- 0:00:39 Average standard deviation of split frequencies: 0.012142 395500 -- (-1658.704) [-1659.135] (-1655.218) (-1656.090) * (-1655.616) (-1653.564) [-1654.077] (-1654.848) -- 0:00:39 396000 -- (-1654.781) (-1657.037) (-1656.445) [-1655.802] * (-1653.550) (-1655.094) [-1654.590] (-1655.691) -- 0:00:39 396500 -- (-1656.367) [-1656.417] (-1653.588) (-1655.277) * (-1657.662) (-1653.548) (-1658.317) [-1655.707] -- 0:00:39 397000 -- (-1655.378) [-1657.687] (-1653.754) (-1659.853) * (-1656.220) (-1656.763) (-1654.543) [-1657.799] -- 0:00:39 397500 -- (-1653.536) (-1657.685) (-1655.194) [-1658.044] * (-1655.549) (-1657.687) (-1655.845) [-1656.897] -- 0:00:39 398000 -- (-1655.966) (-1657.699) (-1658.074) [-1655.656] * [-1657.369] (-1657.148) (-1658.092) (-1654.805) -- 0:00:39 398500 -- (-1656.968) (-1656.442) (-1658.200) [-1659.748] * (-1655.650) (-1657.559) (-1657.470) [-1655.326] -- 0:00:39 399000 -- (-1656.935) (-1660.304) (-1657.619) [-1656.733] * [-1655.789] (-1655.746) (-1657.220) (-1656.857) -- 0:00:39 399500 -- [-1654.022] (-1655.107) (-1655.587) (-1657.156) * (-1655.068) [-1655.765] (-1656.898) (-1658.375) -- 0:00:39 400000 -- (-1656.289) (-1654.933) [-1653.703] (-1653.714) * [-1654.990] (-1658.047) (-1658.902) (-1657.870) -- 0:00:39 Average standard deviation of split frequencies: 0.013020 400500 -- (-1654.632) (-1657.013) [-1654.002] (-1653.759) * (-1655.531) (-1654.217) [-1655.063] (-1656.992) -- 0:00:38 401000 -- (-1656.390) [-1655.907] (-1656.877) (-1655.842) * [-1653.999] (-1655.463) (-1659.061) (-1656.433) -- 0:00:38 401500 -- (-1658.288) (-1656.178) (-1657.496) [-1654.819] * (-1654.591) (-1655.321) [-1655.919] (-1656.785) -- 0:00:38 402000 -- (-1658.164) (-1656.702) [-1660.329] (-1654.816) * (-1655.293) [-1655.122] (-1654.237) (-1656.117) -- 0:00:38 402500 -- (-1661.535) (-1656.592) (-1655.806) [-1655.441] * (-1655.086) (-1654.456) (-1655.672) [-1655.198] -- 0:00:38 403000 -- (-1658.598) (-1656.315) [-1653.556] (-1658.657) * [-1655.628] (-1655.658) (-1654.058) (-1654.344) -- 0:00:38 403500 -- (-1659.610) (-1656.315) (-1655.418) [-1656.361] * [-1656.587] (-1654.545) (-1653.977) (-1660.711) -- 0:00:38 404000 -- [-1654.106] (-1658.874) (-1655.118) (-1654.804) * [-1656.456] (-1660.697) (-1654.413) (-1656.144) -- 0:00:38 404500 -- (-1657.039) (-1654.216) (-1656.047) [-1654.115] * (-1655.756) (-1660.113) [-1656.677] (-1655.513) -- 0:00:38 405000 -- (-1656.424) (-1654.562) [-1655.771] (-1657.558) * (-1655.578) (-1655.052) (-1656.765) [-1654.919] -- 0:00:38 Average standard deviation of split frequencies: 0.013236 405500 -- (-1654.241) (-1654.180) [-1656.127] (-1654.186) * (-1657.940) (-1655.156) [-1656.763] (-1654.681) -- 0:00:38 406000 -- (-1654.544) [-1656.288] (-1658.540) (-1654.092) * (-1655.154) [-1655.640] (-1656.186) (-1656.186) -- 0:00:38 406500 -- (-1655.808) (-1656.844) (-1658.083) [-1656.825] * (-1655.383) [-1655.003] (-1656.354) (-1658.307) -- 0:00:37 407000 -- (-1655.605) [-1654.575] (-1658.655) (-1654.233) * (-1654.085) (-1654.674) [-1655.906] (-1654.348) -- 0:00:37 407500 -- (-1656.730) (-1657.626) [-1656.514] (-1655.805) * [-1656.426] (-1656.771) (-1653.947) (-1654.319) -- 0:00:37 408000 -- (-1655.596) (-1655.158) [-1655.749] (-1655.001) * [-1656.904] (-1654.990) (-1655.415) (-1658.397) -- 0:00:37 408500 -- [-1655.239] (-1654.380) (-1654.269) (-1654.059) * [-1657.102] (-1655.078) (-1656.343) (-1659.173) -- 0:00:37 409000 -- [-1654.073] (-1655.138) (-1654.835) (-1654.010) * (-1658.145) (-1656.307) [-1656.280] (-1655.607) -- 0:00:37 409500 -- (-1655.134) (-1654.375) (-1655.936) [-1657.856] * (-1656.971) (-1654.069) (-1655.134) [-1655.454] -- 0:00:37 410000 -- [-1654.072] (-1654.492) (-1654.674) (-1654.222) * [-1656.201] (-1656.607) (-1654.490) (-1655.629) -- 0:00:38 Average standard deviation of split frequencies: 0.013469 410500 -- (-1658.776) [-1656.581] (-1654.675) (-1653.542) * [-1656.364] (-1656.254) (-1653.563) (-1655.363) -- 0:00:38 411000 -- (-1656.477) (-1655.626) (-1656.602) [-1653.758] * (-1655.355) (-1656.619) [-1657.596] (-1657.650) -- 0:00:38 411500 -- (-1658.068) (-1659.510) [-1658.284] (-1654.924) * (-1655.944) (-1653.623) (-1657.634) [-1655.119] -- 0:00:38 412000 -- (-1655.524) [-1655.346] (-1655.798) (-1655.923) * (-1655.039) (-1653.676) [-1656.223] (-1655.341) -- 0:00:38 412500 -- [-1654.062] (-1654.010) (-1655.793) (-1656.378) * (-1659.865) (-1654.290) [-1657.735] (-1660.227) -- 0:00:38 413000 -- (-1655.898) [-1653.519] (-1654.526) (-1656.452) * (-1656.061) [-1653.529] (-1655.347) (-1658.517) -- 0:00:38 413500 -- (-1653.706) (-1653.519) (-1653.896) [-1653.450] * (-1655.739) (-1653.529) (-1655.443) [-1657.198] -- 0:00:38 414000 -- [-1654.162] (-1654.096) (-1655.531) (-1656.416) * [-1655.302] (-1655.406) (-1656.474) (-1654.939) -- 0:00:38 414500 -- (-1654.480) (-1664.766) [-1654.223] (-1654.835) * (-1654.163) (-1654.138) [-1659.827] (-1654.651) -- 0:00:38 415000 -- [-1656.661] (-1657.288) (-1654.730) (-1656.627) * [-1653.933] (-1653.663) (-1661.175) (-1657.022) -- 0:00:38 Average standard deviation of split frequencies: 0.014051 415500 -- (-1657.770) (-1654.066) [-1654.031] (-1655.578) * (-1656.520) (-1655.124) [-1656.209] (-1655.360) -- 0:00:37 416000 -- (-1657.810) (-1654.393) [-1655.230] (-1655.503) * (-1654.378) (-1657.517) (-1657.633) [-1655.190] -- 0:00:37 416500 -- (-1656.680) (-1655.186) [-1656.134] (-1655.577) * (-1655.314) [-1656.998] (-1654.796) (-1656.330) -- 0:00:37 417000 -- [-1656.017] (-1659.180) (-1656.542) (-1657.050) * (-1655.389) [-1655.114] (-1654.060) (-1655.367) -- 0:00:37 417500 -- (-1656.047) (-1657.519) [-1656.710] (-1661.014) * (-1654.976) (-1656.001) [-1654.181] (-1655.965) -- 0:00:37 418000 -- (-1657.419) (-1657.090) (-1655.238) [-1656.089] * (-1655.137) (-1653.526) (-1655.448) [-1656.372] -- 0:00:37 418500 -- (-1658.350) [-1656.653] (-1658.641) (-1654.969) * (-1655.031) (-1656.969) [-1656.865] (-1654.454) -- 0:00:37 419000 -- (-1660.352) (-1656.737) (-1656.844) [-1656.671] * [-1656.236] (-1655.644) (-1656.694) (-1656.958) -- 0:00:37 419500 -- (-1656.294) [-1654.465] (-1656.721) (-1653.682) * (-1658.927) (-1653.625) [-1654.053] (-1657.701) -- 0:00:37 420000 -- (-1654.852) (-1658.223) (-1656.818) [-1655.078] * [-1654.933] (-1653.519) (-1656.329) (-1656.166) -- 0:00:37 Average standard deviation of split frequencies: 0.013597 420500 -- (-1656.312) [-1657.059] (-1663.041) (-1655.763) * (-1654.870) [-1657.428] (-1656.532) (-1656.564) -- 0:00:37 421000 -- [-1654.096] (-1657.400) (-1656.479) (-1655.168) * (-1653.786) (-1655.096) (-1657.244) [-1655.920] -- 0:00:37 421500 -- (-1655.359) (-1654.374) (-1657.168) [-1653.445] * [-1653.994] (-1655.093) (-1659.308) (-1654.484) -- 0:00:37 422000 -- (-1654.632) (-1654.374) [-1656.389] (-1654.104) * (-1655.615) (-1654.203) (-1657.358) [-1653.586] -- 0:00:36 422500 -- (-1654.392) (-1655.847) (-1655.385) [-1653.783] * (-1655.539) (-1655.546) (-1654.336) [-1653.578] -- 0:00:36 423000 -- (-1657.887) (-1656.802) [-1654.908] (-1653.772) * (-1657.678) (-1659.702) (-1654.114) [-1655.812] -- 0:00:36 423500 -- (-1662.048) (-1656.217) [-1654.569] (-1653.784) * (-1657.678) [-1661.545] (-1655.924) (-1655.470) -- 0:00:36 424000 -- [-1656.696] (-1657.246) (-1656.215) (-1653.784) * (-1654.142) [-1656.580] (-1655.456) (-1654.559) -- 0:00:36 424500 -- (-1659.268) (-1660.609) (-1655.557) [-1654.244] * (-1654.728) (-1654.557) (-1654.864) [-1656.752] -- 0:00:36 425000 -- (-1656.622) (-1656.611) [-1654.936] (-1658.622) * (-1656.153) (-1655.279) (-1654.960) [-1656.337] -- 0:00:36 Average standard deviation of split frequencies: 0.012689 425500 -- (-1663.197) (-1654.952) [-1656.370] (-1656.840) * (-1654.340) [-1655.093] (-1654.849) (-1654.223) -- 0:00:37 426000 -- (-1656.090) [-1653.833] (-1655.161) (-1655.231) * (-1657.176) [-1654.208] (-1657.435) (-1655.354) -- 0:00:37 426500 -- (-1655.652) [-1653.722] (-1656.579) (-1654.672) * (-1654.771) (-1657.718) (-1658.648) [-1658.891] -- 0:00:37 427000 -- [-1656.108] (-1654.667) (-1656.736) (-1658.612) * [-1655.425] (-1661.578) (-1654.703) (-1654.788) -- 0:00:37 427500 -- (-1656.268) [-1655.007] (-1660.466) (-1655.729) * (-1654.279) (-1659.187) [-1655.138] (-1654.565) -- 0:00:37 428000 -- [-1657.629] (-1653.454) (-1658.438) (-1657.093) * (-1655.025) [-1660.247] (-1656.587) (-1656.702) -- 0:00:37 428500 -- (-1655.877) (-1655.230) (-1657.149) [-1654.883] * [-1655.349] (-1655.468) (-1656.040) (-1654.911) -- 0:00:37 429000 -- (-1655.399) [-1656.841] (-1654.757) (-1655.877) * (-1656.525) (-1655.989) [-1653.974] (-1654.121) -- 0:00:37 429500 -- (-1655.873) (-1659.414) (-1654.424) [-1655.314] * [-1656.056] (-1655.547) (-1657.061) (-1654.762) -- 0:00:37 430000 -- [-1655.997] (-1655.636) (-1653.635) (-1657.240) * (-1656.045) (-1654.332) [-1655.070] (-1655.864) -- 0:00:37 Average standard deviation of split frequencies: 0.012259 430500 -- (-1657.107) (-1659.180) (-1653.650) [-1657.327] * (-1658.050) [-1654.715] (-1655.185) (-1656.746) -- 0:00:37 431000 -- (-1654.446) (-1656.514) (-1655.356) [-1657.323] * (-1655.198) [-1655.733] (-1656.802) (-1657.207) -- 0:00:36 431500 -- (-1655.395) (-1656.648) [-1655.392] (-1656.290) * (-1659.271) [-1656.369] (-1654.602) (-1658.584) -- 0:00:36 432000 -- (-1655.603) (-1656.281) (-1655.898) [-1657.386] * (-1655.751) (-1656.704) [-1655.635] (-1659.432) -- 0:00:36 432500 -- (-1653.990) [-1653.714] (-1654.573) (-1657.915) * (-1655.761) (-1656.505) (-1654.040) [-1655.867] -- 0:00:36 433000 -- (-1654.554) [-1653.864] (-1657.635) (-1654.852) * (-1654.426) (-1658.348) [-1654.517] (-1657.060) -- 0:00:36 433500 -- (-1654.280) (-1655.107) [-1656.116] (-1654.081) * (-1657.887) (-1654.401) (-1654.251) [-1654.937] -- 0:00:36 434000 -- [-1654.674] (-1655.667) (-1655.310) (-1658.994) * [-1656.426] (-1655.123) (-1654.639) (-1657.353) -- 0:00:36 434500 -- (-1654.855) (-1660.797) [-1655.696] (-1655.680) * (-1654.935) [-1656.442] (-1655.502) (-1655.389) -- 0:00:36 435000 -- (-1655.992) [-1657.368] (-1655.210) (-1655.391) * (-1654.549) (-1654.238) [-1655.804] (-1656.988) -- 0:00:36 Average standard deviation of split frequencies: 0.013119 435500 -- [-1656.484] (-1657.666) (-1653.373) (-1656.032) * [-1653.724] (-1654.185) (-1658.721) (-1656.362) -- 0:00:36 436000 -- (-1654.059) (-1654.854) [-1654.702] (-1654.504) * (-1662.521) [-1655.508] (-1656.983) (-1658.118) -- 0:00:36 436500 -- (-1654.749) (-1654.283) [-1657.377] (-1653.491) * (-1659.518) [-1657.854] (-1657.197) (-1656.731) -- 0:00:36 437000 -- (-1655.730) [-1654.268] (-1655.506) (-1659.471) * (-1654.700) (-1655.570) [-1654.537] (-1655.645) -- 0:00:36 437500 -- (-1655.446) (-1653.756) (-1655.478) [-1655.352] * (-1654.598) (-1654.715) [-1654.268] (-1661.340) -- 0:00:36 438000 -- (-1653.500) (-1653.756) [-1656.623] (-1660.244) * [-1656.263] (-1655.123) (-1656.501) (-1653.401) -- 0:00:35 438500 -- [-1653.508] (-1656.527) (-1657.787) (-1655.052) * (-1653.412) [-1654.367] (-1653.922) (-1654.141) -- 0:00:35 439000 -- (-1659.039) (-1657.385) (-1660.591) [-1656.016] * (-1654.154) [-1653.976] (-1656.518) (-1654.285) -- 0:00:35 439500 -- (-1657.958) [-1655.549] (-1655.898) (-1657.006) * (-1656.309) (-1656.407) (-1663.529) [-1655.235] -- 0:00:35 440000 -- [-1658.277] (-1656.199) (-1658.148) (-1656.009) * (-1656.909) (-1654.678) (-1657.438) [-1655.087] -- 0:00:35 Average standard deviation of split frequencies: 0.013051 440500 -- [-1654.932] (-1654.842) (-1657.485) (-1654.440) * (-1656.376) (-1654.023) [-1654.861] (-1654.870) -- 0:00:35 441000 -- (-1656.214) [-1653.390] (-1656.721) (-1654.242) * (-1656.749) (-1656.176) [-1656.144] (-1654.608) -- 0:00:36 441500 -- [-1656.506] (-1655.378) (-1654.540) (-1656.100) * (-1656.246) (-1655.505) [-1656.049] (-1654.853) -- 0:00:36 442000 -- [-1653.518] (-1654.691) (-1657.261) (-1661.119) * [-1654.771] (-1655.657) (-1655.079) (-1659.344) -- 0:00:36 442500 -- (-1656.981) [-1657.499] (-1660.045) (-1659.329) * (-1655.385) (-1657.440) (-1657.590) [-1655.562] -- 0:00:36 443000 -- (-1655.861) (-1655.932) (-1654.794) [-1656.542] * (-1656.231) (-1659.850) (-1655.589) [-1655.543] -- 0:00:36 443500 -- [-1654.289] (-1656.357) (-1653.841) (-1660.100) * (-1654.842) (-1656.898) (-1654.259) [-1655.845] -- 0:00:36 444000 -- (-1654.702) (-1656.440) [-1656.485] (-1663.639) * (-1659.443) (-1655.707) (-1654.336) [-1654.212] -- 0:00:36 444500 -- (-1654.835) (-1654.148) (-1655.247) [-1655.360] * [-1658.045] (-1654.339) (-1658.792) (-1657.701) -- 0:00:36 445000 -- (-1654.581) (-1664.146) (-1654.050) [-1654.718] * (-1657.291) [-1654.260] (-1656.126) (-1655.248) -- 0:00:36 Average standard deviation of split frequencies: 0.012684 445500 -- (-1659.675) (-1656.204) (-1654.630) [-1654.621] * (-1655.986) (-1658.536) (-1653.861) [-1655.070] -- 0:00:36 446000 -- (-1656.863) (-1655.075) (-1655.106) [-1655.663] * (-1660.998) [-1654.996] (-1654.038) (-1655.860) -- 0:00:36 446500 -- (-1657.197) (-1654.493) [-1655.261] (-1656.191) * (-1655.880) (-1661.563) (-1654.118) [-1654.795] -- 0:00:35 447000 -- (-1656.460) (-1657.707) [-1654.809] (-1654.252) * (-1656.766) (-1656.780) (-1655.678) [-1655.391] -- 0:00:35 447500 -- (-1655.880) (-1657.021) [-1654.120] (-1653.466) * [-1655.789] (-1655.338) (-1654.165) (-1656.018) -- 0:00:35 448000 -- (-1656.588) (-1655.389) [-1656.505] (-1653.520) * [-1655.099] (-1655.281) (-1654.117) (-1654.609) -- 0:00:35 448500 -- (-1655.651) [-1655.146] (-1656.543) (-1655.177) * (-1656.175) (-1654.338) (-1656.855) [-1654.648] -- 0:00:35 449000 -- [-1654.176] (-1654.246) (-1655.055) (-1655.188) * [-1654.030] (-1654.093) (-1656.723) (-1655.415) -- 0:00:35 449500 -- (-1655.091) (-1653.956) [-1657.289] (-1655.969) * [-1654.122] (-1656.341) (-1654.977) (-1661.910) -- 0:00:35 450000 -- [-1656.304] (-1655.274) (-1655.232) (-1657.887) * (-1654.630) (-1661.581) [-1656.494] (-1658.745) -- 0:00:35 Average standard deviation of split frequencies: 0.013319 450500 -- (-1659.481) (-1656.539) [-1654.272] (-1658.949) * (-1655.246) [-1655.459] (-1659.779) (-1657.727) -- 0:00:35 451000 -- (-1658.602) (-1656.524) (-1655.576) [-1655.655] * (-1654.976) (-1654.955) (-1658.899) [-1656.045] -- 0:00:35 451500 -- (-1656.907) (-1654.427) (-1655.168) [-1655.487] * [-1656.815] (-1656.001) (-1657.652) (-1655.941) -- 0:00:35 452000 -- (-1656.574) [-1656.776] (-1655.101) (-1654.006) * (-1656.515) (-1655.287) [-1658.349] (-1654.477) -- 0:00:35 452500 -- (-1661.486) (-1656.850) (-1658.484) [-1661.429] * (-1655.088) (-1655.133) [-1656.529] (-1655.328) -- 0:00:35 453000 -- (-1659.973) (-1653.557) [-1658.501] (-1655.123) * [-1654.381] (-1654.191) (-1655.549) (-1656.394) -- 0:00:35 453500 -- (-1657.237) (-1655.006) (-1660.491) [-1653.256] * (-1655.033) (-1655.079) (-1658.077) [-1659.234] -- 0:00:34 454000 -- [-1654.380] (-1654.780) (-1654.715) (-1654.407) * [-1655.738] (-1655.129) (-1656.476) (-1658.716) -- 0:00:34 454500 -- [-1654.380] (-1655.885) (-1657.037) (-1656.677) * (-1655.227) [-1654.220] (-1653.524) (-1655.486) -- 0:00:34 455000 -- (-1653.603) (-1655.494) (-1654.613) [-1657.003] * (-1655.214) [-1653.753] (-1653.787) (-1655.992) -- 0:00:34 Average standard deviation of split frequencies: 0.012858 455500 -- [-1653.827] (-1655.028) (-1654.667) (-1653.958) * (-1656.392) (-1654.863) [-1655.912] (-1655.713) -- 0:00:34 456000 -- (-1653.669) (-1654.596) (-1653.930) [-1656.784] * (-1654.963) [-1656.384] (-1655.912) (-1656.646) -- 0:00:34 456500 -- [-1654.893] (-1654.596) (-1656.722) (-1655.638) * [-1655.156] (-1654.362) (-1654.605) (-1655.214) -- 0:00:35 457000 -- (-1654.575) (-1654.848) [-1655.338] (-1656.586) * (-1656.228) (-1655.582) (-1653.839) [-1655.441] -- 0:00:35 457500 -- (-1656.269) (-1655.403) (-1655.468) [-1656.135] * (-1654.728) (-1654.538) (-1656.385) [-1654.573] -- 0:00:35 458000 -- [-1655.890] (-1657.301) (-1655.471) (-1655.779) * [-1656.546] (-1656.040) (-1656.305) (-1655.684) -- 0:00:35 458500 -- (-1657.161) (-1655.799) (-1656.393) [-1656.278] * (-1657.328) (-1657.632) [-1654.615] (-1660.135) -- 0:00:35 459000 -- (-1660.551) [-1658.630] (-1658.354) (-1655.648) * (-1655.027) [-1654.715] (-1658.306) (-1663.858) -- 0:00:35 459500 -- (-1659.107) [-1658.616] (-1654.402) (-1657.056) * (-1654.159) (-1654.323) (-1655.573) [-1657.913] -- 0:00:35 460000 -- (-1657.361) [-1657.923] (-1654.272) (-1657.429) * [-1656.169] (-1656.781) (-1656.314) (-1655.213) -- 0:00:35 Average standard deviation of split frequencies: 0.013367 460500 -- (-1655.863) (-1654.257) (-1654.693) [-1654.777] * [-1653.831] (-1655.458) (-1656.379) (-1655.704) -- 0:00:35 461000 -- (-1658.976) (-1657.850) (-1656.097) [-1654.475] * [-1655.388] (-1655.267) (-1657.207) (-1654.843) -- 0:00:35 461500 -- (-1655.191) (-1655.240) [-1654.270] (-1654.349) * (-1657.342) (-1653.684) [-1655.207] (-1654.912) -- 0:00:35 462000 -- (-1656.638) (-1655.945) [-1655.213] (-1660.594) * (-1658.064) (-1653.474) [-1657.097] (-1658.083) -- 0:00:34 462500 -- (-1657.423) (-1656.255) (-1653.501) [-1655.584] * (-1656.957) [-1653.892] (-1657.189) (-1657.677) -- 0:00:34 463000 -- (-1658.790) [-1657.099] (-1654.406) (-1655.868) * (-1657.633) (-1654.037) (-1658.933) [-1657.812] -- 0:00:34 463500 -- (-1655.077) [-1654.542] (-1654.247) (-1658.048) * [-1657.535] (-1658.244) (-1656.068) (-1653.533) -- 0:00:34 464000 -- (-1654.452) [-1657.011] (-1655.450) (-1656.310) * [-1656.169] (-1659.660) (-1656.265) (-1653.684) -- 0:00:34 464500 -- [-1654.302] (-1657.743) (-1654.119) (-1659.022) * (-1656.450) (-1656.644) [-1656.913] (-1656.533) -- 0:00:34 465000 -- (-1654.949) [-1653.872] (-1656.080) (-1657.190) * (-1661.484) (-1653.600) (-1655.779) [-1655.015] -- 0:00:34 Average standard deviation of split frequencies: 0.012794 465500 -- (-1658.619) (-1655.757) [-1653.830] (-1655.898) * (-1663.023) (-1655.024) (-1657.570) [-1658.014] -- 0:00:34 466000 -- (-1655.659) [-1653.954] (-1654.443) (-1654.228) * (-1657.827) [-1654.945] (-1656.641) (-1656.338) -- 0:00:34 466500 -- (-1655.634) (-1654.921) [-1654.891] (-1658.917) * (-1657.658) [-1654.420] (-1654.648) (-1656.222) -- 0:00:34 467000 -- (-1653.854) (-1656.453) [-1659.251] (-1656.465) * (-1654.180) (-1658.075) [-1654.160] (-1655.887) -- 0:00:34 467500 -- (-1656.041) (-1657.269) (-1658.262) [-1657.866] * (-1655.903) (-1658.953) [-1654.092] (-1655.792) -- 0:00:34 468000 -- (-1656.665) [-1658.345] (-1655.807) (-1656.013) * (-1657.541) (-1655.114) [-1653.596] (-1656.432) -- 0:00:34 468500 -- [-1655.698] (-1657.570) (-1656.820) (-1658.172) * (-1656.068) [-1654.815] (-1658.117) (-1655.860) -- 0:00:34 469000 -- [-1655.107] (-1656.833) (-1656.356) (-1654.951) * (-1655.189) (-1654.435) (-1659.701) [-1655.460] -- 0:00:33 469500 -- (-1655.863) (-1657.273) [-1654.339] (-1655.001) * [-1656.391] (-1654.427) (-1655.220) (-1655.494) -- 0:00:33 470000 -- (-1656.892) (-1655.558) [-1653.828] (-1653.286) * (-1653.597) (-1654.427) (-1655.338) [-1655.318] -- 0:00:33 Average standard deviation of split frequencies: 0.012844 470500 -- [-1655.290] (-1658.321) (-1660.969) (-1655.051) * (-1654.230) [-1654.701] (-1658.846) (-1655.087) -- 0:00:33 471000 -- (-1656.513) (-1655.790) (-1656.454) [-1655.244] * (-1655.748) (-1654.728) [-1656.631] (-1655.041) -- 0:00:33 471500 -- (-1656.533) [-1653.621] (-1657.488) (-1657.515) * (-1655.151) (-1653.919) [-1654.875] (-1654.148) -- 0:00:33 472000 -- (-1656.923) (-1656.811) [-1657.199] (-1655.529) * (-1656.003) (-1655.375) [-1656.413] (-1654.337) -- 0:00:34 472500 -- (-1656.412) [-1657.413] (-1658.740) (-1654.153) * (-1655.014) (-1654.640) (-1655.816) [-1654.787] -- 0:00:34 473000 -- (-1654.360) (-1657.440) (-1655.310) [-1657.203] * (-1655.825) (-1654.678) [-1660.888] (-1656.036) -- 0:00:34 473500 -- [-1655.071] (-1660.300) (-1656.871) (-1656.065) * (-1656.185) (-1658.857) (-1658.254) [-1654.697] -- 0:00:34 474000 -- (-1654.719) [-1657.443] (-1657.607) (-1656.029) * (-1654.231) (-1653.888) (-1659.333) [-1657.003] -- 0:00:34 474500 -- (-1662.297) [-1659.365] (-1655.786) (-1654.263) * (-1654.231) (-1653.888) (-1656.199) [-1656.716] -- 0:00:34 475000 -- (-1660.258) [-1659.684] (-1653.402) (-1654.009) * [-1654.340] (-1654.614) (-1657.503) (-1654.589) -- 0:00:34 Average standard deviation of split frequencies: 0.011698 475500 -- (-1660.898) (-1655.025) [-1655.334] (-1655.380) * [-1657.118] (-1660.641) (-1656.411) (-1654.451) -- 0:00:34 476000 -- (-1655.046) (-1653.932) (-1655.195) [-1655.679] * (-1655.672) (-1659.005) [-1654.973] (-1655.660) -- 0:00:34 476500 -- (-1655.594) [-1653.568] (-1654.688) (-1655.997) * (-1655.230) [-1655.467] (-1654.499) (-1655.661) -- 0:00:34 477000 -- [-1654.056] (-1656.966) (-1656.785) (-1656.914) * (-1656.242) (-1659.761) (-1654.881) [-1654.642] -- 0:00:33 477500 -- (-1657.516) [-1654.431] (-1659.234) (-1654.482) * (-1655.375) [-1655.111] (-1656.032) (-1654.251) -- 0:00:33 478000 -- [-1654.572] (-1656.206) (-1657.429) (-1656.155) * (-1655.782) (-1655.012) (-1654.416) [-1654.534] -- 0:00:33 478500 -- (-1654.741) [-1656.306] (-1655.712) (-1656.183) * (-1655.228) (-1655.764) (-1655.726) [-1656.485] -- 0:00:33 479000 -- (-1657.316) [-1660.088] (-1654.060) (-1657.467) * (-1653.921) (-1656.154) (-1654.113) [-1656.545] -- 0:00:33 479500 -- (-1658.175) [-1657.610] (-1656.291) (-1657.543) * (-1654.043) [-1655.923] (-1658.984) (-1653.769) -- 0:00:33 480000 -- (-1656.860) [-1655.878] (-1656.667) (-1658.970) * (-1657.343) [-1655.348] (-1655.343) (-1654.450) -- 0:00:33 Average standard deviation of split frequencies: 0.012226 480500 -- (-1654.956) [-1654.076] (-1657.438) (-1659.082) * (-1655.518) (-1656.111) (-1654.671) [-1653.826] -- 0:00:33 481000 -- [-1655.624] (-1657.443) (-1655.077) (-1658.827) * (-1655.151) (-1654.355) [-1655.349] (-1656.695) -- 0:00:33 481500 -- (-1655.933) (-1654.222) (-1654.471) [-1655.252] * (-1655.110) (-1654.755) [-1657.841] (-1654.756) -- 0:00:33 482000 -- (-1656.003) (-1654.710) (-1655.127) [-1655.543] * (-1654.868) (-1654.749) (-1657.094) [-1654.243] -- 0:00:33 482500 -- (-1654.944) [-1653.926] (-1653.486) (-1661.187) * (-1658.093) (-1654.626) (-1655.394) [-1657.527] -- 0:00:33 483000 -- [-1655.590] (-1653.797) (-1655.308) (-1663.082) * (-1654.817) (-1656.183) [-1657.821] (-1656.269) -- 0:00:33 483500 -- (-1658.705) (-1655.754) [-1654.790] (-1662.375) * (-1656.130) (-1655.284) [-1655.599] (-1657.403) -- 0:00:33 484000 -- (-1653.870) (-1657.009) (-1653.802) [-1655.138] * (-1659.618) (-1656.165) (-1658.131) [-1655.243] -- 0:00:33 484500 -- (-1653.900) (-1653.760) (-1654.271) [-1658.459] * [-1656.233] (-1654.639) (-1656.464) (-1654.313) -- 0:00:32 485000 -- [-1654.292] (-1656.838) (-1654.179) (-1656.786) * [-1661.041] (-1654.545) (-1655.249) (-1655.713) -- 0:00:32 Average standard deviation of split frequencies: 0.011397 485500 -- (-1654.051) (-1657.346) (-1655.560) [-1658.682] * (-1656.872) [-1654.129] (-1658.496) (-1660.168) -- 0:00:32 486000 -- [-1658.077] (-1655.730) (-1654.740) (-1653.724) * [-1654.172] (-1656.429) (-1656.789) (-1656.200) -- 0:00:32 486500 -- [-1654.823] (-1658.882) (-1657.037) (-1653.635) * (-1656.338) (-1653.741) (-1656.087) [-1654.729] -- 0:00:32 487000 -- (-1655.751) (-1656.378) (-1661.937) [-1654.623] * [-1656.751] (-1654.556) (-1656.196) (-1654.830) -- 0:00:32 487500 -- [-1655.437] (-1656.342) (-1659.613) (-1653.958) * (-1655.598) (-1655.760) [-1653.512] (-1656.943) -- 0:00:32 488000 -- (-1656.834) [-1654.330] (-1657.141) (-1654.348) * [-1657.994] (-1656.930) (-1655.414) (-1660.270) -- 0:00:33 488500 -- (-1659.255) (-1656.155) [-1655.103] (-1655.542) * (-1658.386) (-1656.650) (-1655.582) [-1655.570] -- 0:00:33 489000 -- (-1657.461) (-1658.475) [-1657.414] (-1657.985) * (-1659.942) (-1655.567) [-1655.939] (-1655.522) -- 0:00:33 489500 -- (-1657.783) (-1656.158) (-1656.865) [-1655.640] * [-1660.042] (-1655.322) (-1662.954) (-1657.227) -- 0:00:33 490000 -- [-1656.184] (-1655.197) (-1654.927) (-1657.956) * (-1655.129) (-1653.876) (-1655.886) [-1654.680] -- 0:00:33 Average standard deviation of split frequencies: 0.011589 490500 -- [-1657.934] (-1656.080) (-1654.729) (-1660.792) * (-1657.760) (-1653.671) (-1655.908) [-1654.852] -- 0:00:33 491000 -- (-1656.783) [-1655.785] (-1654.260) (-1655.670) * (-1656.254) (-1659.631) [-1653.890] (-1656.767) -- 0:00:33 491500 -- [-1657.654] (-1658.271) (-1654.260) (-1656.994) * (-1657.642) (-1655.291) (-1656.780) [-1654.429] -- 0:00:33 492000 -- (-1654.261) [-1656.632] (-1654.144) (-1655.797) * (-1657.175) (-1659.676) (-1655.062) [-1658.027] -- 0:00:33 492500 -- (-1655.987) (-1655.567) [-1656.546] (-1654.692) * [-1653.991] (-1656.664) (-1654.264) (-1658.298) -- 0:00:32 493000 -- [-1654.509] (-1655.854) (-1656.848) (-1653.985) * [-1654.442] (-1654.939) (-1654.151) (-1659.694) -- 0:00:32 493500 -- [-1654.402] (-1654.982) (-1656.386) (-1657.676) * (-1654.548) [-1655.334] (-1654.764) (-1658.240) -- 0:00:32 494000 -- (-1654.887) (-1655.093) (-1655.666) [-1659.284] * (-1654.281) [-1655.837] (-1655.269) (-1656.976) -- 0:00:32 494500 -- (-1654.969) (-1655.533) (-1655.569) [-1654.340] * (-1654.041) (-1654.925) [-1654.966] (-1656.241) -- 0:00:32 495000 -- (-1654.010) [-1655.889] (-1655.639) (-1659.713) * (-1654.778) (-1655.084) [-1653.837] (-1655.464) -- 0:00:32 Average standard deviation of split frequencies: 0.011049 495500 -- (-1653.982) (-1657.486) [-1657.583] (-1657.211) * (-1654.098) [-1656.116] (-1656.125) (-1653.610) -- 0:00:32 496000 -- (-1657.166) (-1654.803) [-1656.044] (-1664.007) * [-1657.825] (-1656.319) (-1653.580) (-1655.031) -- 0:00:32 496500 -- (-1655.364) (-1658.535) (-1656.515) [-1656.759] * (-1657.441) [-1655.514] (-1654.155) (-1654.755) -- 0:00:32 497000 -- (-1654.839) (-1660.248) (-1659.602) [-1658.875] * (-1659.890) [-1654.388] (-1654.178) (-1654.373) -- 0:00:32 497500 -- (-1656.790) [-1660.167] (-1656.510) (-1658.470) * (-1655.783) (-1654.077) (-1657.011) [-1657.374] -- 0:00:32 498000 -- (-1657.126) (-1656.142) (-1653.768) [-1657.086] * (-1655.669) (-1656.572) (-1660.020) [-1655.395] -- 0:00:32 498500 -- (-1655.430) (-1656.234) [-1653.614] (-1658.122) * (-1656.468) (-1657.404) (-1655.464) [-1653.562] -- 0:00:32 499000 -- (-1656.327) [-1656.371] (-1655.953) (-1658.072) * (-1661.951) (-1655.383) (-1656.235) [-1653.599] -- 0:00:32 499500 -- (-1655.454) (-1653.784) [-1656.470] (-1656.215) * (-1658.491) (-1654.530) (-1655.605) [-1653.569] -- 0:00:32 500000 -- (-1655.496) (-1654.720) (-1657.503) [-1655.456] * [-1657.339] (-1653.941) (-1653.356) (-1653.338) -- 0:00:32 Average standard deviation of split frequencies: 0.011236 500500 -- (-1655.671) (-1654.748) [-1656.305] (-1654.947) * (-1659.436) [-1654.183] (-1655.440) (-1653.357) -- 0:00:31 501000 -- (-1654.848) [-1659.685] (-1656.285) (-1654.543) * (-1661.377) (-1655.049) [-1655.012] (-1654.276) -- 0:00:31 501500 -- (-1654.272) [-1657.446] (-1654.787) (-1656.765) * [-1656.411] (-1654.106) (-1654.891) (-1653.408) -- 0:00:31 502000 -- (-1655.313) (-1654.174) [-1654.881] (-1655.048) * (-1655.989) [-1654.178] (-1658.680) (-1653.743) -- 0:00:31 502500 -- [-1659.813] (-1656.268) (-1657.884) (-1655.639) * (-1656.958) [-1653.882] (-1657.502) (-1655.310) -- 0:00:31 503000 -- [-1654.739] (-1654.861) (-1655.464) (-1655.093) * (-1654.678) [-1655.144] (-1655.168) (-1655.696) -- 0:00:31 503500 -- [-1657.842] (-1654.534) (-1655.464) (-1657.976) * (-1655.220) (-1662.446) [-1655.199] (-1654.055) -- 0:00:32 504000 -- [-1657.423] (-1655.282) (-1657.003) (-1657.333) * (-1654.765) (-1662.659) [-1656.289] (-1654.099) -- 0:00:32 504500 -- (-1655.423) [-1656.060] (-1654.627) (-1655.960) * (-1660.016) (-1654.869) [-1655.073] (-1654.973) -- 0:00:32 505000 -- (-1655.362) (-1654.502) [-1654.716] (-1653.785) * [-1654.492] (-1658.609) (-1656.525) (-1654.888) -- 0:00:32 Average standard deviation of split frequencies: 0.010772 505500 -- (-1653.419) (-1656.859) (-1656.597) [-1656.819] * [-1654.362] (-1660.660) (-1653.830) (-1655.642) -- 0:00:32 506000 -- (-1656.862) (-1656.982) (-1656.221) [-1655.169] * (-1656.310) (-1655.497) (-1654.831) [-1654.999] -- 0:00:32 506500 -- (-1655.088) [-1659.571] (-1657.237) (-1656.856) * (-1656.190) (-1655.271) (-1654.317) [-1657.141] -- 0:00:32 507000 -- (-1653.700) (-1656.659) (-1657.564) [-1658.641] * (-1655.438) [-1654.366] (-1654.746) (-1657.798) -- 0:00:32 507500 -- (-1656.822) (-1655.441) [-1661.144] (-1659.550) * [-1653.463] (-1656.599) (-1654.459) (-1657.616) -- 0:00:32 508000 -- (-1654.452) [-1653.489] (-1656.752) (-1656.246) * (-1658.595) (-1655.582) (-1656.553) [-1658.033] -- 0:00:31 508500 -- [-1653.767] (-1655.250) (-1655.784) (-1655.048) * [-1655.091] (-1657.373) (-1658.520) (-1659.409) -- 0:00:31 509000 -- (-1654.425) (-1658.739) (-1655.673) [-1655.032] * [-1654.195] (-1657.817) (-1660.166) (-1657.265) -- 0:00:31 509500 -- [-1655.585] (-1659.150) (-1653.858) (-1657.215) * (-1653.889) (-1654.272) (-1653.437) [-1658.052] -- 0:00:31 510000 -- (-1657.368) (-1654.141) [-1654.136] (-1653.895) * (-1654.854) (-1655.952) [-1653.487] (-1654.890) -- 0:00:31 Average standard deviation of split frequencies: 0.010317 510500 -- (-1654.766) [-1654.030] (-1654.680) (-1657.884) * (-1657.305) (-1654.909) [-1654.503] (-1656.270) -- 0:00:31 511000 -- (-1655.959) (-1655.592) (-1655.921) [-1657.559] * (-1660.444) [-1654.467] (-1656.307) (-1653.999) -- 0:00:31 511500 -- (-1654.721) (-1655.115) [-1655.636] (-1657.451) * [-1655.684] (-1655.508) (-1654.175) (-1654.012) -- 0:00:31 512000 -- (-1654.490) (-1654.886) [-1658.731] (-1654.825) * (-1654.480) [-1655.515] (-1655.102) (-1654.357) -- 0:00:31 512500 -- (-1655.664) (-1653.893) (-1658.854) [-1654.640] * (-1656.906) (-1655.243) [-1654.897] (-1656.856) -- 0:00:31 513000 -- [-1657.131] (-1655.854) (-1658.562) (-1655.261) * (-1654.648) [-1655.751] (-1654.135) (-1656.986) -- 0:00:31 513500 -- (-1655.258) [-1654.063] (-1657.129) (-1654.967) * (-1654.568) (-1657.136) (-1654.108) [-1656.317] -- 0:00:31 514000 -- [-1654.126] (-1655.120) (-1656.583) (-1655.019) * (-1655.154) [-1656.596] (-1657.577) (-1656.629) -- 0:00:31 514500 -- (-1654.488) (-1653.617) (-1659.049) [-1657.017] * (-1655.154) (-1655.977) [-1653.985] (-1655.220) -- 0:00:31 515000 -- (-1656.928) [-1654.011] (-1654.938) (-1654.694) * [-1654.559] (-1654.565) (-1654.052) (-1655.841) -- 0:00:31 Average standard deviation of split frequencies: 0.011085 515500 -- (-1654.070) [-1654.262] (-1653.833) (-1657.805) * (-1653.324) (-1658.147) [-1654.754] (-1657.378) -- 0:00:31 516000 -- (-1653.803) (-1653.903) [-1654.151] (-1655.440) * (-1660.871) (-1658.147) (-1657.460) [-1654.408] -- 0:00:30 516500 -- [-1653.803] (-1654.565) (-1653.940) (-1653.327) * (-1662.218) (-1654.967) [-1653.802] (-1653.898) -- 0:00:30 517000 -- (-1653.818) (-1656.247) [-1654.246] (-1654.472) * (-1656.227) [-1654.429] (-1653.804) (-1655.436) -- 0:00:30 517500 -- [-1653.810] (-1655.307) (-1653.768) (-1655.161) * [-1656.600] (-1653.950) (-1654.982) (-1653.783) -- 0:00:30 518000 -- (-1657.954) (-1656.916) [-1658.843] (-1654.779) * (-1657.190) (-1654.266) [-1657.540] (-1657.568) -- 0:00:30 518500 -- (-1658.216) (-1657.276) (-1655.092) [-1654.548] * (-1658.152) (-1655.555) [-1656.390] (-1657.247) -- 0:00:30 519000 -- [-1655.197] (-1656.539) (-1654.934) (-1656.187) * [-1654.570] (-1655.156) (-1659.689) (-1655.527) -- 0:00:30 519500 -- (-1653.785) (-1655.416) [-1654.901] (-1662.076) * [-1654.344] (-1657.025) (-1657.314) (-1655.265) -- 0:00:31 520000 -- (-1654.739) [-1658.096] (-1659.814) (-1655.219) * [-1656.803] (-1656.081) (-1657.174) (-1655.322) -- 0:00:31 Average standard deviation of split frequencies: 0.010080 520500 -- (-1654.380) [-1655.723] (-1658.986) (-1654.907) * (-1655.703) [-1654.844] (-1655.056) (-1656.436) -- 0:00:31 521000 -- (-1656.992) (-1655.086) (-1658.798) [-1654.012] * [-1654.286] (-1658.979) (-1653.840) (-1656.841) -- 0:00:31 521500 -- (-1657.751) [-1654.232] (-1655.760) (-1654.914) * (-1653.508) (-1656.143) (-1655.222) [-1655.053] -- 0:00:31 522000 -- (-1657.003) (-1655.991) (-1655.796) [-1654.828] * (-1653.549) (-1659.731) [-1654.907] (-1654.127) -- 0:00:31 522500 -- (-1655.018) [-1656.051] (-1655.499) (-1655.946) * [-1655.409] (-1654.618) (-1656.546) (-1655.792) -- 0:00:31 523000 -- (-1655.513) [-1654.925] (-1654.768) (-1655.854) * [-1657.973] (-1654.585) (-1657.248) (-1655.548) -- 0:00:31 523500 -- (-1653.896) (-1655.916) (-1654.367) [-1654.193] * [-1653.704] (-1654.726) (-1654.956) (-1659.305) -- 0:00:30 524000 -- (-1654.837) [-1655.211] (-1655.719) (-1654.785) * [-1653.181] (-1655.336) (-1656.630) (-1656.239) -- 0:00:30 524500 -- (-1653.541) (-1656.822) (-1656.534) [-1653.965] * (-1654.843) (-1656.920) (-1658.044) [-1656.460] -- 0:00:30 525000 -- (-1653.521) (-1654.340) (-1658.169) [-1655.575] * [-1654.033] (-1655.497) (-1655.991) (-1657.627) -- 0:00:30 Average standard deviation of split frequencies: 0.009311 525500 -- (-1653.652) [-1657.567] (-1653.349) (-1655.486) * (-1655.055) (-1654.724) (-1657.970) [-1657.887] -- 0:00:30 526000 -- (-1657.332) [-1654.482] (-1654.115) (-1655.404) * (-1655.077) (-1654.914) (-1655.011) [-1654.327] -- 0:00:30 526500 -- (-1661.249) (-1656.584) (-1655.591) [-1655.586] * (-1657.901) [-1658.227] (-1656.081) (-1654.502) -- 0:00:30 527000 -- (-1658.146) (-1656.872) [-1657.670] (-1658.430) * (-1655.965) (-1656.350) [-1656.217] (-1660.200) -- 0:00:30 527500 -- [-1655.214] (-1659.321) (-1657.914) (-1659.578) * [-1655.910] (-1657.525) (-1659.782) (-1655.855) -- 0:00:30 528000 -- (-1657.623) [-1659.464] (-1654.507) (-1656.256) * [-1658.174] (-1655.822) (-1657.425) (-1655.115) -- 0:00:30 528500 -- (-1660.444) (-1655.095) [-1655.544] (-1655.589) * (-1656.077) (-1656.929) (-1657.791) [-1655.590] -- 0:00:30 529000 -- [-1663.887] (-1655.046) (-1655.481) (-1657.207) * (-1654.652) (-1654.443) (-1657.749) [-1659.325] -- 0:00:30 529500 -- [-1663.665] (-1654.417) (-1658.358) (-1657.818) * (-1654.976) [-1655.746] (-1656.266) (-1658.362) -- 0:00:30 530000 -- (-1658.923) [-1654.689] (-1657.402) (-1657.906) * [-1654.851] (-1658.536) (-1656.272) (-1654.816) -- 0:00:30 Average standard deviation of split frequencies: 0.009216 530500 -- [-1656.318] (-1653.793) (-1655.208) (-1656.419) * [-1654.753] (-1660.221) (-1655.822) (-1658.341) -- 0:00:30 531000 -- (-1657.170) (-1659.670) [-1654.810] (-1657.463) * (-1653.929) (-1657.263) [-1655.702] (-1657.268) -- 0:00:30 531500 -- (-1655.697) (-1657.967) (-1656.925) [-1655.281] * (-1655.578) (-1654.734) (-1656.082) [-1659.027] -- 0:00:29 532000 -- (-1655.697) [-1654.499] (-1657.913) (-1657.176) * (-1654.690) (-1653.896) (-1658.375) [-1657.080] -- 0:00:29 532500 -- (-1655.453) (-1654.220) (-1656.559) [-1656.124] * (-1658.756) (-1653.956) (-1656.628) [-1656.981] -- 0:00:29 533000 -- (-1658.249) [-1656.150] (-1658.466) (-1661.100) * (-1659.521) [-1653.957] (-1655.213) (-1656.072) -- 0:00:29 533500 -- (-1661.014) (-1655.714) [-1656.117] (-1658.462) * (-1657.528) (-1660.248) [-1655.444] (-1659.313) -- 0:00:29 534000 -- [-1654.156] (-1657.188) (-1654.268) (-1655.162) * [-1657.542] (-1655.622) (-1655.776) (-1658.521) -- 0:00:29 534500 -- [-1657.958] (-1656.516) (-1653.927) (-1653.659) * (-1655.238) [-1654.929] (-1657.283) (-1657.712) -- 0:00:29 535000 -- (-1659.116) (-1653.548) (-1654.156) [-1653.660] * (-1660.104) (-1654.170) [-1656.040] (-1653.589) -- 0:00:30 Average standard deviation of split frequencies: 0.009015 535500 -- [-1654.849] (-1655.566) (-1653.961) (-1654.039) * (-1654.580) (-1654.244) [-1656.282] (-1654.937) -- 0:00:30 536000 -- (-1654.647) (-1656.618) (-1655.061) [-1656.516] * (-1656.722) [-1654.968] (-1656.362) (-1655.041) -- 0:00:30 536500 -- (-1656.472) (-1654.281) (-1657.662) [-1654.336] * (-1659.210) [-1654.861] (-1656.857) (-1653.329) -- 0:00:30 537000 -- (-1657.796) (-1655.833) [-1653.572] (-1664.687) * (-1657.899) [-1655.109] (-1659.047) (-1657.927) -- 0:00:30 537500 -- (-1655.021) (-1654.894) [-1655.850] (-1656.226) * [-1660.420] (-1656.348) (-1658.189) (-1659.164) -- 0:00:30 538000 -- (-1655.217) (-1655.719) [-1661.057] (-1654.925) * (-1656.265) (-1657.692) (-1654.617) [-1658.216] -- 0:00:30 538500 -- (-1656.017) (-1656.286) [-1656.318] (-1658.492) * (-1654.361) [-1662.490] (-1657.088) (-1657.994) -- 0:00:29 539000 -- (-1660.434) (-1656.183) (-1654.303) [-1653.508] * (-1654.531) [-1658.210] (-1654.014) (-1659.191) -- 0:00:29 539500 -- (-1654.032) (-1657.906) (-1654.863) [-1653.447] * (-1653.511) (-1657.917) [-1656.982] (-1658.829) -- 0:00:29 540000 -- (-1659.003) (-1659.386) [-1654.283] (-1653.595) * [-1653.961] (-1660.899) (-1658.266) (-1657.103) -- 0:00:29 Average standard deviation of split frequencies: 0.009318 540500 -- (-1658.237) (-1660.609) [-1653.881] (-1655.075) * (-1653.637) (-1654.582) (-1659.249) [-1654.331] -- 0:00:29 541000 -- (-1654.793) (-1658.298) [-1656.498] (-1656.857) * [-1655.637] (-1655.527) (-1655.367) (-1654.766) -- 0:00:29 541500 -- [-1656.383] (-1654.731) (-1655.237) (-1656.607) * [-1654.174] (-1654.422) (-1653.800) (-1656.386) -- 0:00:29 542000 -- (-1660.307) [-1658.324] (-1654.345) (-1655.179) * [-1654.171] (-1655.962) (-1665.818) (-1659.765) -- 0:00:29 542500 -- [-1655.051] (-1657.113) (-1657.387) (-1653.857) * (-1656.755) [-1656.191] (-1664.871) (-1657.514) -- 0:00:29 543000 -- (-1654.722) [-1656.182] (-1658.522) (-1653.793) * (-1656.725) (-1654.620) [-1653.748] (-1659.251) -- 0:00:29 543500 -- [-1655.122] (-1655.170) (-1657.436) (-1653.711) * (-1657.300) (-1658.168) [-1656.395] (-1654.830) -- 0:00:29 544000 -- (-1654.864) [-1656.984] (-1658.060) (-1653.732) * [-1654.470] (-1660.982) (-1656.675) (-1656.236) -- 0:00:29 544500 -- (-1656.147) [-1654.460] (-1657.660) (-1655.184) * (-1656.403) (-1659.369) [-1656.872] (-1654.739) -- 0:00:29 545000 -- (-1659.101) (-1660.164) [-1654.250] (-1659.402) * [-1654.552] (-1657.500) (-1659.455) (-1655.200) -- 0:00:29 Average standard deviation of split frequencies: 0.008024 545500 -- (-1657.656) [-1655.403] (-1653.596) (-1654.233) * (-1653.414) (-1661.274) (-1658.115) [-1654.909] -- 0:00:29 546000 -- (-1657.491) (-1655.395) [-1655.537] (-1653.534) * (-1656.135) (-1655.383) (-1658.886) [-1654.916] -- 0:00:29 546500 -- [-1656.682] (-1658.781) (-1655.181) (-1653.540) * (-1654.741) (-1657.306) [-1654.716] (-1655.690) -- 0:00:29 547000 -- (-1656.259) (-1655.611) [-1655.284] (-1653.936) * (-1656.394) (-1654.367) (-1659.508) [-1655.311] -- 0:00:28 547500 -- (-1656.259) [-1654.504] (-1658.066) (-1655.341) * [-1653.445] (-1658.518) (-1656.361) (-1657.788) -- 0:00:28 548000 -- (-1655.808) (-1653.707) (-1657.452) [-1655.991] * [-1653.693] (-1656.320) (-1657.333) (-1655.509) -- 0:00:28 548500 -- [-1655.905] (-1654.487) (-1653.862) (-1654.705) * [-1654.577] (-1654.457) (-1662.298) (-1658.486) -- 0:00:28 549000 -- (-1654.816) (-1653.889) [-1655.716] (-1654.705) * [-1654.792] (-1655.138) (-1655.444) (-1655.403) -- 0:00:28 549500 -- (-1657.641) [-1655.376] (-1658.969) (-1656.500) * (-1657.113) (-1657.515) (-1655.402) [-1656.275] -- 0:00:28 550000 -- (-1658.493) [-1656.135] (-1657.599) (-1655.751) * (-1660.708) (-1655.553) (-1655.527) [-1657.389] -- 0:00:28 Average standard deviation of split frequencies: 0.007651 550500 -- (-1654.777) (-1655.586) (-1659.831) [-1654.847] * [-1655.890] (-1658.433) (-1653.780) (-1657.595) -- 0:00:29 551000 -- (-1655.493) (-1655.567) (-1655.905) [-1657.835] * (-1656.044) (-1659.167) (-1654.461) [-1654.846] -- 0:00:29 551500 -- (-1654.743) [-1654.648] (-1654.640) (-1656.816) * (-1654.248) [-1654.152] (-1657.594) (-1655.191) -- 0:00:29 552000 -- (-1656.878) [-1654.702] (-1655.451) (-1657.076) * (-1654.368) [-1654.944] (-1656.263) (-1655.083) -- 0:00:29 552500 -- [-1653.936] (-1654.923) (-1653.660) (-1657.341) * (-1653.897) [-1654.100] (-1655.982) (-1655.224) -- 0:00:29 553000 -- (-1657.559) (-1656.771) (-1653.464) [-1655.552] * [-1653.747] (-1654.697) (-1653.711) (-1655.276) -- 0:00:29 553500 -- (-1655.775) (-1657.393) [-1655.617] (-1656.921) * [-1655.390] (-1656.976) (-1656.647) (-1654.711) -- 0:00:29 554000 -- (-1653.887) (-1655.567) (-1656.741) [-1659.862] * (-1658.309) [-1653.536] (-1653.683) (-1654.308) -- 0:00:28 554500 -- (-1656.252) [-1655.815] (-1657.487) (-1654.118) * (-1655.973) (-1654.057) [-1653.831] (-1658.877) -- 0:00:28 555000 -- (-1653.678) (-1657.120) [-1655.719] (-1654.416) * (-1654.750) (-1654.456) (-1653.741) [-1655.527] -- 0:00:28 Average standard deviation of split frequencies: 0.007381 555500 -- (-1653.919) [-1656.962] (-1658.464) (-1654.421) * (-1655.434) (-1654.360) (-1654.141) [-1656.374] -- 0:00:28 556000 -- (-1654.061) (-1662.420) (-1660.132) [-1654.715] * [-1655.411] (-1655.096) (-1656.198) (-1656.455) -- 0:00:28 556500 -- (-1654.468) [-1656.792] (-1654.402) (-1655.636) * (-1658.599) [-1657.398] (-1656.033) (-1655.181) -- 0:00:28 557000 -- [-1656.661] (-1653.347) (-1654.637) (-1654.857) * (-1656.973) (-1657.807) (-1654.580) [-1655.160] -- 0:00:28 557500 -- (-1656.454) (-1657.065) (-1657.230) [-1655.219] * [-1655.024] (-1660.307) (-1656.992) (-1654.125) -- 0:00:28 558000 -- (-1657.350) (-1658.382) (-1654.005) [-1655.258] * (-1654.478) (-1659.910) [-1656.621] (-1654.802) -- 0:00:28 558500 -- (-1656.385) (-1657.786) (-1655.135) [-1655.323] * [-1654.691] (-1656.744) (-1658.224) (-1654.685) -- 0:00:28 559000 -- (-1658.947) (-1657.949) [-1655.757] (-1656.593) * (-1655.798) (-1655.488) (-1654.180) [-1655.693] -- 0:00:28 559500 -- (-1656.591) (-1654.705) [-1654.914] (-1655.329) * (-1655.493) [-1655.504] (-1654.428) (-1655.289) -- 0:00:28 560000 -- (-1654.886) [-1656.058] (-1656.503) (-1656.964) * [-1655.119] (-1655.390) (-1654.881) (-1656.812) -- 0:00:28 Average standard deviation of split frequencies: 0.008198 560500 -- (-1656.303) (-1654.154) [-1657.088] (-1655.617) * (-1656.563) (-1656.015) (-1656.111) [-1653.809] -- 0:00:28 561000 -- (-1655.579) (-1662.090) (-1654.137) [-1655.746] * (-1656.156) (-1654.701) (-1657.109) [-1658.700] -- 0:00:28 561500 -- [-1655.438] (-1663.918) (-1654.216) (-1653.807) * [-1654.663] (-1654.696) (-1657.374) (-1656.354) -- 0:00:28 562000 -- [-1654.326] (-1659.604) (-1654.047) (-1653.849) * (-1654.630) (-1655.860) (-1654.708) [-1656.639] -- 0:00:28 562500 -- (-1655.588) (-1657.009) [-1657.458] (-1656.202) * (-1655.346) [-1658.106] (-1653.839) (-1656.249) -- 0:00:28 563000 -- [-1655.393] (-1655.264) (-1660.924) (-1656.229) * (-1657.364) (-1656.644) (-1656.425) [-1656.254] -- 0:00:27 563500 -- (-1657.211) [-1655.571] (-1658.143) (-1657.913) * (-1659.304) (-1658.344) [-1654.483] (-1655.197) -- 0:00:27 564000 -- [-1657.250] (-1655.440) (-1662.752) (-1661.710) * (-1654.638) [-1657.190] (-1657.048) (-1656.864) -- 0:00:27 564500 -- (-1655.029) (-1657.960) (-1660.354) [-1656.836] * (-1655.122) (-1654.197) (-1659.013) [-1655.989] -- 0:00:27 565000 -- [-1654.020] (-1660.866) (-1658.158) (-1656.049) * (-1653.814) (-1656.171) (-1656.432) [-1656.962] -- 0:00:27 Average standard deviation of split frequencies: 0.007692 565500 -- (-1655.673) [-1656.115] (-1657.234) (-1655.569) * [-1655.927] (-1656.507) (-1654.546) (-1658.741) -- 0:00:27 566000 -- (-1654.925) (-1656.522) (-1657.966) [-1654.972] * (-1656.500) (-1657.501) [-1660.413] (-1657.685) -- 0:00:27 566500 -- (-1654.855) [-1656.069] (-1656.482) (-1653.797) * [-1655.984] (-1654.937) (-1658.454) (-1654.664) -- 0:00:28 567000 -- (-1654.783) [-1654.327] (-1654.227) (-1654.693) * (-1660.130) (-1657.923) [-1659.860] (-1654.407) -- 0:00:28 567500 -- [-1659.035] (-1656.605) (-1656.056) (-1656.789) * (-1659.790) (-1655.708) (-1656.344) [-1654.407] -- 0:00:28 568000 -- (-1659.129) (-1656.905) [-1656.056] (-1659.830) * (-1655.587) (-1654.820) [-1656.893] (-1656.029) -- 0:00:28 568500 -- (-1654.756) (-1653.885) (-1658.123) [-1656.024] * (-1660.497) (-1654.211) [-1654.219] (-1654.449) -- 0:00:28 569000 -- (-1654.118) (-1653.934) (-1657.752) [-1654.551] * (-1654.010) (-1656.219) [-1653.655] (-1657.672) -- 0:00:28 569500 -- [-1653.676] (-1654.991) (-1654.308) (-1654.545) * (-1654.171) (-1657.830) (-1653.997) [-1659.071] -- 0:00:27 570000 -- (-1653.666) [-1654.990] (-1657.821) (-1655.457) * (-1654.946) [-1655.846] (-1654.991) (-1657.166) -- 0:00:27 Average standard deviation of split frequencies: 0.007240 570500 -- (-1653.280) (-1655.693) (-1656.344) [-1654.145] * (-1655.958) (-1657.688) (-1653.967) [-1658.727] -- 0:00:27 571000 -- (-1656.136) [-1655.571] (-1654.667) (-1656.214) * (-1658.901) (-1656.580) (-1656.576) [-1655.194] -- 0:00:27 571500 -- (-1656.557) [-1655.311] (-1656.728) (-1655.937) * (-1657.998) [-1659.584] (-1655.002) (-1655.271) -- 0:00:27 572000 -- (-1657.492) (-1654.452) [-1655.101] (-1657.373) * [-1658.125] (-1655.133) (-1653.916) (-1654.617) -- 0:00:27 572500 -- (-1656.645) (-1657.439) [-1655.275] (-1656.586) * [-1655.225] (-1655.401) (-1657.614) (-1655.188) -- 0:00:27 573000 -- (-1658.221) (-1656.308) (-1656.846) [-1654.399] * [-1661.245] (-1658.054) (-1656.112) (-1659.883) -- 0:00:27 573500 -- (-1654.834) (-1657.157) (-1655.470) [-1654.586] * (-1654.005) [-1656.547] (-1655.961) (-1658.129) -- 0:00:27 574000 -- (-1657.068) (-1655.020) [-1654.852] (-1654.595) * (-1654.861) [-1655.157] (-1656.411) (-1653.514) -- 0:00:27 574500 -- (-1655.955) (-1654.957) (-1656.654) [-1656.586] * (-1654.484) (-1655.534) (-1655.932) [-1653.642] -- 0:00:27 575000 -- (-1653.651) [-1657.104] (-1654.126) (-1655.428) * (-1653.921) (-1657.323) (-1654.919) [-1655.662] -- 0:00:27 Average standard deviation of split frequencies: 0.007125 575500 -- [-1656.232] (-1655.860) (-1658.718) (-1657.215) * (-1654.302) [-1656.092] (-1654.142) (-1654.852) -- 0:00:27 576000 -- (-1657.292) [-1653.913] (-1662.690) (-1658.106) * [-1653.881] (-1655.692) (-1656.249) (-1658.419) -- 0:00:27 576500 -- [-1657.335] (-1654.779) (-1653.674) (-1654.709) * [-1659.684] (-1655.743) (-1654.253) (-1656.079) -- 0:00:27 577000 -- (-1653.804) [-1654.525] (-1655.503) (-1653.697) * [-1654.301] (-1655.725) (-1656.599) (-1655.973) -- 0:00:27 577500 -- (-1654.587) (-1654.672) (-1654.843) [-1654.475] * (-1654.172) (-1656.813) [-1657.440] (-1655.796) -- 0:00:27 578000 -- (-1655.654) (-1655.473) [-1655.080] (-1653.622) * (-1653.264) (-1655.979) [-1656.386] (-1653.374) -- 0:00:27 578500 -- (-1655.331) (-1659.444) (-1654.168) [-1655.122] * [-1654.826] (-1660.984) (-1654.489) (-1653.789) -- 0:00:26 579000 -- (-1661.546) (-1655.576) [-1655.636] (-1654.964) * [-1657.530] (-1657.751) (-1656.687) (-1655.710) -- 0:00:26 579500 -- (-1656.756) [-1656.043] (-1656.276) (-1654.653) * [-1656.020] (-1657.934) (-1655.310) (-1654.660) -- 0:00:26 580000 -- [-1656.021] (-1655.970) (-1654.404) (-1654.885) * (-1656.931) [-1657.418] (-1654.180) (-1655.084) -- 0:00:26 Average standard deviation of split frequencies: 0.007498 580500 -- (-1659.408) (-1653.617) [-1654.320] (-1657.534) * [-1657.984] (-1656.057) (-1653.747) (-1655.284) -- 0:00:26 581000 -- (-1656.249) (-1653.673) [-1654.482] (-1656.093) * (-1657.984) (-1661.086) (-1654.151) [-1654.779] -- 0:00:26 581500 -- [-1656.985] (-1653.797) (-1655.171) (-1655.356) * (-1653.571) [-1657.945] (-1655.559) (-1657.740) -- 0:00:26 582000 -- (-1656.241) (-1653.962) (-1655.622) [-1654.773] * (-1653.369) (-1655.248) [-1656.549] (-1656.908) -- 0:00:27 582500 -- [-1653.912] (-1654.526) (-1654.485) (-1654.768) * (-1656.548) (-1655.770) [-1654.887] (-1657.828) -- 0:00:27 583000 -- (-1654.501) (-1655.965) [-1654.092] (-1658.278) * (-1655.477) [-1656.268] (-1655.091) (-1660.361) -- 0:00:27 583500 -- [-1655.549] (-1659.020) (-1655.852) (-1654.859) * (-1655.094) (-1654.050) (-1656.317) [-1657.114] -- 0:00:27 584000 -- [-1654.427] (-1655.801) (-1657.550) (-1659.262) * (-1655.720) [-1655.991] (-1655.269) (-1655.575) -- 0:00:27 584500 -- (-1654.492) (-1653.956) [-1655.048] (-1660.945) * [-1655.649] (-1655.615) (-1654.797) (-1653.962) -- 0:00:27 585000 -- [-1657.399] (-1653.826) (-1657.800) (-1658.155) * (-1655.005) (-1655.671) [-1654.589] (-1657.965) -- 0:00:26 Average standard deviation of split frequencies: 0.008376 585500 -- (-1657.060) (-1660.700) [-1658.046] (-1656.929) * (-1656.773) (-1655.671) [-1655.404] (-1658.377) -- 0:00:26 586000 -- (-1653.720) [-1660.526] (-1657.323) (-1659.325) * (-1657.564) (-1655.434) (-1659.838) [-1657.570] -- 0:00:26 586500 -- (-1654.323) (-1655.549) (-1657.773) [-1657.958] * (-1656.320) (-1654.532) (-1657.493) [-1654.214] -- 0:00:26 587000 -- (-1655.293) (-1658.264) (-1657.425) [-1653.518] * (-1653.819) (-1658.657) [-1657.282] (-1654.226) -- 0:00:26 587500 -- (-1659.797) (-1657.508) (-1659.737) [-1657.568] * [-1656.226] (-1655.763) (-1655.895) (-1655.490) -- 0:00:26 588000 -- (-1656.786) (-1655.914) (-1654.870) [-1657.342] * (-1653.980) (-1654.143) [-1653.833] (-1657.047) -- 0:00:26 588500 -- (-1655.000) (-1657.384) (-1653.808) [-1659.302] * (-1654.714) (-1657.991) [-1654.466] (-1656.322) -- 0:00:26 589000 -- (-1657.464) (-1655.401) (-1653.799) [-1656.739] * (-1657.281) [-1654.925] (-1654.465) (-1654.528) -- 0:00:26 589500 -- (-1654.535) (-1655.454) [-1654.312] (-1655.376) * [-1654.124] (-1656.275) (-1653.979) (-1654.500) -- 0:00:26 590000 -- (-1654.208) (-1659.086) [-1654.674] (-1656.018) * (-1654.297) (-1659.227) [-1655.352] (-1653.267) -- 0:00:26 Average standard deviation of split frequencies: 0.008450 590500 -- [-1655.950] (-1654.836) (-1656.039) (-1661.361) * [-1653.456] (-1656.833) (-1654.517) (-1653.241) -- 0:00:26 591000 -- (-1655.988) [-1654.337] (-1658.916) (-1654.530) * [-1654.289] (-1658.219) (-1654.723) (-1654.294) -- 0:00:26 591500 -- (-1654.780) [-1655.424] (-1654.353) (-1655.664) * (-1654.733) [-1654.693] (-1654.573) (-1656.136) -- 0:00:26 592000 -- (-1655.369) [-1656.294] (-1655.418) (-1654.101) * (-1654.549) (-1658.133) (-1654.232) [-1655.223] -- 0:00:26 592500 -- (-1654.138) [-1654.605] (-1656.390) (-1656.571) * (-1658.018) [-1654.983] (-1654.121) (-1654.750) -- 0:00:26 593000 -- [-1653.626] (-1658.561) (-1657.560) (-1658.750) * (-1655.711) (-1653.947) [-1660.357] (-1654.446) -- 0:00:26 593500 -- (-1657.655) (-1657.653) [-1654.751] (-1655.022) * (-1656.108) [-1655.866] (-1660.703) (-1658.960) -- 0:00:26 594000 -- (-1654.992) (-1655.497) (-1655.503) [-1655.727] * (-1655.763) [-1658.098] (-1655.383) (-1653.396) -- 0:00:25 594500 -- (-1663.752) (-1655.958) [-1656.593] (-1657.267) * [-1655.267] (-1656.643) (-1654.356) (-1653.542) -- 0:00:25 595000 -- [-1654.430] (-1657.814) (-1656.173) (-1658.919) * [-1655.986] (-1654.987) (-1654.430) (-1655.869) -- 0:00:25 Average standard deviation of split frequencies: 0.008282 595500 -- [-1655.501] (-1655.923) (-1654.390) (-1656.237) * (-1653.302) (-1654.438) (-1655.298) [-1659.652] -- 0:00:25 596000 -- (-1654.028) (-1658.550) [-1659.453] (-1653.935) * (-1653.640) (-1657.181) [-1654.898] (-1660.490) -- 0:00:25 596500 -- (-1656.107) (-1658.609) (-1658.581) [-1653.851] * (-1657.460) (-1654.620) (-1655.781) [-1658.302] -- 0:00:25 597000 -- (-1653.575) (-1655.445) [-1657.785] (-1656.464) * [-1656.583] (-1655.220) (-1656.523) (-1658.374) -- 0:00:25 597500 -- [-1653.654] (-1655.305) (-1656.023) (-1654.302) * (-1659.561) (-1654.539) [-1656.941] (-1655.517) -- 0:00:26 598000 -- [-1656.039] (-1655.235) (-1656.519) (-1654.859) * (-1657.838) (-1654.930) [-1653.517] (-1655.706) -- 0:00:26 598500 -- (-1660.502) (-1654.304) [-1659.063] (-1654.916) * (-1656.265) (-1655.179) (-1655.251) [-1653.525] -- 0:00:26 599000 -- (-1656.627) (-1654.155) [-1655.596] (-1653.416) * (-1654.513) (-1658.250) (-1655.370) [-1654.672] -- 0:00:26 599500 -- (-1655.438) (-1661.776) (-1656.045) [-1656.729] * [-1655.320] (-1655.472) (-1653.405) (-1653.813) -- 0:00:26 600000 -- (-1655.464) (-1653.777) [-1655.555] (-1655.250) * (-1656.128) [-1658.465] (-1655.096) (-1657.486) -- 0:00:25 Average standard deviation of split frequencies: 0.007617 600500 -- (-1655.137) (-1653.760) [-1656.561] (-1655.296) * (-1654.455) [-1653.986] (-1654.144) (-1653.748) -- 0:00:25 601000 -- (-1654.091) [-1654.526] (-1656.399) (-1654.569) * (-1653.297) [-1656.213] (-1655.836) (-1653.653) -- 0:00:25 601500 -- (-1656.215) (-1658.591) [-1655.872] (-1655.107) * (-1655.766) (-1656.330) (-1654.475) [-1657.498] -- 0:00:25 602000 -- (-1655.164) [-1659.805] (-1655.743) (-1655.230) * (-1655.377) (-1654.608) (-1653.901) [-1655.238] -- 0:00:25 602500 -- (-1655.674) (-1656.735) [-1654.367] (-1655.020) * (-1653.772) (-1656.254) [-1654.698] (-1655.594) -- 0:00:25 603000 -- (-1654.688) (-1655.842) [-1653.944] (-1655.104) * (-1657.545) [-1656.380] (-1656.422) (-1656.251) -- 0:00:25 603500 -- (-1662.963) (-1655.354) [-1654.277] (-1654.633) * (-1657.823) [-1655.995] (-1654.457) (-1658.187) -- 0:00:25 604000 -- [-1653.615] (-1656.357) (-1656.436) (-1657.018) * [-1660.327] (-1653.775) (-1656.328) (-1656.744) -- 0:00:25 604500 -- (-1653.430) (-1657.938) (-1656.193) [-1653.872] * (-1656.797) [-1656.534] (-1656.040) (-1656.966) -- 0:00:25 605000 -- (-1655.384) (-1655.869) [-1655.958] (-1662.477) * (-1653.647) (-1658.694) [-1655.047] (-1659.444) -- 0:00:25 Average standard deviation of split frequencies: 0.007733 605500 -- [-1655.369] (-1654.077) (-1658.596) (-1660.402) * (-1654.204) (-1659.671) (-1654.743) [-1659.938] -- 0:00:25 606000 -- (-1655.779) [-1654.579] (-1658.573) (-1659.356) * (-1654.343) [-1655.506] (-1658.297) (-1654.354) -- 0:00:25 606500 -- (-1655.692) [-1655.755] (-1653.894) (-1656.312) * [-1654.883] (-1656.554) (-1658.086) (-1655.941) -- 0:00:25 607000 -- [-1655.156] (-1657.643) (-1655.245) (-1661.676) * [-1653.994] (-1655.416) (-1655.177) (-1656.848) -- 0:00:25 607500 -- (-1657.344) (-1660.570) (-1654.549) [-1653.637] * (-1655.140) (-1654.033) [-1655.439] (-1657.049) -- 0:00:25 608000 -- (-1655.852) [-1659.072] (-1658.600) (-1655.631) * (-1656.167) [-1656.771] (-1659.475) (-1659.952) -- 0:00:25 608500 -- (-1655.506) (-1657.521) (-1656.116) [-1655.129] * [-1656.411] (-1658.225) (-1654.412) (-1659.018) -- 0:00:25 609000 -- (-1657.127) (-1659.233) [-1656.110] (-1655.934) * (-1654.888) (-1656.249) (-1654.390) [-1655.304] -- 0:00:25 609500 -- (-1656.142) (-1662.140) (-1653.983) [-1657.127] * [-1654.099] (-1660.476) (-1656.791) (-1655.823) -- 0:00:24 610000 -- [-1655.284] (-1657.170) (-1653.444) (-1659.737) * (-1654.455) [-1655.012] (-1654.795) (-1656.004) -- 0:00:24 Average standard deviation of split frequencies: 0.007492 610500 -- [-1654.936] (-1654.946) (-1656.184) (-1654.319) * [-1654.888] (-1655.310) (-1655.835) (-1654.289) -- 0:00:24 611000 -- (-1655.819) (-1657.927) [-1655.029] (-1653.551) * (-1660.185) (-1653.972) (-1655.333) [-1655.304] -- 0:00:24 611500 -- (-1655.850) [-1654.712] (-1654.409) (-1654.245) * (-1660.098) (-1658.540) [-1653.429] (-1654.041) -- 0:00:24 612000 -- (-1653.567) [-1656.344] (-1655.575) (-1654.257) * (-1665.684) (-1654.362) [-1654.269] (-1655.211) -- 0:00:24 612500 -- (-1659.059) (-1657.273) (-1656.561) [-1654.855] * (-1658.687) (-1655.736) [-1654.072] (-1654.352) -- 0:00:24 613000 -- (-1655.240) [-1654.858] (-1655.927) (-1654.511) * (-1654.411) (-1654.899) (-1655.489) [-1654.188] -- 0:00:25 613500 -- [-1654.236] (-1654.038) (-1656.844) (-1656.509) * (-1655.955) [-1654.527] (-1655.446) (-1654.817) -- 0:00:25 614000 -- (-1655.062) [-1653.532] (-1657.043) (-1654.676) * [-1659.140] (-1655.633) (-1655.578) (-1660.430) -- 0:00:25 614500 -- (-1654.363) (-1653.367) [-1658.923] (-1655.642) * [-1654.896] (-1654.356) (-1654.759) (-1655.823) -- 0:00:25 615000 -- (-1654.782) (-1653.393) (-1658.491) [-1655.840] * (-1654.823) (-1657.117) [-1655.181] (-1657.558) -- 0:00:25 Average standard deviation of split frequencies: 0.007383 615500 -- (-1654.460) [-1655.376] (-1653.994) (-1658.144) * (-1654.821) (-1654.876) (-1654.986) [-1655.675] -- 0:00:24 616000 -- (-1658.315) (-1658.924) [-1656.559] (-1654.883) * (-1656.066) (-1654.065) [-1654.432] (-1654.950) -- 0:00:24 616500 -- (-1654.550) [-1655.380] (-1656.374) (-1656.611) * (-1654.435) [-1653.719] (-1655.273) (-1655.414) -- 0:00:24 617000 -- (-1653.397) (-1654.700) [-1654.798] (-1661.339) * [-1655.873] (-1654.754) (-1654.969) (-1656.521) -- 0:00:24 617500 -- (-1653.351) (-1655.790) (-1655.376) [-1654.799] * (-1655.099) (-1655.744) (-1657.906) [-1655.135] -- 0:00:24 618000 -- (-1653.659) [-1659.971] (-1656.553) (-1660.398) * (-1655.973) [-1655.236] (-1660.438) (-1653.418) -- 0:00:24 618500 -- [-1654.716] (-1659.216) (-1657.001) (-1656.335) * (-1659.586) (-1657.355) (-1657.159) [-1654.987] -- 0:00:24 619000 -- (-1655.274) (-1654.056) [-1656.167] (-1655.830) * [-1656.586] (-1658.038) (-1659.782) (-1658.752) -- 0:00:24 619500 -- (-1653.961) (-1654.829) (-1658.409) [-1655.998] * [-1655.033] (-1659.800) (-1658.071) (-1656.137) -- 0:00:24 620000 -- (-1654.594) (-1654.697) (-1655.091) [-1655.848] * [-1663.118] (-1659.000) (-1655.420) (-1657.126) -- 0:00:24 Average standard deviation of split frequencies: 0.007416 620500 -- (-1654.672) (-1657.127) [-1657.413] (-1657.012) * (-1655.963) (-1659.654) [-1655.078] (-1661.263) -- 0:00:24 621000 -- (-1655.147) (-1655.507) [-1657.171] (-1654.870) * (-1659.351) (-1654.136) [-1655.838] (-1656.917) -- 0:00:24 621500 -- (-1653.561) [-1657.927] (-1658.400) (-1653.939) * [-1655.774] (-1657.670) (-1657.327) (-1657.445) -- 0:00:24 622000 -- [-1656.779] (-1654.958) (-1659.274) (-1655.125) * (-1656.445) (-1655.926) (-1658.773) [-1655.545] -- 0:00:24 622500 -- (-1658.378) (-1657.780) [-1655.619] (-1656.111) * (-1654.820) [-1654.071] (-1657.927) (-1654.458) -- 0:00:24 623000 -- (-1654.984) (-1654.959) [-1656.417] (-1657.083) * (-1654.113) [-1656.532] (-1655.361) (-1654.724) -- 0:00:24 623500 -- (-1656.392) [-1656.271] (-1654.715) (-1656.550) * [-1653.386] (-1657.485) (-1653.862) (-1654.760) -- 0:00:24 624000 -- (-1653.882) (-1653.985) [-1654.599] (-1653.985) * (-1654.050) (-1655.220) [-1655.674] (-1656.274) -- 0:00:24 624500 -- [-1654.217] (-1653.552) (-1659.315) (-1656.326) * (-1653.357) [-1654.865] (-1654.774) (-1656.070) -- 0:00:24 625000 -- [-1658.153] (-1654.616) (-1653.641) (-1659.407) * [-1653.393] (-1654.848) (-1654.898) (-1656.237) -- 0:00:24 Average standard deviation of split frequencies: 0.007353 625500 -- [-1655.445] (-1655.074) (-1654.173) (-1656.532) * (-1654.685) [-1653.632] (-1656.598) (-1654.970) -- 0:00:23 626000 -- (-1657.668) (-1655.395) [-1655.645] (-1657.977) * (-1655.265) (-1656.162) [-1654.905] (-1653.989) -- 0:00:23 626500 -- (-1655.083) (-1655.186) [-1654.505] (-1656.205) * (-1657.697) [-1653.570] (-1655.268) (-1657.642) -- 0:00:23 627000 -- [-1655.083] (-1656.264) (-1654.567) (-1655.672) * (-1655.577) (-1654.053) [-1655.676] (-1659.333) -- 0:00:23 627500 -- (-1656.680) [-1653.962] (-1660.314) (-1654.304) * (-1657.533) (-1654.098) [-1658.214] (-1661.031) -- 0:00:23 628000 -- (-1655.699) (-1654.446) (-1655.008) [-1653.775] * [-1654.516] (-1654.098) (-1657.248) (-1658.348) -- 0:00:23 628500 -- (-1655.003) (-1655.230) (-1657.888) [-1656.224] * (-1656.390) (-1655.512) (-1656.009) [-1660.597] -- 0:00:23 629000 -- (-1663.186) (-1655.266) (-1654.329) [-1654.572] * [-1654.434] (-1656.260) (-1654.905) (-1656.353) -- 0:00:24 629500 -- (-1654.923) [-1654.644] (-1654.328) (-1654.680) * [-1655.319] (-1654.823) (-1656.697) (-1656.422) -- 0:00:24 630000 -- (-1655.122) (-1654.343) [-1653.568] (-1655.060) * (-1654.463) [-1656.509] (-1658.237) (-1657.459) -- 0:00:24 Average standard deviation of split frequencies: 0.007211 630500 -- (-1656.814) (-1655.026) (-1653.638) [-1656.606] * (-1654.511) (-1654.107) (-1658.920) [-1655.048] -- 0:00:24 631000 -- (-1657.452) (-1655.800) [-1657.946] (-1657.907) * [-1658.413] (-1655.642) (-1658.699) (-1653.656) -- 0:00:23 631500 -- (-1656.746) (-1659.515) [-1655.925] (-1654.261) * (-1657.692) (-1656.312) (-1655.514) [-1653.954] -- 0:00:23 632000 -- (-1655.056) (-1656.275) (-1656.679) [-1654.476] * (-1655.423) (-1657.857) (-1657.982) [-1654.527] -- 0:00:23 632500 -- (-1654.061) (-1656.226) [-1655.854] (-1661.507) * (-1654.936) [-1654.202] (-1654.567) (-1654.867) -- 0:00:23 633000 -- [-1655.260] (-1656.398) (-1655.593) (-1658.328) * [-1660.734] (-1656.038) (-1654.107) (-1654.871) -- 0:00:23 633500 -- [-1655.505] (-1659.183) (-1654.974) (-1657.119) * (-1657.592) (-1656.186) [-1654.471] (-1655.732) -- 0:00:23 634000 -- [-1653.603] (-1657.049) (-1658.037) (-1655.191) * (-1657.595) [-1656.511] (-1654.159) (-1657.889) -- 0:00:23 634500 -- [-1653.973] (-1656.013) (-1654.982) (-1654.927) * (-1654.585) (-1655.845) (-1653.421) [-1656.127] -- 0:00:23 635000 -- (-1658.614) (-1655.036) [-1653.594] (-1655.118) * (-1654.387) (-1655.544) [-1655.273] (-1655.885) -- 0:00:23 Average standard deviation of split frequencies: 0.007368 635500 -- (-1661.049) (-1655.329) [-1654.552] (-1654.721) * [-1655.513] (-1657.701) (-1656.814) (-1654.403) -- 0:00:23 636000 -- [-1654.698] (-1658.123) (-1654.385) (-1654.113) * (-1655.246) (-1656.216) [-1655.567] (-1655.582) -- 0:00:23 636500 -- (-1660.332) (-1667.146) (-1656.360) [-1655.294] * (-1657.286) (-1657.455) [-1654.344] (-1655.039) -- 0:00:23 637000 -- (-1656.395) (-1658.435) [-1654.143] (-1655.395) * (-1655.677) (-1654.323) (-1655.568) [-1656.732] -- 0:00:23 637500 -- [-1653.544] (-1658.806) (-1655.985) (-1656.423) * (-1656.375) (-1656.614) (-1654.439) [-1663.081] -- 0:00:23 638000 -- (-1653.434) [-1655.003] (-1658.915) (-1656.121) * (-1657.980) (-1654.171) [-1654.344] (-1654.624) -- 0:00:23 638500 -- (-1653.398) [-1654.764] (-1654.890) (-1655.694) * (-1654.558) (-1653.682) [-1655.680] (-1654.828) -- 0:00:23 639000 -- (-1656.557) (-1657.019) (-1655.821) [-1655.100] * (-1659.564) [-1653.925] (-1655.012) (-1654.569) -- 0:00:23 639500 -- [-1654.714] (-1655.385) (-1654.649) (-1656.173) * (-1663.065) (-1654.755) (-1654.426) [-1654.541] -- 0:00:23 640000 -- (-1655.293) [-1660.833] (-1654.383) (-1656.599) * (-1665.104) (-1655.578) [-1655.091] (-1654.600) -- 0:00:23 Average standard deviation of split frequencies: 0.007012 640500 -- (-1661.535) [-1657.617] (-1655.025) (-1663.131) * (-1657.466) [-1656.699] (-1655.885) (-1654.613) -- 0:00:23 641000 -- (-1653.668) (-1657.676) (-1655.353) [-1656.220] * (-1657.395) (-1654.013) [-1655.739] (-1654.725) -- 0:00:22 641500 -- (-1655.148) [-1656.781] (-1654.937) (-1654.782) * (-1655.816) [-1654.760] (-1655.236) (-1656.087) -- 0:00:22 642000 -- (-1654.327) (-1659.156) (-1657.689) [-1654.955] * (-1657.082) (-1657.221) [-1654.762] (-1653.757) -- 0:00:22 642500 -- (-1655.054) (-1658.072) (-1655.772) [-1655.459] * (-1656.972) (-1656.915) (-1654.361) [-1658.236] -- 0:00:22 643000 -- [-1654.126] (-1657.180) (-1655.616) (-1653.827) * (-1655.952) (-1656.164) [-1655.887] (-1655.094) -- 0:00:22 643500 -- (-1657.026) [-1654.885] (-1657.366) (-1658.922) * (-1655.296) (-1654.876) [-1656.811] (-1656.378) -- 0:00:22 644000 -- (-1654.730) (-1653.661) (-1658.614) [-1655.526] * [-1654.728] (-1655.989) (-1653.934) (-1657.937) -- 0:00:22 644500 -- (-1654.405) [-1654.218] (-1657.144) (-1655.340) * (-1655.545) (-1656.586) (-1653.727) [-1653.966] -- 0:00:22 645000 -- (-1653.912) (-1656.040) (-1657.943) [-1653.992] * (-1653.616) [-1655.550] (-1654.819) (-1653.822) -- 0:00:23 Average standard deviation of split frequencies: 0.007388 645500 -- (-1655.946) (-1654.100) (-1654.668) [-1653.662] * (-1656.565) [-1654.853] (-1657.237) (-1657.797) -- 0:00:23 646000 -- [-1654.932] (-1654.066) (-1658.472) (-1655.098) * (-1655.111) (-1658.883) (-1657.854) [-1655.172] -- 0:00:23 646500 -- (-1655.259) [-1653.897] (-1655.660) (-1654.277) * [-1655.672] (-1659.277) (-1654.919) (-1653.840) -- 0:00:22 647000 -- (-1654.741) (-1658.839) [-1654.796] (-1655.187) * (-1656.745) (-1657.878) [-1656.316] (-1656.793) -- 0:00:22 647500 -- (-1654.703) (-1659.068) (-1654.253) [-1654.312] * (-1657.521) (-1657.428) (-1657.381) [-1654.129] -- 0:00:22 648000 -- (-1657.411) [-1654.751] (-1654.733) (-1654.326) * (-1657.182) (-1655.167) (-1661.809) [-1654.715] -- 0:00:22 648500 -- (-1655.481) (-1653.645) (-1654.240) [-1654.292] * (-1657.046) [-1656.220] (-1656.660) (-1654.376) -- 0:00:22 649000 -- (-1655.785) (-1653.915) [-1653.961] (-1655.042) * (-1657.638) [-1656.029] (-1655.617) (-1658.999) -- 0:00:22 649500 -- [-1655.785] (-1654.704) (-1654.355) (-1654.949) * [-1654.537] (-1656.023) (-1659.565) (-1658.907) -- 0:00:22 650000 -- [-1653.793] (-1659.129) (-1656.528) (-1655.157) * (-1655.013) [-1657.466] (-1655.522) (-1657.262) -- 0:00:22 Average standard deviation of split frequencies: 0.007200 650500 -- (-1653.969) (-1657.990) (-1660.830) [-1653.556] * [-1655.622] (-1654.932) (-1656.982) (-1657.329) -- 0:00:22 651000 -- (-1655.635) (-1656.307) (-1663.319) [-1653.595] * (-1655.805) (-1655.388) [-1658.355] (-1657.808) -- 0:00:22 651500 -- (-1654.219) (-1655.116) [-1654.620] (-1655.137) * [-1655.189] (-1656.106) (-1660.499) (-1656.232) -- 0:00:22 652000 -- [-1657.504] (-1654.763) (-1656.597) (-1655.185) * (-1656.928) (-1657.086) [-1659.228] (-1654.570) -- 0:00:22 652500 -- (-1656.425) (-1653.363) [-1659.238] (-1655.503) * (-1658.267) (-1656.059) (-1656.633) [-1654.720] -- 0:00:22 653000 -- (-1656.814) (-1656.076) [-1660.445] (-1654.695) * (-1655.039) (-1658.681) (-1653.391) [-1655.686] -- 0:00:22 653500 -- (-1656.319) [-1654.430] (-1655.354) (-1654.846) * (-1654.568) (-1654.151) (-1653.391) [-1656.404] -- 0:00:22 654000 -- (-1655.114) [-1655.731] (-1653.854) (-1654.779) * [-1654.468] (-1654.015) (-1655.949) (-1656.201) -- 0:00:22 654500 -- (-1655.552) (-1654.694) [-1654.957] (-1654.741) * [-1655.374] (-1653.424) (-1655.378) (-1657.430) -- 0:00:22 655000 -- [-1654.783] (-1656.768) (-1655.452) (-1653.690) * (-1655.565) [-1653.404] (-1653.504) (-1654.434) -- 0:00:22 Average standard deviation of split frequencies: 0.007276 655500 -- [-1658.129] (-1654.570) (-1655.115) (-1653.335) * (-1655.099) (-1653.840) [-1653.713] (-1654.236) -- 0:00:22 656000 -- (-1655.515) (-1656.021) [-1654.009] (-1655.174) * (-1655.248) [-1654.999] (-1655.655) (-1653.786) -- 0:00:22 656500 -- [-1658.000] (-1656.983) (-1654.934) (-1653.452) * (-1653.718) (-1656.918) [-1654.026] (-1653.651) -- 0:00:21 657000 -- (-1654.552) (-1655.638) [-1654.603] (-1654.204) * (-1655.409) [-1655.558] (-1654.653) (-1654.595) -- 0:00:21 657500 -- (-1655.253) (-1659.860) [-1654.503] (-1654.474) * (-1655.664) (-1657.697) [-1654.529] (-1656.922) -- 0:00:21 658000 -- (-1654.964) (-1663.023) [-1654.189] (-1656.082) * [-1656.233] (-1655.959) (-1656.368) (-1656.586) -- 0:00:21 658500 -- [-1653.544] (-1656.379) (-1659.579) (-1658.487) * [-1656.343] (-1653.482) (-1655.919) (-1654.373) -- 0:00:21 659000 -- (-1654.983) (-1657.426) (-1656.134) [-1655.641] * (-1655.314) (-1653.365) [-1654.678] (-1654.513) -- 0:00:21 659500 -- [-1657.096] (-1654.288) (-1654.006) (-1656.513) * [-1655.431] (-1657.540) (-1655.701) (-1654.767) -- 0:00:21 660000 -- (-1657.636) [-1653.900] (-1653.940) (-1656.873) * (-1654.688) (-1654.511) (-1655.080) [-1656.357] -- 0:00:21 Average standard deviation of split frequencies: 0.006422 660500 -- [-1658.258] (-1656.261) (-1656.315) (-1656.020) * [-1654.037] (-1653.929) (-1654.649) (-1655.738) -- 0:00:22 661000 -- (-1657.961) (-1656.574) [-1654.479] (-1655.780) * [-1654.622] (-1655.596) (-1655.457) (-1656.168) -- 0:00:22 661500 -- [-1660.537] (-1656.342) (-1654.574) (-1657.438) * (-1654.637) [-1655.596] (-1654.733) (-1654.040) -- 0:00:22 662000 -- [-1656.864] (-1655.620) (-1655.281) (-1657.441) * (-1654.272) (-1656.586) (-1655.409) [-1654.083] -- 0:00:21 662500 -- (-1656.410) (-1658.223) (-1659.003) [-1655.500] * [-1654.209] (-1654.497) (-1654.366) (-1655.603) -- 0:00:21 663000 -- (-1655.015) [-1656.962] (-1655.473) (-1655.032) * (-1657.957) [-1655.423] (-1654.566) (-1655.143) -- 0:00:21 663500 -- (-1655.727) (-1657.688) (-1655.390) [-1653.510] * [-1658.121] (-1653.581) (-1658.261) (-1655.780) -- 0:00:21 664000 -- [-1654.743] (-1654.418) (-1658.353) (-1658.917) * [-1654.887] (-1654.344) (-1655.703) (-1654.443) -- 0:00:21 664500 -- [-1655.756] (-1655.963) (-1660.339) (-1659.576) * (-1655.488) (-1655.120) [-1655.135] (-1654.268) -- 0:00:21 665000 -- (-1655.871) (-1655.172) (-1656.216) [-1653.947] * (-1655.988) (-1655.190) [-1653.720] (-1654.207) -- 0:00:21 Average standard deviation of split frequencies: 0.006592 665500 -- (-1655.109) (-1654.635) [-1653.548] (-1657.499) * (-1654.766) (-1653.327) (-1653.728) [-1654.207] -- 0:00:21 666000 -- (-1655.373) (-1660.177) (-1655.638) [-1654.047] * (-1653.674) [-1654.149] (-1653.702) (-1653.745) -- 0:00:21 666500 -- (-1655.754) [-1657.511] (-1654.913) (-1654.401) * [-1657.745] (-1653.676) (-1653.684) (-1656.486) -- 0:00:21 667000 -- [-1655.734] (-1653.967) (-1656.454) (-1654.395) * (-1656.079) (-1655.581) [-1658.185] (-1654.379) -- 0:00:21 667500 -- (-1654.194) [-1655.281] (-1655.990) (-1653.813) * [-1654.579] (-1654.853) (-1656.006) (-1654.624) -- 0:00:21 668000 -- (-1653.919) (-1653.750) [-1656.351] (-1656.312) * (-1658.684) [-1656.239] (-1659.078) (-1653.785) -- 0:00:21 668500 -- (-1658.298) (-1657.681) (-1656.344) [-1655.009] * (-1656.663) (-1658.767) [-1655.894] (-1658.398) -- 0:00:21 669000 -- (-1657.975) [-1656.212] (-1659.054) (-1654.119) * (-1657.537) (-1656.009) (-1653.780) [-1654.560] -- 0:00:21 669500 -- (-1655.061) (-1655.034) (-1658.198) [-1655.234] * (-1657.435) (-1656.754) (-1655.189) [-1656.914] -- 0:00:21 670000 -- (-1657.231) [-1655.629] (-1656.229) (-1655.449) * (-1656.369) (-1655.805) (-1659.144) [-1656.399] -- 0:00:21 Average standard deviation of split frequencies: 0.006546 670500 -- [-1657.910] (-1654.599) (-1657.210) (-1657.971) * [-1656.449] (-1656.337) (-1655.761) (-1655.122) -- 0:00:21 671000 -- [-1655.342] (-1657.084) (-1658.197) (-1658.056) * [-1654.352] (-1656.765) (-1655.038) (-1654.823) -- 0:00:21 671500 -- (-1654.781) [-1656.389] (-1658.056) (-1656.198) * (-1655.861) (-1656.188) (-1654.917) [-1656.923] -- 0:00:21 672000 -- (-1654.470) (-1656.064) (-1659.684) [-1656.326] * (-1655.734) (-1658.094) (-1655.043) [-1654.645] -- 0:00:20 672500 -- (-1654.470) [-1657.168] (-1657.653) (-1656.412) * (-1654.478) (-1656.727) (-1653.826) [-1655.441] -- 0:00:20 673000 -- (-1654.470) (-1658.400) (-1654.923) [-1655.734] * (-1654.853) (-1662.854) [-1660.023] (-1657.227) -- 0:00:20 673500 -- (-1656.759) (-1656.436) (-1654.999) [-1657.171] * (-1657.200) [-1655.227] (-1654.729) (-1659.255) -- 0:00:20 674000 -- (-1658.967) [-1656.784] (-1656.651) (-1656.857) * (-1653.943) (-1655.652) (-1654.422) [-1658.062] -- 0:00:20 674500 -- (-1657.398) (-1659.172) [-1656.056] (-1655.667) * (-1653.752) (-1655.320) [-1654.501] (-1658.492) -- 0:00:20 675000 -- (-1657.159) [-1656.139] (-1661.626) (-1654.419) * (-1655.150) (-1656.182) [-1654.638] (-1656.611) -- 0:00:20 Average standard deviation of split frequencies: 0.006712 675500 -- (-1655.097) [-1654.275] (-1654.382) (-1654.299) * (-1654.316) (-1664.497) [-1662.111] (-1655.955) -- 0:00:20 676000 -- (-1659.980) (-1654.556) [-1654.338] (-1653.704) * (-1656.718) [-1657.528] (-1658.854) (-1658.467) -- 0:00:20 676500 -- [-1655.872] (-1654.656) (-1655.236) (-1654.429) * (-1655.405) (-1654.352) (-1658.336) [-1656.182] -- 0:00:21 677000 -- (-1654.917) (-1657.921) (-1655.757) [-1655.017] * (-1655.063) (-1656.360) (-1654.956) [-1656.330] -- 0:00:20 677500 -- [-1658.776] (-1654.209) (-1655.596) (-1655.616) * (-1656.323) (-1653.762) (-1657.051) [-1654.140] -- 0:00:20 678000 -- (-1654.873) (-1655.909) (-1655.672) [-1654.500] * [-1658.536] (-1654.109) (-1656.026) (-1656.331) -- 0:00:20 678500 -- [-1654.741] (-1653.655) (-1656.895) (-1653.878) * (-1658.437) (-1656.227) [-1654.099] (-1657.124) -- 0:00:20 679000 -- (-1656.156) (-1657.873) (-1655.754) [-1653.870] * (-1655.666) (-1654.778) (-1654.261) [-1658.488] -- 0:00:20 679500 -- (-1658.121) (-1660.028) [-1655.973] (-1654.874) * (-1655.325) (-1658.354) [-1654.614] (-1656.685) -- 0:00:20 680000 -- [-1655.426] (-1655.109) (-1655.895) (-1656.479) * [-1659.158] (-1654.952) (-1653.771) (-1661.124) -- 0:00:20 Average standard deviation of split frequencies: 0.006493 680500 -- (-1658.925) (-1655.557) (-1654.550) [-1655.141] * (-1653.774) (-1654.360) [-1654.539] (-1660.454) -- 0:00:20 681000 -- (-1657.969) [-1653.785] (-1654.116) (-1656.833) * (-1654.577) (-1656.879) (-1657.400) [-1655.985] -- 0:00:20 681500 -- (-1658.995) (-1653.783) [-1656.225] (-1654.906) * (-1653.756) (-1654.792) [-1656.444] (-1654.907) -- 0:00:20 682000 -- (-1655.161) [-1653.957] (-1656.610) (-1654.054) * [-1653.269] (-1654.396) (-1654.679) (-1655.345) -- 0:00:20 682500 -- (-1654.236) (-1658.091) [-1654.439] (-1654.955) * (-1653.510) (-1656.622) [-1655.702] (-1657.227) -- 0:00:20 683000 -- (-1655.199) (-1656.978) [-1655.279] (-1655.556) * (-1653.536) (-1654.652) (-1656.002) [-1653.885] -- 0:00:20 683500 -- (-1655.136) (-1655.581) [-1658.863] (-1654.137) * [-1654.142] (-1654.099) (-1654.906) (-1654.279) -- 0:00:20 684000 -- [-1656.973] (-1655.481) (-1663.843) (-1655.380) * [-1653.967] (-1658.532) (-1657.505) (-1653.336) -- 0:00:20 684500 -- (-1656.768) [-1654.968] (-1660.401) (-1654.539) * (-1655.451) (-1654.593) (-1658.331) [-1653.768] -- 0:00:20 685000 -- (-1654.831) [-1654.482] (-1654.389) (-1656.982) * (-1657.148) [-1655.519] (-1655.679) (-1653.811) -- 0:00:20 Average standard deviation of split frequencies: 0.006614 685500 -- (-1653.670) (-1655.263) [-1655.340] (-1655.198) * [-1657.418] (-1655.096) (-1656.034) (-1657.993) -- 0:00:20 686000 -- (-1654.149) (-1653.813) [-1656.848] (-1656.887) * (-1660.092) [-1657.314] (-1655.109) (-1654.807) -- 0:00:20 686500 -- (-1653.722) (-1653.750) [-1656.724] (-1656.229) * (-1657.180) [-1654.066] (-1655.116) (-1654.712) -- 0:00:20 687000 -- (-1653.601) (-1653.660) (-1657.860) [-1655.233] * (-1655.836) [-1653.714] (-1655.422) (-1659.390) -- 0:00:20 687500 -- [-1654.300] (-1655.903) (-1655.765) (-1653.584) * (-1655.017) (-1655.300) (-1653.832) [-1653.632] -- 0:00:20 688000 -- [-1654.390] (-1654.066) (-1655.662) (-1657.775) * (-1657.211) [-1657.262] (-1654.120) (-1653.794) -- 0:00:19 688500 -- (-1654.669) [-1654.597] (-1654.102) (-1654.234) * [-1656.586] (-1657.950) (-1658.476) (-1654.129) -- 0:00:19 689000 -- (-1655.031) (-1655.068) (-1655.366) [-1654.405] * (-1656.684) (-1657.411) [-1656.492] (-1655.576) -- 0:00:19 689500 -- [-1658.326] (-1655.179) (-1661.016) (-1654.788) * (-1657.667) (-1655.847) (-1655.773) [-1654.016] -- 0:00:19 690000 -- (-1655.247) (-1655.620) (-1655.218) [-1654.976] * [-1654.947] (-1656.781) (-1658.576) (-1654.647) -- 0:00:19 Average standard deviation of split frequencies: 0.006953 690500 -- (-1656.246) [-1658.097] (-1653.755) (-1655.520) * [-1656.951] (-1654.689) (-1654.586) (-1654.326) -- 0:00:19 691000 -- [-1656.154] (-1656.001) (-1655.194) (-1656.883) * [-1654.588] (-1653.729) (-1656.453) (-1654.483) -- 0:00:19 691500 -- (-1656.565) (-1656.465) [-1654.517] (-1658.353) * (-1655.474) [-1653.717] (-1663.738) (-1654.601) -- 0:00:19 692000 -- [-1659.315] (-1656.033) (-1662.025) (-1659.683) * (-1656.169) [-1654.726] (-1655.137) (-1656.086) -- 0:00:19 692500 -- (-1658.896) (-1653.957) (-1658.959) [-1654.325] * (-1653.829) (-1654.776) [-1658.402] (-1656.084) -- 0:00:19 693000 -- (-1659.670) [-1655.831] (-1657.952) (-1654.869) * [-1658.396] (-1653.972) (-1653.867) (-1655.025) -- 0:00:19 693500 -- (-1654.259) [-1653.862] (-1654.407) (-1655.346) * [-1656.721] (-1654.100) (-1654.455) (-1661.206) -- 0:00:19 694000 -- (-1654.840) (-1659.565) (-1655.459) [-1655.227] * (-1656.841) (-1658.037) [-1654.918] (-1661.104) -- 0:00:19 694500 -- [-1655.180] (-1656.118) (-1656.239) (-1657.261) * (-1654.905) (-1655.335) [-1654.718] (-1657.759) -- 0:00:19 695000 -- (-1659.696) (-1660.763) [-1656.104] (-1654.926) * (-1655.171) (-1655.905) [-1655.914] (-1655.362) -- 0:00:19 Average standard deviation of split frequencies: 0.006815 695500 -- [-1654.783] (-1659.993) (-1654.732) (-1656.787) * (-1656.100) (-1654.818) [-1655.399] (-1655.920) -- 0:00:19 696000 -- [-1654.806] (-1655.701) (-1655.683) (-1654.756) * [-1656.310] (-1656.097) (-1655.423) (-1655.534) -- 0:00:19 696500 -- (-1661.767) (-1654.988) [-1657.534] (-1653.434) * [-1654.931] (-1657.598) (-1657.464) (-1655.264) -- 0:00:19 697000 -- (-1657.889) [-1654.385] (-1657.156) (-1659.234) * (-1654.371) (-1656.056) (-1655.417) [-1656.123] -- 0:00:19 697500 -- (-1656.720) (-1656.068) [-1656.435] (-1655.156) * [-1655.638] (-1654.429) (-1655.622) (-1655.228) -- 0:00:19 698000 -- [-1653.762] (-1654.980) (-1655.371) (-1654.026) * (-1656.198) (-1655.734) (-1655.638) [-1657.240] -- 0:00:19 698500 -- (-1662.127) (-1657.467) [-1658.225] (-1657.801) * (-1655.489) [-1656.429] (-1657.100) (-1653.887) -- 0:00:19 699000 -- (-1662.851) (-1654.706) (-1655.821) [-1657.455] * (-1655.872) (-1655.076) [-1655.463] (-1654.709) -- 0:00:19 699500 -- (-1657.165) [-1661.083] (-1660.238) (-1656.078) * [-1655.749] (-1655.915) (-1655.887) (-1655.334) -- 0:00:19 700000 -- [-1654.243] (-1654.491) (-1656.869) (-1655.382) * (-1654.943) (-1655.253) [-1655.277] (-1657.244) -- 0:00:19 Average standard deviation of split frequencies: 0.007359 700500 -- [-1655.384] (-1657.305) (-1655.492) (-1656.289) * (-1657.454) [-1654.364] (-1657.384) (-1657.829) -- 0:00:19 701000 -- (-1653.537) (-1655.387) (-1654.546) [-1653.523] * (-1654.916) [-1655.641] (-1656.431) (-1656.852) -- 0:00:19 701500 -- (-1656.303) (-1655.624) [-1656.830] (-1653.866) * [-1656.080] (-1657.068) (-1658.924) (-1656.073) -- 0:00:19 702000 -- (-1654.637) [-1654.721] (-1654.260) (-1657.784) * (-1656.164) [-1657.343] (-1655.672) (-1655.660) -- 0:00:19 702500 -- [-1654.445] (-1653.815) (-1655.308) (-1656.414) * [-1655.611] (-1655.272) (-1654.384) (-1654.179) -- 0:00:19 703000 -- [-1655.858] (-1653.743) (-1655.945) (-1655.663) * (-1655.542) (-1655.984) [-1655.839] (-1656.156) -- 0:00:19 703500 -- (-1657.659) (-1654.245) (-1654.490) [-1654.314] * (-1655.529) (-1653.958) [-1655.840] (-1654.545) -- 0:00:18 704000 -- (-1659.419) (-1653.653) [-1654.536] (-1659.340) * (-1656.949) (-1654.348) (-1653.639) [-1655.263] -- 0:00:18 704500 -- (-1655.557) (-1655.084) (-1655.614) [-1655.188] * (-1655.709) [-1654.193] (-1654.608) (-1655.494) -- 0:00:18 705000 -- [-1655.388] (-1655.311) (-1654.917) (-1656.125) * (-1655.372) (-1654.979) [-1655.984] (-1656.603) -- 0:00:18 Average standard deviation of split frequencies: 0.007595 705500 -- (-1658.915) [-1654.502] (-1656.929) (-1654.105) * (-1655.032) [-1656.705] (-1656.470) (-1658.255) -- 0:00:18 706000 -- (-1658.745) (-1655.186) [-1654.008] (-1654.701) * [-1655.042] (-1653.550) (-1656.824) (-1658.148) -- 0:00:18 706500 -- (-1656.724) (-1655.334) (-1655.613) [-1654.191] * (-1655.350) (-1659.432) (-1655.487) [-1659.243] -- 0:00:18 707000 -- [-1653.535] (-1656.001) (-1654.345) (-1653.757) * (-1654.041) [-1656.794] (-1655.901) (-1655.684) -- 0:00:18 707500 -- (-1654.860) [-1656.305] (-1657.257) (-1653.949) * [-1653.715] (-1654.775) (-1654.980) (-1654.847) -- 0:00:18 708000 -- [-1655.016] (-1656.841) (-1653.607) (-1653.948) * (-1654.911) (-1653.756) [-1655.154] (-1654.370) -- 0:00:18 708500 -- (-1655.877) [-1658.931] (-1654.518) (-1659.116) * (-1653.741) [-1654.445] (-1654.984) (-1654.249) -- 0:00:18 709000 -- (-1656.540) [-1662.252] (-1654.827) (-1658.028) * (-1654.610) [-1655.846] (-1656.796) (-1655.517) -- 0:00:18 709500 -- (-1657.668) (-1658.670) [-1654.779] (-1654.002) * (-1659.786) (-1656.349) (-1658.882) [-1657.728] -- 0:00:18 710000 -- (-1655.053) [-1656.991] (-1660.033) (-1655.505) * (-1657.262) (-1657.184) (-1655.511) [-1654.959] -- 0:00:18 Average standard deviation of split frequencies: 0.007214 710500 -- (-1658.034) (-1657.279) (-1653.441) [-1656.800] * [-1655.926] (-1656.657) (-1655.475) (-1654.308) -- 0:00:18 711000 -- (-1655.185) [-1655.510] (-1654.700) (-1655.928) * [-1658.189] (-1655.989) (-1653.990) (-1655.597) -- 0:00:18 711500 -- (-1655.124) (-1653.981) [-1658.129] (-1656.036) * (-1656.267) [-1655.070] (-1655.078) (-1655.490) -- 0:00:18 712000 -- (-1655.118) [-1655.416] (-1657.339) (-1654.810) * (-1655.203) (-1654.719) [-1656.004] (-1655.615) -- 0:00:18 712500 -- (-1655.285) [-1656.582] (-1657.283) (-1655.697) * (-1658.769) (-1658.577) [-1658.240] (-1656.130) -- 0:00:18 713000 -- (-1655.900) [-1657.279] (-1655.270) (-1656.607) * [-1658.011] (-1658.921) (-1657.631) (-1657.064) -- 0:00:18 713500 -- (-1654.648) (-1654.892) (-1657.403) [-1658.367] * (-1660.912) [-1660.049] (-1657.082) (-1653.912) -- 0:00:18 714000 -- [-1653.993] (-1655.073) (-1663.971) (-1656.170) * (-1657.557) (-1658.995) [-1654.494] (-1654.515) -- 0:00:18 714500 -- [-1656.213] (-1654.324) (-1663.570) (-1656.320) * (-1656.498) (-1655.377) [-1654.013] (-1654.754) -- 0:00:18 715000 -- (-1660.084) [-1658.997] (-1655.545) (-1653.259) * (-1657.279) [-1660.875] (-1656.806) (-1661.415) -- 0:00:18 Average standard deviation of split frequencies: 0.007407 715500 -- (-1655.466) (-1654.133) (-1655.347) [-1653.500] * (-1658.116) (-1657.215) [-1655.759] (-1655.084) -- 0:00:18 716000 -- (-1656.149) (-1655.526) [-1654.504] (-1654.336) * (-1658.402) (-1657.122) (-1654.048) [-1653.381] -- 0:00:18 716500 -- [-1655.985] (-1656.937) (-1656.228) (-1654.676) * (-1658.061) (-1655.848) (-1657.498) [-1653.387] -- 0:00:18 717000 -- (-1655.545) [-1655.106] (-1655.587) (-1655.787) * (-1658.169) [-1654.019] (-1656.260) (-1654.625) -- 0:00:18 717500 -- (-1653.502) [-1654.426] (-1656.642) (-1656.625) * (-1656.001) (-1657.851) (-1655.888) [-1654.367] -- 0:00:18 718000 -- (-1655.183) (-1654.429) [-1656.710] (-1654.377) * (-1658.203) (-1655.717) [-1654.544] (-1658.080) -- 0:00:18 718500 -- (-1654.886) (-1654.233) [-1656.957] (-1654.378) * [-1655.085] (-1653.946) (-1655.083) (-1655.508) -- 0:00:18 719000 -- (-1653.348) (-1654.564) [-1656.633] (-1655.417) * [-1654.755] (-1653.297) (-1656.121) (-1655.444) -- 0:00:17 719500 -- (-1654.761) [-1657.259] (-1655.850) (-1658.846) * (-1654.583) (-1655.573) (-1654.828) [-1655.303] -- 0:00:17 720000 -- [-1653.776] (-1659.491) (-1654.943) (-1654.253) * (-1654.370) (-1654.068) (-1656.245) [-1657.316] -- 0:00:17 Average standard deviation of split frequencies: 0.007154 720500 -- (-1656.053) (-1661.498) [-1655.105] (-1656.057) * [-1653.983] (-1653.569) (-1662.989) (-1655.733) -- 0:00:17 721000 -- [-1655.156] (-1661.381) (-1653.484) (-1654.191) * (-1660.176) (-1655.014) (-1658.916) [-1655.050] -- 0:00:17 721500 -- (-1656.616) [-1654.964] (-1657.118) (-1654.486) * (-1656.231) [-1656.766] (-1655.686) (-1657.555) -- 0:00:17 722000 -- (-1655.149) (-1654.650) [-1653.992] (-1656.664) * (-1655.374) (-1655.735) (-1658.214) [-1656.001] -- 0:00:17 722500 -- (-1654.409) (-1654.780) (-1654.159) [-1656.067] * [-1657.372] (-1659.695) (-1654.921) (-1654.391) -- 0:00:17 723000 -- (-1657.045) (-1655.168) (-1656.823) [-1655.700] * (-1656.218) [-1656.020] (-1657.286) (-1654.309) -- 0:00:17 723500 -- (-1656.705) (-1655.247) (-1653.950) [-1654.585] * (-1656.615) (-1656.653) (-1654.324) [-1654.254] -- 0:00:17 724000 -- (-1656.055) (-1655.163) (-1657.745) [-1655.072] * [-1655.767] (-1656.892) (-1658.371) (-1659.914) -- 0:00:17 724500 -- (-1655.414) (-1657.989) (-1654.191) [-1654.794] * (-1655.425) (-1658.408) [-1654.102] (-1656.272) -- 0:00:17 725000 -- [-1654.312] (-1657.560) (-1654.647) (-1658.689) * (-1655.813) (-1660.209) (-1655.723) [-1660.280] -- 0:00:17 Average standard deviation of split frequencies: 0.006899 725500 -- [-1653.554] (-1654.500) (-1656.285) (-1656.621) * (-1655.376) [-1654.472] (-1661.734) (-1658.359) -- 0:00:17 726000 -- [-1655.301] (-1658.316) (-1654.961) (-1661.494) * [-1656.963] (-1654.347) (-1656.731) (-1655.023) -- 0:00:17 726500 -- (-1657.760) [-1655.020] (-1658.790) (-1655.449) * (-1654.487) [-1655.513] (-1657.396) (-1654.746) -- 0:00:17 727000 -- (-1655.053) (-1655.079) [-1654.737] (-1655.170) * [-1655.966] (-1653.894) (-1657.742) (-1654.559) -- 0:00:17 727500 -- (-1654.882) (-1655.775) (-1658.719) [-1655.037] * (-1654.754) [-1653.701] (-1661.087) (-1654.321) -- 0:00:17 728000 -- (-1656.990) [-1657.731] (-1655.285) (-1657.980) * (-1654.502) (-1655.431) [-1656.213] (-1654.791) -- 0:00:17 728500 -- (-1656.236) [-1654.898] (-1654.351) (-1657.107) * (-1655.015) (-1656.488) [-1654.159] (-1657.038) -- 0:00:17 729000 -- (-1656.878) [-1656.513] (-1654.031) (-1659.269) * (-1653.968) (-1657.463) (-1655.805) [-1655.820] -- 0:00:17 729500 -- (-1655.375) (-1654.316) [-1653.871] (-1657.609) * [-1656.174] (-1654.461) (-1662.506) (-1655.101) -- 0:00:17 730000 -- (-1655.154) [-1653.527] (-1654.211) (-1654.190) * (-1657.097) [-1657.539] (-1653.945) (-1658.881) -- 0:00:17 Average standard deviation of split frequencies: 0.007249 730500 -- (-1655.268) (-1654.354) [-1655.248] (-1655.277) * (-1656.586) [-1656.867] (-1655.859) (-1657.258) -- 0:00:17 731000 -- (-1656.394) [-1656.508] (-1659.620) (-1659.165) * (-1653.859) (-1655.146) [-1656.376] (-1656.464) -- 0:00:17 731500 -- (-1655.121) [-1654.072] (-1658.182) (-1654.831) * (-1657.619) (-1655.966) (-1653.692) [-1655.803] -- 0:00:17 732000 -- (-1655.686) (-1654.342) (-1656.170) [-1654.298] * (-1658.929) (-1654.079) [-1653.740] (-1658.388) -- 0:00:17 732500 -- (-1654.524) [-1656.777] (-1655.787) (-1654.221) * (-1654.640) [-1656.920] (-1656.449) (-1660.457) -- 0:00:17 733000 -- (-1655.631) (-1655.695) (-1656.755) [-1655.487] * (-1655.706) (-1653.307) (-1657.369) [-1654.515] -- 0:00:17 733500 -- (-1655.685) (-1653.686) [-1654.820] (-1654.102) * (-1656.476) [-1653.393] (-1663.485) (-1655.138) -- 0:00:17 734000 -- (-1655.490) (-1653.995) [-1654.236] (-1656.834) * (-1657.280) (-1653.449) [-1659.419] (-1655.660) -- 0:00:17 734500 -- (-1655.951) (-1659.099) (-1654.724) [-1654.068] * (-1655.204) (-1657.332) (-1659.112) [-1659.543] -- 0:00:16 735000 -- [-1657.936] (-1656.325) (-1655.824) (-1654.478) * [-1657.876] (-1655.342) (-1656.121) (-1657.855) -- 0:00:16 Average standard deviation of split frequencies: 0.007724 735500 -- (-1658.564) [-1655.094] (-1656.867) (-1656.764) * (-1660.668) (-1656.613) (-1657.867) [-1655.888] -- 0:00:16 736000 -- (-1656.363) (-1655.546) (-1656.096) [-1658.282] * (-1657.557) (-1655.515) (-1657.721) [-1655.214] -- 0:00:16 736500 -- (-1657.064) (-1657.812) [-1659.886] (-1653.987) * (-1657.662) [-1655.150] (-1654.148) (-1655.430) -- 0:00:16 737000 -- [-1656.618] (-1658.862) (-1658.646) (-1653.308) * (-1653.422) (-1654.995) [-1654.001] (-1654.742) -- 0:00:16 737500 -- (-1657.313) (-1656.502) (-1656.039) [-1654.998] * (-1655.251) (-1653.568) (-1658.011) [-1656.279] -- 0:00:16 738000 -- (-1657.131) (-1654.381) [-1656.281] (-1658.293) * (-1653.824) [-1656.405] (-1654.492) (-1654.793) -- 0:00:16 738500 -- (-1654.014) (-1654.679) (-1656.265) [-1654.597] * (-1653.679) (-1654.921) [-1655.608] (-1654.741) -- 0:00:16 739000 -- [-1655.975] (-1653.464) (-1655.806) (-1656.448) * (-1656.549) (-1654.145) [-1656.010] (-1657.551) -- 0:00:16 739500 -- (-1662.206) (-1654.605) [-1654.848] (-1655.143) * [-1657.899] (-1654.325) (-1655.306) (-1656.688) -- 0:00:16 740000 -- (-1660.563) (-1655.203) [-1653.873] (-1654.952) * (-1658.201) (-1654.340) [-1656.691] (-1657.165) -- 0:00:16 Average standard deviation of split frequencies: 0.007825 740500 -- [-1657.236] (-1656.034) (-1656.327) (-1658.209) * (-1661.138) (-1653.572) [-1655.098] (-1656.272) -- 0:00:16 741000 -- (-1657.243) [-1655.531] (-1657.567) (-1654.636) * (-1657.269) [-1653.653] (-1656.226) (-1656.243) -- 0:00:16 741500 -- [-1655.552] (-1655.637) (-1656.433) (-1653.992) * (-1656.093) [-1653.250] (-1654.809) (-1654.082) -- 0:00:16 742000 -- (-1654.410) (-1657.699) [-1655.154] (-1656.056) * (-1654.214) [-1653.703] (-1655.287) (-1655.423) -- 0:00:16 742500 -- [-1654.663] (-1656.679) (-1654.794) (-1654.004) * (-1654.016) [-1654.923] (-1654.118) (-1656.640) -- 0:00:16 743000 -- (-1657.512) (-1655.258) [-1657.875] (-1654.409) * [-1655.035] (-1657.284) (-1655.239) (-1656.785) -- 0:00:16 743500 -- [-1656.642] (-1655.958) (-1654.190) (-1655.912) * (-1656.533) [-1656.498] (-1654.853) (-1664.186) -- 0:00:16 744000 -- [-1654.395] (-1656.731) (-1656.187) (-1654.229) * (-1655.765) [-1657.018] (-1655.252) (-1657.317) -- 0:00:16 744500 -- [-1655.814] (-1654.024) (-1654.611) (-1655.880) * [-1653.609] (-1655.787) (-1654.294) (-1656.675) -- 0:00:16 745000 -- (-1655.827) (-1654.581) (-1657.169) [-1653.487] * (-1656.625) (-1656.417) [-1653.839] (-1654.301) -- 0:00:16 Average standard deviation of split frequencies: 0.008140 745500 -- (-1654.228) (-1654.521) [-1654.418] (-1653.640) * (-1653.339) [-1656.895] (-1656.494) (-1654.110) -- 0:00:16 746000 -- (-1660.699) (-1663.041) (-1656.190) [-1654.509] * (-1654.512) (-1655.393) (-1655.098) [-1654.567] -- 0:00:16 746500 -- (-1662.362) (-1661.899) (-1658.343) [-1656.876] * (-1654.396) (-1654.183) [-1654.637] (-1654.102) -- 0:00:16 747000 -- (-1656.487) (-1658.328) (-1657.422) [-1659.523] * (-1653.564) (-1654.562) [-1654.347] (-1657.224) -- 0:00:16 747500 -- (-1655.113) (-1658.263) (-1659.152) [-1655.871] * (-1653.544) (-1654.749) [-1658.189] (-1657.859) -- 0:00:16 748000 -- (-1655.107) (-1654.130) [-1659.222] (-1654.538) * [-1654.311] (-1654.267) (-1654.305) (-1654.867) -- 0:00:16 748500 -- (-1658.921) (-1656.265) (-1656.999) [-1654.775] * (-1654.588) [-1655.227] (-1656.951) (-1654.636) -- 0:00:16 749000 -- [-1655.903] (-1656.891) (-1655.519) (-1654.705) * (-1655.909) (-1658.071) [-1656.557] (-1660.727) -- 0:00:16 749500 -- [-1659.174] (-1658.384) (-1656.787) (-1655.214) * [-1655.183] (-1655.589) (-1654.275) (-1658.997) -- 0:00:16 750000 -- [-1658.494] (-1659.911) (-1656.343) (-1657.207) * (-1657.816) [-1655.089] (-1654.239) (-1657.129) -- 0:00:16 Average standard deviation of split frequencies: 0.008127 750500 -- (-1659.755) [-1654.406] (-1657.311) (-1656.565) * [-1653.366] (-1661.075) (-1654.318) (-1655.219) -- 0:00:15 751000 -- (-1661.669) (-1654.897) [-1659.131] (-1656.736) * (-1657.499) (-1659.439) (-1654.595) [-1654.169] -- 0:00:15 751500 -- [-1654.640] (-1654.085) (-1660.452) (-1653.466) * [-1655.529] (-1657.436) (-1654.531) (-1656.887) -- 0:00:15 752000 -- (-1657.622) (-1654.762) (-1657.004) [-1653.830] * (-1658.848) (-1653.797) [-1655.445] (-1657.474) -- 0:00:15 752500 -- (-1655.542) (-1655.752) [-1655.667] (-1654.952) * (-1657.365) (-1655.960) (-1656.314) [-1658.011] -- 0:00:15 753000 -- [-1656.840] (-1655.884) (-1654.534) (-1655.780) * [-1656.013] (-1655.499) (-1656.743) (-1654.416) -- 0:00:15 753500 -- (-1656.950) [-1656.901] (-1655.204) (-1656.924) * [-1653.319] (-1657.559) (-1655.908) (-1654.109) -- 0:00:15 754000 -- (-1660.752) (-1654.770) [-1657.389] (-1655.128) * [-1654.239] (-1660.169) (-1654.089) (-1655.713) -- 0:00:15 754500 -- (-1659.993) (-1656.883) (-1660.667) [-1655.497] * (-1653.994) (-1662.946) (-1655.232) [-1654.694] -- 0:00:15 755000 -- [-1656.302] (-1656.671) (-1657.538) (-1654.110) * (-1655.542) (-1655.391) [-1654.540] (-1656.260) -- 0:00:15 Average standard deviation of split frequencies: 0.007923 755500 -- (-1655.939) [-1656.307] (-1659.202) (-1656.011) * (-1656.413) (-1657.510) (-1655.866) [-1655.745] -- 0:00:15 756000 -- [-1656.329] (-1655.731) (-1657.964) (-1658.711) * (-1654.385) (-1653.743) [-1653.690] (-1656.839) -- 0:00:15 756500 -- (-1654.778) [-1655.526] (-1654.698) (-1656.575) * (-1655.799) (-1653.856) (-1655.610) [-1656.858] -- 0:00:15 757000 -- [-1655.410] (-1655.876) (-1656.416) (-1653.699) * (-1659.582) [-1653.966] (-1656.469) (-1658.711) -- 0:00:15 757500 -- (-1655.014) (-1661.767) [-1658.155] (-1655.010) * (-1656.728) [-1654.719] (-1654.952) (-1656.598) -- 0:00:15 758000 -- (-1654.237) (-1655.973) (-1655.345) [-1654.841] * (-1658.529) [-1655.387] (-1656.274) (-1655.346) -- 0:00:15 758500 -- (-1655.592) (-1655.454) (-1656.987) [-1654.797] * (-1656.036) (-1656.172) (-1655.770) [-1655.888] -- 0:00:15 759000 -- (-1654.755) (-1656.343) (-1657.246) [-1654.075] * (-1655.575) [-1656.988] (-1655.715) (-1657.757) -- 0:00:15 759500 -- (-1658.246) (-1658.622) (-1655.556) [-1655.146] * (-1656.843) (-1656.102) (-1654.851) [-1655.074] -- 0:00:15 760000 -- (-1657.094) (-1658.570) [-1657.774] (-1654.514) * (-1656.969) [-1657.263] (-1655.872) (-1655.785) -- 0:00:15 Average standard deviation of split frequencies: 0.007692 760500 -- [-1656.470] (-1658.299) (-1657.200) (-1656.571) * (-1655.570) (-1658.234) (-1656.178) [-1653.493] -- 0:00:15 761000 -- (-1656.321) (-1656.346) [-1656.194] (-1658.272) * (-1656.716) [-1656.830] (-1656.456) (-1653.687) -- 0:00:15 761500 -- (-1656.288) (-1657.616) (-1659.364) [-1653.989] * (-1656.267) (-1665.238) [-1657.794] (-1655.057) -- 0:00:15 762000 -- (-1655.630) [-1656.336] (-1653.784) (-1654.649) * (-1657.042) (-1658.804) [-1656.459] (-1655.232) -- 0:00:15 762500 -- (-1654.208) (-1655.883) [-1654.542] (-1655.928) * (-1655.040) [-1656.240] (-1655.402) (-1656.368) -- 0:00:15 763000 -- (-1654.262) [-1655.206] (-1654.762) (-1653.718) * (-1656.436) (-1655.433) [-1655.008] (-1657.912) -- 0:00:15 763500 -- (-1653.359) (-1656.733) (-1655.577) [-1655.632] * (-1654.370) (-1655.031) (-1654.572) [-1656.305] -- 0:00:15 764000 -- (-1657.728) (-1658.086) (-1656.782) [-1656.849] * (-1656.782) (-1659.451) [-1655.824] (-1658.850) -- 0:00:15 764500 -- (-1655.041) [-1656.048] (-1656.622) (-1653.391) * [-1656.008] (-1660.089) (-1657.513) (-1657.131) -- 0:00:15 765000 -- (-1655.132) [-1657.665] (-1654.183) (-1653.562) * (-1655.363) (-1659.411) [-1658.050] (-1659.701) -- 0:00:15 Average standard deviation of split frequencies: 0.007566 765500 -- (-1658.221) [-1656.224] (-1657.905) (-1654.357) * [-1656.663] (-1655.920) (-1659.491) (-1654.442) -- 0:00:15 766000 -- (-1658.295) (-1654.692) [-1654.972] (-1655.589) * (-1654.816) (-1656.535) (-1655.572) [-1658.155] -- 0:00:14 766500 -- (-1657.655) [-1653.754] (-1657.723) (-1655.703) * (-1659.992) [-1653.409] (-1656.812) (-1659.249) -- 0:00:14 767000 -- (-1653.848) [-1656.497] (-1656.759) (-1655.256) * (-1658.697) [-1653.709] (-1655.759) (-1654.263) -- 0:00:14 767500 -- (-1653.761) (-1657.488) [-1654.109] (-1654.583) * [-1654.382] (-1654.837) (-1658.017) (-1654.014) -- 0:00:14 768000 -- (-1654.905) [-1656.396] (-1656.699) (-1659.082) * (-1656.139) (-1654.941) (-1657.481) [-1653.945] -- 0:00:14 768500 -- (-1654.440) [-1654.486] (-1657.101) (-1656.136) * [-1656.454] (-1655.970) (-1654.656) (-1654.444) -- 0:00:14 769000 -- (-1654.378) (-1654.632) [-1653.471] (-1660.530) * (-1656.395) [-1653.504] (-1658.668) (-1654.533) -- 0:00:14 769500 -- [-1654.385] (-1657.632) (-1661.294) (-1657.802) * (-1659.922) (-1654.371) (-1655.519) [-1654.741] -- 0:00:14 770000 -- [-1655.107] (-1655.138) (-1657.078) (-1656.491) * (-1654.781) [-1663.631] (-1653.785) (-1654.754) -- 0:00:14 Average standard deviation of split frequencies: 0.007124 770500 -- (-1655.863) [-1657.853] (-1655.436) (-1657.060) * (-1655.355) [-1656.853] (-1654.587) (-1656.155) -- 0:00:14 771000 -- (-1655.204) (-1654.654) [-1655.731] (-1656.956) * (-1654.884) (-1655.875) (-1657.821) [-1654.942] -- 0:00:14 771500 -- (-1656.257) (-1655.578) [-1656.752] (-1660.217) * [-1653.629] (-1655.139) (-1653.994) (-1656.965) -- 0:00:14 772000 -- (-1656.509) [-1653.443] (-1659.693) (-1655.361) * (-1653.365) (-1655.101) [-1654.884] (-1654.632) -- 0:00:14 772500 -- (-1654.756) [-1656.598] (-1656.827) (-1655.323) * [-1655.535] (-1655.572) (-1655.060) (-1656.793) -- 0:00:14 773000 -- [-1653.737] (-1655.135) (-1654.543) (-1656.516) * (-1654.407) (-1654.804) [-1656.201] (-1657.832) -- 0:00:14 773500 -- [-1654.335] (-1655.129) (-1654.049) (-1656.366) * (-1654.887) [-1653.336] (-1659.040) (-1660.069) -- 0:00:14 774000 -- (-1654.146) [-1657.132] (-1654.476) (-1657.030) * (-1657.390) (-1655.391) [-1656.141] (-1656.017) -- 0:00:14 774500 -- (-1653.931) (-1654.501) (-1654.922) [-1654.478] * [-1656.950] (-1655.939) (-1655.101) (-1659.850) -- 0:00:14 775000 -- (-1654.307) (-1656.870) (-1654.010) [-1654.060] * (-1658.120) (-1660.277) (-1655.512) [-1655.101] -- 0:00:14 Average standard deviation of split frequencies: 0.006789 775500 -- (-1655.241) (-1654.831) (-1653.393) [-1660.081] * (-1659.002) (-1657.719) [-1655.666] (-1655.520) -- 0:00:14 776000 -- [-1653.941] (-1657.254) (-1658.134) (-1654.700) * (-1656.975) (-1656.317) [-1655.393] (-1663.863) -- 0:00:14 776500 -- [-1658.428] (-1659.032) (-1654.643) (-1657.341) * (-1657.624) [-1653.820] (-1655.992) (-1657.512) -- 0:00:14 777000 -- (-1659.360) (-1656.669) [-1654.140] (-1659.146) * (-1655.320) (-1656.814) [-1659.802] (-1657.176) -- 0:00:14 777500 -- (-1656.861) [-1657.425] (-1654.933) (-1655.653) * (-1653.670) (-1659.191) [-1654.746] (-1660.777) -- 0:00:14 778000 -- (-1655.749) (-1657.608) (-1654.385) [-1655.052] * (-1655.562) (-1660.675) (-1656.985) [-1658.811] -- 0:00:14 778500 -- (-1655.691) (-1655.195) [-1656.157] (-1655.415) * [-1653.286] (-1655.378) (-1654.906) (-1656.050) -- 0:00:14 779000 -- (-1655.095) [-1654.605] (-1656.120) (-1654.087) * (-1655.438) [-1654.319] (-1655.952) (-1655.567) -- 0:00:14 779500 -- (-1656.388) (-1654.820) [-1654.421] (-1659.003) * [-1654.074] (-1655.461) (-1654.930) (-1654.456) -- 0:00:14 780000 -- (-1656.194) (-1657.603) (-1654.246) [-1655.375] * (-1655.638) (-1656.968) (-1654.054) [-1653.468] -- 0:00:14 Average standard deviation of split frequencies: 0.006820 780500 -- (-1654.848) (-1655.084) [-1654.957] (-1656.608) * (-1655.637) (-1658.999) [-1654.686] (-1655.438) -- 0:00:14 781000 -- [-1656.748] (-1656.912) (-1655.689) (-1656.499) * (-1659.033) (-1655.117) [-1654.171] (-1654.537) -- 0:00:14 781500 -- (-1656.911) (-1653.941) (-1657.374) [-1654.846] * (-1655.006) [-1653.769] (-1653.584) (-1655.647) -- 0:00:13 782000 -- [-1654.694] (-1653.935) (-1655.505) (-1656.485) * [-1654.619] (-1657.886) (-1654.686) (-1657.605) -- 0:00:13 782500 -- (-1654.416) [-1653.859] (-1653.720) (-1653.772) * [-1653.658] (-1659.747) (-1654.163) (-1654.409) -- 0:00:13 783000 -- [-1657.428] (-1656.913) (-1653.426) (-1654.831) * (-1655.389) (-1654.534) (-1654.349) [-1654.498] -- 0:00:13 783500 -- (-1655.365) (-1658.126) [-1654.941] (-1658.158) * [-1658.252] (-1657.701) (-1654.835) (-1657.012) -- 0:00:13 784000 -- (-1657.436) (-1654.990) [-1654.790] (-1654.427) * (-1654.776) (-1656.269) (-1653.635) [-1655.264] -- 0:00:13 784500 -- (-1657.586) (-1657.793) (-1656.092) [-1655.240] * (-1654.817) (-1658.585) [-1656.025] (-1654.792) -- 0:00:13 785000 -- (-1656.000) (-1656.867) [-1653.395] (-1654.963) * [-1653.713] (-1658.769) (-1655.333) (-1654.666) -- 0:00:13 Average standard deviation of split frequencies: 0.007091 785500 -- [-1655.531] (-1655.673) (-1654.290) (-1658.250) * (-1657.006) (-1656.289) (-1654.984) [-1654.634] -- 0:00:13 786000 -- (-1653.759) (-1657.012) (-1655.129) [-1657.429] * (-1654.670) (-1654.444) (-1655.190) [-1658.447] -- 0:00:13 786500 -- [-1655.370] (-1657.479) (-1655.928) (-1656.758) * [-1655.859] (-1653.973) (-1654.448) (-1658.497) -- 0:00:13 787000 -- (-1656.474) (-1656.781) [-1653.784] (-1657.503) * (-1655.389) (-1658.063) (-1653.979) [-1657.205] -- 0:00:13 787500 -- (-1658.951) (-1660.568) [-1658.121] (-1655.821) * [-1655.180] (-1656.500) (-1656.428) (-1655.056) -- 0:00:13 788000 -- (-1657.077) (-1655.130) [-1655.851] (-1655.755) * (-1660.628) (-1667.668) (-1656.100) [-1653.302] -- 0:00:13 788500 -- (-1654.147) [-1655.379] (-1654.552) (-1654.538) * (-1656.126) (-1661.378) (-1654.957) [-1654.731] -- 0:00:13 789000 -- (-1660.172) (-1657.896) [-1656.239] (-1656.284) * (-1653.417) (-1658.115) [-1655.321] (-1654.983) -- 0:00:13 789500 -- [-1658.167] (-1654.120) (-1661.405) (-1656.479) * (-1654.278) (-1658.498) [-1658.685] (-1657.274) -- 0:00:13 790000 -- (-1654.705) [-1656.553] (-1655.876) (-1653.472) * (-1656.699) (-1656.163) [-1654.955] (-1654.211) -- 0:00:13 Average standard deviation of split frequencies: 0.006418 790500 -- (-1655.386) (-1656.392) (-1657.057) [-1655.035] * (-1655.742) (-1654.193) (-1654.919) [-1654.589] -- 0:00:13 791000 -- (-1658.142) [-1655.839] (-1656.603) (-1654.709) * (-1656.446) [-1654.322] (-1655.919) (-1654.366) -- 0:00:13 791500 -- (-1657.539) [-1658.483] (-1656.319) (-1657.605) * (-1657.405) [-1654.778] (-1655.078) (-1655.386) -- 0:00:13 792000 -- (-1656.295) (-1658.846) (-1654.044) [-1654.926] * [-1656.149] (-1654.981) (-1655.164) (-1655.488) -- 0:00:13 792500 -- [-1656.922] (-1657.479) (-1656.029) (-1654.587) * [-1654.954] (-1658.654) (-1657.074) (-1654.833) -- 0:00:13 793000 -- (-1654.930) (-1656.841) (-1658.434) [-1657.540] * (-1656.124) [-1653.998] (-1658.850) (-1656.918) -- 0:00:13 793500 -- (-1655.193) (-1656.432) (-1657.282) [-1658.288] * [-1656.397] (-1656.786) (-1656.083) (-1657.744) -- 0:00:13 794000 -- (-1655.326) (-1658.107) (-1656.064) [-1653.910] * (-1655.076) (-1657.271) [-1655.040] (-1655.294) -- 0:00:13 794500 -- (-1659.232) (-1656.190) (-1653.853) [-1655.529] * (-1654.497) (-1656.077) (-1657.310) [-1655.224] -- 0:00:13 795000 -- (-1660.314) [-1656.225] (-1654.119) (-1655.030) * (-1654.476) (-1656.092) [-1654.652] (-1655.097) -- 0:00:13 Average standard deviation of split frequencies: 0.006619 795500 -- [-1655.015] (-1654.879) (-1660.610) (-1655.221) * (-1653.864) (-1655.954) (-1654.559) [-1654.566] -- 0:00:13 796000 -- (-1653.473) (-1657.965) [-1654.106] (-1654.464) * (-1654.190) [-1655.217] (-1655.369) (-1655.361) -- 0:00:13 796500 -- (-1654.076) (-1663.149) [-1656.511] (-1655.259) * (-1653.715) [-1656.945] (-1654.802) (-1660.818) -- 0:00:13 797000 -- [-1653.657] (-1655.357) (-1655.546) (-1654.506) * [-1653.496] (-1657.334) (-1657.843) (-1658.246) -- 0:00:12 797500 -- (-1654.284) (-1654.259) (-1660.014) [-1654.915] * (-1655.695) (-1657.120) [-1656.380] (-1654.228) -- 0:00:12 798000 -- [-1655.990] (-1661.200) (-1657.724) (-1656.719) * [-1654.106] (-1654.878) (-1654.655) (-1657.668) -- 0:00:12 798500 -- (-1655.320) (-1660.827) (-1657.766) [-1654.781] * (-1654.875) (-1656.942) [-1654.903] (-1655.996) -- 0:00:12 799000 -- (-1655.447) (-1656.697) (-1657.972) [-1656.183] * [-1654.960] (-1659.560) (-1654.276) (-1659.893) -- 0:00:12 799500 -- (-1656.136) (-1657.162) (-1657.608) [-1661.922] * (-1653.601) (-1656.462) [-1657.724] (-1658.131) -- 0:00:12 800000 -- [-1656.124] (-1654.860) (-1655.297) (-1655.511) * (-1655.592) (-1659.615) (-1655.738) [-1655.349] -- 0:00:12 Average standard deviation of split frequencies: 0.006338 800500 -- (-1659.007) (-1654.379) (-1655.912) [-1656.509] * (-1655.642) (-1656.384) (-1654.942) [-1655.575] -- 0:00:12 801000 -- (-1655.593) (-1656.918) (-1655.297) [-1655.018] * (-1657.888) (-1656.162) (-1656.030) [-1655.483] -- 0:00:12 801500 -- [-1655.173] (-1657.359) (-1656.715) (-1654.770) * (-1657.384) (-1654.072) [-1658.967] (-1657.632) -- 0:00:12 802000 -- (-1657.408) (-1656.476) (-1655.745) [-1653.779] * (-1655.248) [-1656.254] (-1654.202) (-1656.939) -- 0:00:12 802500 -- [-1654.376] (-1657.200) (-1655.886) (-1654.881) * (-1656.798) [-1660.443] (-1657.352) (-1658.476) -- 0:00:12 803000 -- [-1654.354] (-1655.604) (-1654.402) (-1654.841) * (-1655.641) (-1658.350) [-1655.652] (-1655.242) -- 0:00:12 803500 -- (-1655.230) (-1653.398) [-1657.034] (-1655.681) * (-1657.512) (-1656.816) [-1656.948] (-1655.382) -- 0:00:12 804000 -- (-1657.729) (-1653.647) (-1657.088) [-1654.831] * [-1654.795] (-1655.525) (-1655.066) (-1654.785) -- 0:00:12 804500 -- (-1659.259) (-1662.298) (-1654.260) [-1655.767] * (-1654.997) (-1656.940) (-1656.861) [-1654.006] -- 0:00:12 805000 -- (-1658.487) (-1658.741) [-1654.249] (-1655.369) * (-1655.682) (-1655.198) (-1655.668) [-1654.051] -- 0:00:12 Average standard deviation of split frequencies: 0.006296 805500 -- (-1662.243) (-1654.424) (-1655.528) [-1655.140] * [-1656.766] (-1655.140) (-1654.256) (-1654.618) -- 0:00:12 806000 -- (-1659.994) (-1658.168) [-1655.353] (-1654.544) * (-1655.940) (-1654.748) [-1654.145] (-1654.759) -- 0:00:12 806500 -- (-1656.318) (-1658.662) [-1656.497] (-1654.932) * [-1656.279] (-1654.819) (-1654.808) (-1656.047) -- 0:00:12 807000 -- (-1657.438) [-1656.599] (-1656.861) (-1656.265) * (-1655.557) (-1654.333) [-1654.005] (-1655.340) -- 0:00:12 807500 -- (-1655.806) (-1654.515) (-1658.247) [-1655.297] * (-1655.648) (-1654.474) [-1656.454] (-1656.866) -- 0:00:12 808000 -- (-1656.645) (-1653.888) [-1654.036] (-1655.067) * (-1655.471) [-1653.765] (-1657.533) (-1654.214) -- 0:00:12 808500 -- (-1658.128) (-1655.141) [-1657.986] (-1654.050) * (-1657.262) (-1658.223) [-1655.036] (-1654.260) -- 0:00:12 809000 -- (-1656.351) (-1655.998) (-1654.511) [-1655.287] * (-1655.617) (-1656.525) [-1657.715] (-1653.642) -- 0:00:12 809500 -- (-1657.130) [-1654.624] (-1656.193) (-1654.820) * (-1654.306) [-1656.617] (-1655.784) (-1654.566) -- 0:00:12 810000 -- (-1654.736) (-1653.515) [-1657.402] (-1654.047) * (-1653.807) (-1653.778) (-1653.820) [-1654.261] -- 0:00:12 Average standard deviation of split frequencies: 0.006773 810500 -- (-1655.030) (-1658.530) (-1654.315) [-1653.526] * [-1658.073] (-1654.314) (-1655.156) (-1655.729) -- 0:00:12 811000 -- [-1654.021] (-1656.159) (-1656.708) (-1653.595) * (-1660.565) [-1653.764] (-1655.471) (-1658.188) -- 0:00:12 811500 -- (-1657.657) [-1653.826] (-1654.766) (-1659.007) * (-1653.959) (-1654.403) [-1657.036] (-1655.017) -- 0:00:12 812000 -- (-1653.433) [-1653.508] (-1654.133) (-1654.460) * [-1653.959] (-1661.913) (-1653.932) (-1655.750) -- 0:00:12 812500 -- (-1655.675) (-1653.579) (-1655.291) [-1654.189] * [-1654.233] (-1655.257) (-1656.026) (-1655.162) -- 0:00:12 813000 -- [-1654.597] (-1657.222) (-1653.816) (-1654.723) * (-1654.265) (-1656.395) (-1654.977) [-1655.383] -- 0:00:11 813500 -- [-1655.051] (-1657.081) (-1655.974) (-1653.708) * [-1654.836] (-1653.967) (-1661.192) (-1654.306) -- 0:00:11 814000 -- (-1655.240) (-1656.517) (-1654.613) [-1654.465] * (-1658.232) (-1654.433) [-1655.653] (-1656.600) -- 0:00:11 814500 -- (-1656.449) (-1654.595) (-1656.643) [-1654.712] * (-1659.457) [-1654.693] (-1655.159) (-1658.732) -- 0:00:11 815000 -- (-1657.005) [-1655.877] (-1655.285) (-1656.068) * (-1653.348) (-1653.664) [-1655.250] (-1655.945) -- 0:00:11 Average standard deviation of split frequencies: 0.006898 815500 -- (-1654.490) (-1655.262) [-1653.447] (-1657.757) * [-1653.848] (-1654.819) (-1656.746) (-1655.257) -- 0:00:11 816000 -- (-1655.669) (-1655.795) (-1655.067) [-1656.891] * (-1658.898) [-1655.415] (-1654.830) (-1655.526) -- 0:00:11 816500 -- (-1657.727) [-1656.503] (-1656.703) (-1654.463) * (-1659.753) (-1658.838) (-1655.008) [-1653.898] -- 0:00:11 817000 -- [-1656.460] (-1655.996) (-1653.990) (-1656.894) * [-1656.976] (-1657.749) (-1656.554) (-1653.453) -- 0:00:11 817500 -- (-1656.089) (-1656.619) (-1654.883) [-1655.844] * (-1655.662) [-1655.698] (-1655.154) (-1653.846) -- 0:00:11 818000 -- (-1653.886) (-1654.072) [-1655.588] (-1654.417) * (-1658.129) [-1653.645] (-1655.404) (-1655.729) -- 0:00:11 818500 -- (-1654.869) (-1653.683) [-1654.418] (-1658.145) * (-1657.009) (-1655.356) (-1654.557) [-1655.647] -- 0:00:11 819000 -- [-1655.093] (-1655.252) (-1658.124) (-1655.726) * (-1653.576) (-1655.654) (-1655.662) [-1656.848] -- 0:00:11 819500 -- (-1653.898) (-1656.811) [-1659.317] (-1654.934) * (-1654.645) [-1654.607] (-1654.233) (-1662.388) -- 0:00:11 820000 -- [-1656.921] (-1656.148) (-1654.005) (-1656.112) * (-1656.793) [-1655.165] (-1653.982) (-1655.117) -- 0:00:11 Average standard deviation of split frequencies: 0.006690 820500 -- (-1654.410) (-1655.671) [-1655.631] (-1655.070) * (-1656.280) [-1655.853] (-1657.842) (-1655.596) -- 0:00:11 821000 -- (-1654.379) [-1655.270] (-1657.171) (-1655.299) * (-1657.250) [-1658.622] (-1654.843) (-1653.474) -- 0:00:11 821500 -- [-1655.037] (-1653.863) (-1656.676) (-1653.490) * (-1654.514) (-1657.163) (-1658.019) [-1653.474] -- 0:00:11 822000 -- (-1654.538) (-1654.877) [-1657.599] (-1654.520) * (-1654.996) [-1659.568] (-1656.959) (-1654.977) -- 0:00:11 822500 -- [-1656.028] (-1654.322) (-1656.796) (-1654.771) * (-1654.005) (-1654.590) (-1656.374) [-1656.405] -- 0:00:11 823000 -- (-1655.999) (-1661.727) (-1654.798) [-1653.673] * (-1654.306) (-1653.482) (-1656.980) [-1657.597] -- 0:00:11 823500 -- (-1657.295) [-1654.197] (-1656.595) (-1657.336) * (-1654.559) (-1654.641) (-1654.859) [-1659.446] -- 0:00:11 824000 -- (-1654.710) [-1654.087] (-1654.423) (-1659.069) * (-1654.254) (-1655.953) (-1654.715) [-1658.122] -- 0:00:11 824500 -- (-1656.343) [-1654.876] (-1654.861) (-1656.806) * [-1654.863] (-1655.948) (-1655.314) (-1662.541) -- 0:00:11 825000 -- (-1657.018) (-1655.262) [-1654.428] (-1655.456) * (-1654.863) (-1653.257) [-1656.538] (-1653.696) -- 0:00:11 Average standard deviation of split frequencies: 0.006412 825500 -- (-1655.614) (-1654.481) (-1653.576) [-1654.157] * (-1657.516) [-1655.368] (-1657.542) (-1655.536) -- 0:00:11 826000 -- (-1656.456) (-1654.239) [-1654.557] (-1654.147) * [-1654.629] (-1653.816) (-1659.898) (-1654.571) -- 0:00:11 826500 -- (-1654.447) (-1660.110) [-1654.113] (-1656.465) * [-1657.877] (-1654.293) (-1656.145) (-1655.021) -- 0:00:11 827000 -- (-1656.469) (-1654.132) (-1653.546) [-1657.672] * (-1657.070) [-1656.948] (-1654.952) (-1656.655) -- 0:00:11 827500 -- (-1656.403) (-1657.502) [-1655.166] (-1656.886) * (-1659.089) [-1655.199] (-1654.682) (-1654.866) -- 0:00:11 828000 -- (-1655.022) [-1655.468] (-1655.526) (-1655.904) * (-1656.325) (-1655.628) (-1657.236) [-1654.806] -- 0:00:11 828500 -- (-1654.043) (-1653.645) (-1658.187) [-1657.763] * [-1656.574] (-1656.560) (-1655.769) (-1655.213) -- 0:00:10 829000 -- (-1653.573) (-1655.831) [-1656.732] (-1655.790) * (-1655.481) (-1657.034) (-1655.184) [-1654.233] -- 0:00:10 829500 -- (-1656.490) (-1657.204) [-1654.771] (-1661.091) * (-1656.183) (-1654.143) (-1655.313) [-1656.323] -- 0:00:10 830000 -- [-1657.452] (-1657.898) (-1654.964) (-1654.574) * [-1657.390] (-1654.428) (-1655.696) (-1657.935) -- 0:00:10 Average standard deviation of split frequencies: 0.006209 830500 -- (-1656.125) [-1656.104] (-1658.250) (-1656.785) * (-1655.788) [-1656.785] (-1658.275) (-1653.637) -- 0:00:10 831000 -- (-1659.229) [-1654.967] (-1655.939) (-1659.346) * (-1657.190) [-1653.585] (-1654.771) (-1656.086) -- 0:00:10 831500 -- (-1655.626) (-1653.266) [-1653.981] (-1656.312) * (-1655.147) (-1653.502) (-1653.947) [-1656.269] -- 0:00:10 832000 -- (-1659.546) (-1654.255) [-1656.930] (-1655.972) * [-1655.146] (-1654.625) (-1655.230) (-1657.063) -- 0:00:10 832500 -- (-1656.486) (-1654.290) [-1653.490] (-1656.943) * [-1655.471] (-1654.970) (-1654.061) (-1656.132) -- 0:00:10 833000 -- (-1654.597) [-1654.005] (-1656.225) (-1659.176) * [-1657.940] (-1654.101) (-1654.888) (-1656.768) -- 0:00:10 833500 -- [-1655.778] (-1659.707) (-1654.032) (-1653.390) * (-1657.616) [-1654.161] (-1654.460) (-1656.620) -- 0:00:10 834000 -- [-1654.988] (-1655.649) (-1657.270) (-1653.714) * (-1657.318) (-1656.298) (-1653.915) [-1657.325] -- 0:00:10 834500 -- (-1654.851) [-1654.574] (-1657.263) (-1656.497) * (-1657.861) (-1656.542) (-1654.119) [-1656.080] -- 0:00:10 835000 -- (-1656.196) [-1654.239] (-1656.390) (-1658.222) * (-1660.707) (-1656.676) [-1656.102] (-1659.182) -- 0:00:10 Average standard deviation of split frequencies: 0.006103 835500 -- (-1654.216) [-1653.783] (-1655.291) (-1655.787) * (-1655.071) (-1657.129) (-1659.061) [-1653.681] -- 0:00:10 836000 -- [-1654.801] (-1658.404) (-1655.425) (-1654.204) * (-1654.354) (-1659.698) [-1654.397] (-1660.428) -- 0:00:10 836500 -- (-1659.176) [-1655.881] (-1654.832) (-1655.143) * (-1656.094) (-1659.733) (-1655.022) [-1654.063] -- 0:00:10 837000 -- (-1657.690) (-1659.321) (-1654.892) [-1654.115] * [-1654.320] (-1658.762) (-1656.930) (-1655.565) -- 0:00:10 837500 -- (-1656.322) (-1654.623) [-1654.294] (-1654.675) * (-1655.598) (-1656.788) (-1656.157) [-1655.035] -- 0:00:10 838000 -- (-1654.222) [-1653.795] (-1653.609) (-1655.398) * (-1654.816) (-1655.046) [-1654.997] (-1658.099) -- 0:00:10 838500 -- [-1657.379] (-1657.397) (-1653.892) (-1655.381) * (-1655.059) (-1655.583) (-1653.602) [-1656.787] -- 0:00:10 839000 -- (-1655.190) [-1654.403] (-1655.596) (-1660.929) * [-1654.317] (-1653.963) (-1656.548) (-1657.041) -- 0:00:10 839500 -- (-1656.625) (-1655.344) [-1655.603] (-1655.926) * [-1654.531] (-1653.771) (-1654.308) (-1654.755) -- 0:00:10 840000 -- (-1654.253) (-1657.916) [-1656.660] (-1654.793) * (-1659.144) [-1654.254] (-1658.101) (-1653.309) -- 0:00:10 Average standard deviation of split frequencies: 0.005575 840500 -- (-1656.791) [-1654.736] (-1655.087) (-1654.192) * (-1660.989) (-1655.632) [-1657.273] (-1653.757) -- 0:00:10 841000 -- (-1655.970) [-1654.797] (-1656.704) (-1656.094) * (-1654.719) [-1656.989] (-1658.293) (-1655.192) -- 0:00:10 841500 -- (-1656.896) (-1656.738) (-1657.497) [-1653.488] * (-1656.635) (-1656.203) [-1655.506] (-1656.332) -- 0:00:10 842000 -- [-1654.912] (-1656.572) (-1656.986) (-1653.563) * (-1656.409) (-1659.021) [-1654.377] (-1653.812) -- 0:00:10 842500 -- (-1653.258) (-1657.475) (-1657.548) [-1655.193] * (-1655.481) (-1654.859) (-1653.594) [-1654.024] -- 0:00:10 843000 -- (-1653.996) [-1656.679] (-1655.738) (-1654.681) * [-1655.261] (-1654.821) (-1654.793) (-1654.039) -- 0:00:10 843500 -- (-1656.019) (-1654.562) (-1659.918) [-1657.345] * [-1657.596] (-1654.964) (-1654.331) (-1657.899) -- 0:00:10 844000 -- (-1655.902) (-1656.361) [-1655.698] (-1656.982) * (-1656.816) (-1654.328) (-1654.542) [-1658.285] -- 0:00:09 844500 -- (-1655.491) (-1655.502) (-1655.171) [-1655.447] * (-1657.297) (-1661.921) (-1657.267) [-1656.303] -- 0:00:09 845000 -- (-1661.724) (-1656.460) (-1658.373) [-1654.853] * (-1655.051) (-1656.289) (-1657.798) [-1658.861] -- 0:00:09 Average standard deviation of split frequencies: 0.005507 845500 -- (-1657.305) (-1658.451) [-1657.454] (-1655.929) * [-1653.726] (-1657.619) (-1655.330) (-1655.488) -- 0:00:09 846000 -- (-1654.375) (-1654.248) (-1658.640) [-1655.231] * (-1655.779) (-1655.897) [-1654.504] (-1655.634) -- 0:00:09 846500 -- [-1653.954] (-1654.703) (-1665.596) (-1655.128) * (-1655.621) (-1659.831) (-1655.032) [-1655.209] -- 0:00:09 847000 -- (-1656.602) [-1654.821] (-1656.456) (-1655.128) * [-1655.384] (-1654.228) (-1658.069) (-1656.319) -- 0:00:09 847500 -- (-1656.002) (-1657.610) [-1654.524] (-1653.998) * [-1655.254] (-1654.254) (-1654.664) (-1659.764) -- 0:00:09 848000 -- (-1662.177) (-1656.110) (-1653.192) [-1659.385] * (-1654.327) (-1657.416) [-1655.148] (-1659.160) -- 0:00:09 848500 -- (-1661.430) (-1658.655) [-1655.830] (-1656.558) * (-1653.813) (-1657.670) [-1656.699] (-1656.893) -- 0:00:09 849000 -- (-1654.815) (-1656.575) (-1656.106) [-1656.557] * [-1653.499] (-1654.122) (-1657.016) (-1659.299) -- 0:00:09 849500 -- (-1655.148) (-1655.771) [-1655.347] (-1654.032) * (-1656.639) (-1653.552) (-1654.296) [-1653.587] -- 0:00:09 850000 -- (-1655.541) [-1655.377] (-1658.905) (-1655.073) * [-1657.420] (-1654.196) (-1653.581) (-1654.685) -- 0:00:09 Average standard deviation of split frequencies: 0.005542 850500 -- (-1653.840) (-1653.663) [-1656.006] (-1655.524) * [-1656.507] (-1655.048) (-1653.875) (-1656.332) -- 0:00:09 851000 -- (-1655.105) (-1655.240) (-1655.178) [-1654.607] * (-1654.692) [-1654.491] (-1658.544) (-1654.619) -- 0:00:09 851500 -- (-1654.460) (-1657.949) (-1654.636) [-1654.646] * (-1656.076) (-1657.378) [-1654.450] (-1653.470) -- 0:00:09 852000 -- (-1656.161) (-1656.710) [-1654.179] (-1656.685) * [-1654.208] (-1654.848) (-1654.797) (-1655.734) -- 0:00:09 852500 -- (-1654.914) (-1653.641) [-1654.011] (-1655.922) * (-1655.588) (-1659.689) (-1656.552) [-1657.521] -- 0:00:09 853000 -- [-1657.927] (-1658.344) (-1655.969) (-1654.939) * (-1654.174) (-1657.284) [-1656.902] (-1654.951) -- 0:00:09 853500 -- (-1659.049) (-1655.905) (-1659.596) [-1654.459] * (-1657.324) (-1656.227) [-1653.506] (-1655.717) -- 0:00:09 854000 -- (-1659.482) (-1654.957) [-1657.950] (-1657.885) * (-1655.007) (-1655.510) (-1655.335) [-1654.032] -- 0:00:09 854500 -- (-1656.209) (-1656.052) [-1655.558] (-1655.869) * (-1655.554) (-1655.266) [-1655.568] (-1657.582) -- 0:00:09 855000 -- [-1656.039] (-1654.712) (-1654.968) (-1656.117) * (-1654.520) (-1654.699) [-1659.639] (-1654.411) -- 0:00:09 Average standard deviation of split frequencies: 0.005507 855500 -- [-1654.924] (-1658.191) (-1656.143) (-1655.310) * (-1654.396) (-1654.800) (-1654.884) [-1654.605] -- 0:00:09 856000 -- (-1653.630) (-1654.259) (-1655.979) [-1656.277] * (-1656.618) [-1654.085] (-1655.392) (-1655.658) -- 0:00:09 856500 -- (-1653.859) (-1655.441) [-1654.005] (-1657.820) * (-1657.172) [-1654.166] (-1654.650) (-1654.534) -- 0:00:09 857000 -- (-1653.957) (-1655.949) [-1655.786] (-1657.307) * [-1653.223] (-1653.359) (-1656.863) (-1654.881) -- 0:00:09 857500 -- (-1653.303) [-1656.975] (-1659.173) (-1658.369) * (-1654.033) (-1654.851) [-1655.399] (-1655.808) -- 0:00:09 858000 -- (-1656.407) (-1657.861) (-1658.535) [-1653.707] * (-1654.620) [-1656.751] (-1654.457) (-1655.132) -- 0:00:09 858500 -- [-1653.424] (-1658.628) (-1658.533) (-1654.480) * (-1655.681) (-1653.677) [-1654.802] (-1662.364) -- 0:00:09 859000 -- (-1655.098) [-1656.272] (-1656.190) (-1656.246) * (-1660.261) (-1656.071) (-1659.341) [-1657.232] -- 0:00:09 859500 -- (-1656.962) (-1655.290) (-1657.272) [-1654.193] * (-1656.307) (-1655.979) [-1655.128] (-1656.787) -- 0:00:08 860000 -- (-1653.772) (-1653.576) (-1656.486) [-1655.376] * [-1654.622] (-1655.321) (-1654.234) (-1655.746) -- 0:00:08 Average standard deviation of split frequencies: 0.005991 860500 -- (-1656.871) (-1657.722) [-1656.781] (-1654.989) * (-1655.805) (-1655.812) [-1654.530] (-1656.035) -- 0:00:08 861000 -- (-1657.419) [-1655.596] (-1655.733) (-1658.754) * (-1654.895) (-1656.477) [-1657.017] (-1655.799) -- 0:00:08 861500 -- (-1666.422) [-1653.853] (-1654.898) (-1654.151) * (-1653.921) (-1658.268) (-1657.108) [-1654.252] -- 0:00:08 862000 -- [-1656.909] (-1656.226) (-1654.404) (-1654.130) * (-1656.179) (-1657.203) [-1662.235] (-1654.050) -- 0:00:08 862500 -- (-1655.354) (-1656.087) (-1655.373) [-1654.029] * [-1655.075] (-1653.178) (-1654.722) (-1658.499) -- 0:00:08 863000 -- (-1660.003) (-1657.323) [-1655.126] (-1655.180) * (-1655.540) (-1653.388) (-1655.386) [-1658.309] -- 0:00:08 863500 -- (-1654.983) (-1654.300) [-1655.288] (-1655.344) * (-1659.056) [-1653.392] (-1660.081) (-1656.452) -- 0:00:08 864000 -- (-1657.933) (-1656.299) (-1656.186) [-1656.319] * (-1654.140) [-1653.832] (-1658.502) (-1656.061) -- 0:00:08 864500 -- (-1656.073) (-1657.702) (-1656.175) [-1655.270] * (-1660.146) [-1653.832] (-1653.735) (-1657.814) -- 0:00:08 865000 -- (-1655.330) (-1655.436) (-1656.654) [-1655.621] * (-1656.720) (-1654.734) [-1654.503] (-1657.058) -- 0:00:08 Average standard deviation of split frequencies: 0.006192 865500 -- [-1659.978] (-1653.844) (-1655.266) (-1658.119) * (-1653.833) (-1655.327) (-1659.507) [-1655.507] -- 0:00:08 866000 -- (-1656.225) [-1654.059] (-1654.632) (-1657.193) * (-1655.329) (-1661.518) (-1655.651) [-1654.035] -- 0:00:08 866500 -- (-1654.419) (-1654.663) [-1655.903] (-1655.849) * [-1655.735] (-1655.860) (-1654.509) (-1656.462) -- 0:00:08 867000 -- (-1655.089) (-1655.223) [-1655.548] (-1653.294) * [-1654.468] (-1655.699) (-1657.724) (-1662.107) -- 0:00:08 867500 -- (-1653.718) [-1657.433] (-1656.071) (-1653.317) * (-1654.373) (-1654.566) [-1655.969] (-1654.976) -- 0:00:08 868000 -- (-1657.537) (-1657.718) (-1654.718) [-1654.607] * (-1658.193) (-1655.109) [-1655.886] (-1655.437) -- 0:00:08 868500 -- (-1657.087) (-1656.632) [-1655.304] (-1654.686) * (-1656.752) (-1653.810) [-1655.218] (-1654.601) -- 0:00:08 869000 -- (-1654.908) [-1657.542] (-1655.166) (-1655.876) * [-1654.232] (-1655.882) (-1654.008) (-1657.182) -- 0:00:08 869500 -- (-1654.311) [-1655.992] (-1656.258) (-1655.350) * (-1655.603) (-1655.510) (-1656.610) [-1654.156] -- 0:00:08 870000 -- (-1655.514) [-1654.155] (-1655.138) (-1655.991) * (-1654.701) (-1661.323) (-1657.387) [-1653.810] -- 0:00:08 Average standard deviation of split frequencies: 0.005956 870500 -- [-1655.704] (-1656.350) (-1654.455) (-1655.738) * (-1653.378) (-1657.070) (-1658.799) [-1654.351] -- 0:00:08 871000 -- (-1654.818) (-1659.835) (-1654.123) [-1656.235] * (-1656.183) (-1655.283) (-1654.389) [-1654.783] -- 0:00:08 871500 -- (-1654.134) (-1655.749) [-1653.917] (-1656.677) * (-1654.708) [-1654.634] (-1655.488) (-1654.870) -- 0:00:08 872000 -- (-1654.537) [-1656.160] (-1654.255) (-1658.604) * [-1653.129] (-1662.087) (-1655.841) (-1655.339) -- 0:00:08 872500 -- [-1653.938] (-1656.641) (-1656.256) (-1656.556) * (-1655.410) (-1659.544) (-1661.144) [-1655.220] -- 0:00:08 873000 -- (-1656.682) (-1655.940) [-1658.290] (-1655.631) * (-1653.540) (-1658.191) [-1654.650] (-1662.571) -- 0:00:08 873500 -- (-1657.082) [-1653.463] (-1657.831) (-1654.940) * (-1654.853) (-1657.270) [-1655.783] (-1656.521) -- 0:00:08 874000 -- [-1654.520] (-1655.520) (-1654.618) (-1656.289) * (-1657.457) (-1656.457) (-1655.930) [-1655.609] -- 0:00:08 874500 -- (-1653.860) (-1653.740) [-1654.602] (-1655.162) * [-1654.857] (-1655.604) (-1654.888) (-1656.465) -- 0:00:08 875000 -- (-1655.519) [-1656.114] (-1654.722) (-1655.264) * (-1654.375) (-1654.813) (-1656.382) [-1655.715] -- 0:00:08 Average standard deviation of split frequencies: 0.006390 875500 -- (-1658.914) (-1656.066) [-1655.793] (-1654.984) * (-1655.563) [-1655.368] (-1655.699) (-1654.844) -- 0:00:07 876000 -- (-1656.105) (-1654.214) (-1656.520) [-1653.949] * (-1656.236) (-1656.419) [-1654.393] (-1654.416) -- 0:00:07 876500 -- (-1653.767) [-1656.510] (-1654.803) (-1655.341) * (-1654.209) (-1654.307) [-1655.225] (-1654.760) -- 0:00:07 877000 -- (-1653.617) [-1654.844] (-1653.729) (-1654.146) * (-1654.099) [-1655.730] (-1654.681) (-1655.308) -- 0:00:07 877500 -- (-1653.587) (-1656.213) (-1653.994) [-1654.661] * (-1656.167) (-1653.989) [-1655.158] (-1656.897) -- 0:00:07 878000 -- (-1656.588) [-1653.584] (-1655.991) (-1655.992) * (-1655.410) (-1653.543) [-1655.400] (-1655.633) -- 0:00:07 878500 -- (-1659.128) (-1659.879) (-1655.832) [-1655.118] * (-1654.085) (-1653.532) (-1657.737) [-1654.437] -- 0:00:07 879000 -- [-1654.838] (-1655.172) (-1656.862) (-1655.795) * (-1653.732) (-1654.221) (-1654.930) [-1654.071] -- 0:00:07 879500 -- (-1657.585) (-1653.674) [-1655.090] (-1654.096) * (-1655.654) (-1654.963) (-1654.948) [-1653.881] -- 0:00:07 880000 -- (-1655.333) [-1653.410] (-1654.591) (-1656.341) * (-1654.783) (-1657.964) [-1655.088] (-1654.051) -- 0:00:07 Average standard deviation of split frequencies: 0.006524 880500 -- (-1654.421) (-1654.432) [-1655.412] (-1661.179) * (-1654.782) [-1655.713] (-1653.594) (-1655.993) -- 0:00:07 881000 -- [-1657.231] (-1653.789) (-1654.183) (-1655.695) * (-1656.003) (-1655.031) (-1653.874) [-1656.631] -- 0:00:07 881500 -- (-1655.487) [-1655.203] (-1653.528) (-1655.058) * [-1658.322] (-1655.747) (-1655.568) (-1654.512) -- 0:00:07 882000 -- [-1654.309] (-1659.803) (-1654.561) (-1654.488) * (-1658.814) (-1654.759) (-1653.473) [-1653.442] -- 0:00:07 882500 -- (-1654.359) (-1656.532) [-1654.603] (-1655.067) * [-1655.513] (-1655.815) (-1653.844) (-1654.019) -- 0:00:07 883000 -- (-1655.629) [-1655.009] (-1655.773) (-1654.693) * [-1654.369] (-1657.060) (-1654.333) (-1655.037) -- 0:00:07 883500 -- [-1659.248] (-1656.710) (-1657.977) (-1657.256) * (-1662.371) (-1656.984) [-1656.325] (-1654.435) -- 0:00:07 884000 -- [-1656.924] (-1655.260) (-1655.493) (-1656.382) * (-1653.790) [-1655.026] (-1655.109) (-1655.206) -- 0:00:07 884500 -- (-1657.380) [-1653.911] (-1657.714) (-1659.584) * (-1656.062) (-1661.467) [-1655.360] (-1654.583) -- 0:00:07 885000 -- [-1655.638] (-1653.956) (-1654.822) (-1656.833) * (-1654.704) [-1655.365] (-1655.721) (-1657.326) -- 0:00:07 Average standard deviation of split frequencies: 0.006684 885500 -- (-1656.485) (-1654.814) [-1654.089] (-1656.488) * (-1653.682) [-1656.884] (-1657.249) (-1658.634) -- 0:00:07 886000 -- (-1653.945) (-1654.761) [-1657.453] (-1658.538) * [-1656.577] (-1655.593) (-1654.863) (-1659.775) -- 0:00:07 886500 -- (-1656.652) (-1657.469) (-1658.245) [-1656.502] * (-1658.579) [-1654.212] (-1661.401) (-1655.327) -- 0:00:07 887000 -- [-1656.652] (-1655.288) (-1656.693) (-1656.635) * (-1657.276) (-1654.391) [-1655.464] (-1657.317) -- 0:00:07 887500 -- [-1654.845] (-1660.322) (-1658.195) (-1658.386) * (-1660.172) [-1656.532] (-1656.374) (-1658.349) -- 0:00:07 888000 -- (-1655.304) [-1660.017] (-1656.029) (-1654.577) * [-1654.261] (-1654.107) (-1655.380) (-1661.486) -- 0:00:07 888500 -- (-1656.803) (-1654.954) [-1654.671] (-1654.501) * (-1656.359) (-1658.676) (-1655.343) [-1655.292] -- 0:00:07 889000 -- (-1656.184) [-1658.209] (-1654.338) (-1663.479) * [-1655.725] (-1658.116) (-1654.939) (-1657.622) -- 0:00:07 889500 -- (-1659.339) (-1653.902) (-1654.501) [-1656.647] * (-1656.320) [-1655.811] (-1653.581) (-1657.706) -- 0:00:07 890000 -- [-1655.084] (-1654.345) (-1654.362) (-1657.006) * (-1654.955) [-1654.884] (-1654.375) (-1654.563) -- 0:00:07 Average standard deviation of split frequencies: 0.006682 890500 -- (-1656.922) [-1655.326] (-1655.792) (-1655.296) * [-1657.228] (-1659.565) (-1654.874) (-1654.734) -- 0:00:07 891000 -- (-1656.136) [-1655.827] (-1657.155) (-1654.570) * (-1655.440) [-1655.859] (-1656.862) (-1654.242) -- 0:00:06 891500 -- [-1654.664] (-1661.965) (-1658.507) (-1655.033) * (-1655.733) [-1658.814] (-1659.953) (-1657.685) -- 0:00:06 892000 -- [-1654.640] (-1663.889) (-1657.934) (-1654.442) * (-1655.506) (-1656.089) (-1654.875) [-1654.394] -- 0:00:06 892500 -- (-1656.008) (-1656.181) (-1657.751) [-1653.918] * (-1656.144) [-1654.270] (-1653.978) (-1655.246) -- 0:00:06 893000 -- [-1657.108] (-1653.639) (-1655.390) (-1654.191) * (-1657.005) (-1654.584) [-1653.507] (-1655.119) -- 0:00:06 893500 -- [-1655.229] (-1658.798) (-1658.105) (-1657.114) * [-1657.640] (-1653.602) (-1658.688) (-1655.175) -- 0:00:06 894000 -- (-1654.253) (-1654.582) [-1654.740] (-1657.872) * (-1656.240) (-1655.426) (-1658.849) [-1655.200] -- 0:00:06 894500 -- (-1655.023) (-1655.385) [-1656.673] (-1656.522) * [-1654.478] (-1659.160) (-1656.215) (-1654.828) -- 0:00:06 895000 -- (-1654.599) (-1654.753) (-1657.160) [-1656.051] * (-1654.691) (-1656.559) (-1654.898) [-1658.754] -- 0:00:06 Average standard deviation of split frequencies: 0.006905 895500 -- (-1657.544) (-1654.959) (-1658.773) [-1657.472] * (-1656.267) (-1655.352) [-1656.981] (-1656.506) -- 0:00:06 896000 -- (-1654.007) (-1655.586) [-1658.110] (-1656.762) * (-1654.528) (-1657.339) [-1655.636] (-1658.395) -- 0:00:06 896500 -- [-1653.580] (-1657.037) (-1656.249) (-1655.138) * (-1657.431) [-1656.347] (-1655.433) (-1661.861) -- 0:00:06 897000 -- (-1653.453) (-1659.365) (-1654.797) [-1654.218] * [-1655.375] (-1657.636) (-1655.904) (-1658.033) -- 0:00:06 897500 -- (-1654.098) [-1656.862] (-1654.821) (-1654.897) * [-1654.336] (-1653.517) (-1658.775) (-1657.904) -- 0:00:06 898000 -- [-1653.810] (-1655.658) (-1657.929) (-1653.938) * (-1654.864) [-1655.963] (-1654.679) (-1653.672) -- 0:00:06 898500 -- [-1655.239] (-1655.205) (-1654.542) (-1658.003) * (-1656.717) (-1659.356) [-1656.092] (-1655.754) -- 0:00:06 899000 -- [-1656.303] (-1656.809) (-1656.476) (-1657.533) * (-1657.420) [-1656.557] (-1657.293) (-1657.660) -- 0:00:06 899500 -- [-1656.540] (-1658.201) (-1658.063) (-1654.638) * (-1658.009) (-1654.473) (-1654.329) [-1653.516] -- 0:00:06 900000 -- (-1657.055) [-1657.055] (-1655.548) (-1656.589) * [-1655.119] (-1659.231) (-1654.517) (-1656.660) -- 0:00:06 Average standard deviation of split frequencies: 0.006968 900500 -- (-1655.915) [-1653.593] (-1658.963) (-1655.443) * (-1658.112) (-1654.910) [-1653.768] (-1654.969) -- 0:00:06 901000 -- (-1655.449) [-1654.058] (-1656.945) (-1654.012) * (-1660.782) (-1654.457) [-1659.025] (-1654.851) -- 0:00:06 901500 -- (-1654.444) (-1655.385) [-1653.950] (-1656.695) * (-1653.626) (-1654.830) [-1655.263] (-1655.683) -- 0:00:06 902000 -- [-1656.150] (-1654.826) (-1658.558) (-1655.928) * (-1653.626) (-1654.491) [-1654.247] (-1656.379) -- 0:00:06 902500 -- [-1656.236] (-1655.270) (-1655.214) (-1656.356) * [-1653.813] (-1654.432) (-1653.904) (-1654.788) -- 0:00:06 903000 -- (-1653.756) (-1653.861) [-1658.041] (-1658.277) * (-1656.322) [-1655.207] (-1656.058) (-1659.788) -- 0:00:06 903500 -- (-1653.442) (-1654.724) (-1655.399) [-1659.562] * (-1655.604) (-1658.682) (-1656.730) [-1658.723] -- 0:00:06 904000 -- (-1654.449) [-1654.128] (-1655.344) (-1657.058) * (-1658.879) [-1656.889] (-1656.252) (-1657.976) -- 0:00:06 904500 -- [-1654.537] (-1654.368) (-1654.359) (-1656.816) * (-1655.526) (-1655.542) (-1656.587) [-1654.986] -- 0:00:06 905000 -- [-1654.497] (-1659.673) (-1655.308) (-1656.899) * (-1657.151) (-1654.547) [-1654.245] (-1654.525) -- 0:00:06 Average standard deviation of split frequencies: 0.006569 905500 -- [-1661.535] (-1657.030) (-1656.728) (-1654.220) * (-1653.745) (-1662.092) [-1657.071] (-1654.049) -- 0:00:06 906000 -- (-1654.497) (-1655.861) [-1654.284] (-1655.114) * (-1654.304) (-1656.422) [-1654.351] (-1653.978) -- 0:00:06 906500 -- [-1653.862] (-1657.266) (-1656.229) (-1655.609) * (-1655.457) (-1657.318) (-1654.262) [-1654.981] -- 0:00:05 907000 -- (-1655.844) [-1656.084] (-1658.682) (-1655.754) * (-1655.527) (-1655.542) [-1654.637] (-1654.896) -- 0:00:05 907500 -- (-1655.562) [-1656.095] (-1655.684) (-1657.360) * [-1655.143] (-1658.330) (-1655.188) (-1655.344) -- 0:00:05 908000 -- (-1654.674) (-1657.182) (-1657.054) [-1654.043] * (-1660.218) (-1654.373) [-1653.880] (-1654.518) -- 0:00:05 908500 -- [-1656.280] (-1654.996) (-1661.362) (-1655.649) * (-1659.629) (-1655.956) [-1656.176] (-1653.565) -- 0:00:05 909000 -- (-1655.839) (-1658.886) [-1657.636] (-1654.890) * [-1656.577] (-1658.442) (-1657.447) (-1653.832) -- 0:00:05 909500 -- (-1653.286) [-1654.437] (-1661.186) (-1656.279) * (-1659.771) (-1656.549) (-1654.446) [-1656.004] -- 0:00:05 910000 -- (-1654.910) (-1654.370) (-1658.958) [-1655.415] * (-1663.111) (-1656.305) [-1654.813] (-1654.368) -- 0:00:05 Average standard deviation of split frequencies: 0.006341 910500 -- (-1655.142) (-1654.832) [-1657.400] (-1657.696) * (-1660.635) (-1655.200) [-1654.977] (-1653.669) -- 0:00:05 911000 -- (-1654.684) (-1660.938) [-1656.380] (-1654.590) * (-1655.234) (-1655.279) (-1654.933) [-1653.858] -- 0:00:05 911500 -- (-1657.652) (-1655.300) (-1660.037) [-1655.444] * (-1654.229) [-1655.086] (-1655.432) (-1654.897) -- 0:00:05 912000 -- [-1655.360] (-1654.621) (-1655.895) (-1654.951) * (-1658.083) (-1655.135) [-1655.314] (-1655.749) -- 0:00:05 912500 -- (-1663.371) (-1657.290) (-1654.832) [-1654.596] * (-1656.657) (-1656.733) (-1656.106) [-1654.781] -- 0:00:05 913000 -- (-1655.460) (-1657.905) [-1654.432] (-1655.012) * (-1655.874) (-1656.940) (-1653.705) [-1656.539] -- 0:00:05 913500 -- (-1656.496) [-1660.686] (-1655.068) (-1659.600) * (-1656.203) [-1654.117] (-1653.891) (-1655.654) -- 0:00:05 914000 -- (-1657.235) [-1654.887] (-1656.766) (-1655.021) * (-1658.015) (-1657.109) [-1653.970] (-1657.373) -- 0:00:05 914500 -- [-1655.764] (-1654.585) (-1657.365) (-1655.281) * (-1655.014) (-1656.328) (-1655.285) [-1657.052] -- 0:00:05 915000 -- (-1655.139) (-1654.839) (-1654.359) [-1658.909] * (-1654.900) (-1658.785) (-1654.674) [-1657.205] -- 0:00:05 Average standard deviation of split frequencies: 0.006240 915500 -- [-1654.756] (-1656.854) (-1657.388) (-1657.210) * (-1654.528) (-1656.849) [-1654.099] (-1657.609) -- 0:00:05 916000 -- (-1655.551) [-1656.529] (-1655.146) (-1658.525) * (-1654.199) (-1657.560) (-1658.433) [-1655.205] -- 0:00:05 916500 -- (-1654.356) (-1660.316) (-1654.687) [-1655.830] * (-1654.664) (-1654.463) (-1653.957) [-1654.797] -- 0:00:05 917000 -- (-1653.839) (-1654.977) [-1653.557] (-1654.192) * [-1654.084] (-1657.235) (-1656.997) (-1656.470) -- 0:00:05 917500 -- [-1653.541] (-1655.551) (-1655.487) (-1654.834) * [-1654.843] (-1657.107) (-1657.305) (-1654.181) -- 0:00:05 918000 -- (-1657.227) [-1655.114] (-1654.604) (-1653.469) * (-1656.091) [-1653.698] (-1659.236) (-1654.237) -- 0:00:05 918500 -- (-1656.857) (-1659.918) (-1657.054) [-1653.764] * (-1656.257) (-1661.017) (-1657.914) [-1654.657] -- 0:00:05 919000 -- [-1654.230] (-1654.261) (-1657.347) (-1655.918) * (-1655.086) (-1656.681) [-1658.065] (-1656.033) -- 0:00:05 919500 -- [-1655.417] (-1654.822) (-1657.859) (-1656.742) * (-1653.544) [-1655.063] (-1656.714) (-1654.761) -- 0:00:05 920000 -- [-1653.931] (-1654.718) (-1655.382) (-1656.625) * (-1653.797) (-1660.649) [-1654.381] (-1655.481) -- 0:00:05 Average standard deviation of split frequencies: 0.005974 920500 -- (-1653.918) (-1655.572) [-1656.016] (-1653.989) * (-1657.133) (-1656.908) [-1654.319] (-1658.027) -- 0:00:05 921000 -- [-1654.967] (-1654.302) (-1654.325) (-1654.319) * (-1654.867) [-1653.621] (-1654.164) (-1656.636) -- 0:00:05 921500 -- (-1653.523) (-1653.988) (-1657.452) [-1655.327] * [-1655.681] (-1658.113) (-1654.057) (-1657.885) -- 0:00:05 922000 -- (-1660.813) (-1655.819) [-1655.911] (-1655.775) * (-1655.688) [-1655.459] (-1654.845) (-1654.544) -- 0:00:04 922500 -- (-1655.946) (-1656.611) (-1655.717) [-1653.954] * (-1657.850) (-1658.312) (-1658.513) [-1654.547] -- 0:00:04 923000 -- (-1660.429) [-1656.508] (-1660.288) (-1655.161) * (-1658.740) (-1657.144) [-1654.112] (-1655.872) -- 0:00:04 923500 -- (-1656.523) (-1654.412) (-1656.008) [-1654.779] * (-1659.423) (-1659.547) [-1655.799] (-1656.867) -- 0:00:04 924000 -- (-1656.536) (-1656.978) [-1656.453] (-1653.575) * (-1656.493) (-1654.375) (-1657.427) [-1656.093] -- 0:00:04 924500 -- [-1653.609] (-1657.262) (-1656.545) (-1653.487) * (-1659.976) (-1655.150) [-1656.973] (-1655.377) -- 0:00:04 925000 -- (-1654.948) (-1660.354) (-1657.566) [-1654.442] * (-1657.259) [-1657.091] (-1656.175) (-1654.593) -- 0:00:04 Average standard deviation of split frequencies: 0.006211 925500 -- [-1655.027] (-1659.275) (-1655.944) (-1658.119) * (-1659.579) [-1655.882] (-1656.096) (-1656.906) -- 0:00:04 926000 -- [-1656.590] (-1655.161) (-1656.706) (-1659.595) * (-1656.159) (-1659.941) (-1654.742) [-1653.930] -- 0:00:04 926500 -- (-1657.291) (-1659.084) [-1654.695] (-1655.949) * (-1659.213) [-1660.588] (-1654.123) (-1653.504) -- 0:00:04 927000 -- (-1654.866) (-1659.780) [-1658.004] (-1659.112) * [-1657.586] (-1656.323) (-1654.824) (-1659.753) -- 0:00:04 927500 -- (-1656.783) (-1659.582) [-1656.433] (-1656.884) * (-1656.457) [-1656.425] (-1659.634) (-1658.044) -- 0:00:04 928000 -- (-1655.472) [-1654.401] (-1656.866) (-1655.232) * [-1657.491] (-1655.282) (-1658.429) (-1659.271) -- 0:00:04 928500 -- (-1655.574) (-1653.531) [-1656.672] (-1655.602) * [-1654.861] (-1655.231) (-1654.938) (-1660.059) -- 0:00:04 929000 -- (-1654.591) [-1654.043] (-1655.911) (-1655.727) * (-1653.534) (-1655.145) [-1654.060] (-1657.829) -- 0:00:04 929500 -- [-1654.564] (-1661.392) (-1655.961) (-1654.793) * (-1655.014) (-1658.986) (-1653.788) [-1657.573] -- 0:00:04 930000 -- (-1653.740) (-1657.917) [-1655.058] (-1654.762) * (-1654.938) (-1657.182) (-1656.092) [-1654.880] -- 0:00:04 Average standard deviation of split frequencies: 0.006247 930500 -- (-1654.182) (-1655.341) (-1655.806) [-1655.747] * (-1655.813) [-1664.701] (-1657.888) (-1655.167) -- 0:00:04 931000 -- (-1655.964) (-1661.177) [-1654.205] (-1654.878) * (-1654.688) (-1657.011) (-1655.084) [-1655.560] -- 0:00:04 931500 -- (-1653.255) (-1654.328) [-1655.972] (-1653.850) * (-1654.226) (-1657.560) [-1655.166] (-1656.218) -- 0:00:04 932000 -- (-1654.253) (-1655.999) (-1655.120) [-1654.439] * (-1654.647) [-1658.523] (-1657.333) (-1654.490) -- 0:00:04 932500 -- (-1655.377) (-1657.421) [-1657.475] (-1657.921) * (-1656.226) [-1655.273] (-1657.580) (-1653.449) -- 0:00:04 933000 -- (-1658.011) [-1656.008] (-1654.357) (-1658.785) * (-1655.731) (-1655.066) (-1654.669) [-1653.752] -- 0:00:04 933500 -- (-1656.205) [-1654.550] (-1657.574) (-1653.814) * (-1653.847) (-1654.916) (-1655.634) [-1659.558] -- 0:00:04 934000 -- (-1657.779) [-1656.516] (-1654.385) (-1654.501) * (-1654.996) (-1656.569) (-1657.376) [-1657.452] -- 0:00:04 934500 -- (-1659.311) (-1654.588) (-1657.510) [-1656.188] * (-1654.808) [-1657.805] (-1658.206) (-1655.558) -- 0:00:04 935000 -- (-1661.492) (-1659.248) (-1657.187) [-1655.138] * [-1654.535] (-1658.757) (-1655.796) (-1655.157) -- 0:00:04 Average standard deviation of split frequencies: 0.006346 935500 -- [-1657.434] (-1657.215) (-1657.499) (-1657.115) * [-1655.989] (-1659.146) (-1654.634) (-1654.996) -- 0:00:04 936000 -- (-1656.618) (-1654.040) (-1657.068) [-1655.101] * (-1655.526) (-1657.990) [-1656.629] (-1655.148) -- 0:00:04 936500 -- [-1654.054] (-1660.180) (-1655.812) (-1655.886) * (-1655.733) (-1655.116) (-1657.619) [-1655.760] -- 0:00:04 937000 -- [-1656.440] (-1657.053) (-1654.822) (-1655.811) * (-1656.963) (-1655.292) [-1654.187] (-1656.687) -- 0:00:04 937500 -- [-1655.027] (-1653.590) (-1656.860) (-1656.599) * [-1654.552] (-1653.512) (-1654.676) (-1655.388) -- 0:00:04 938000 -- (-1657.304) (-1655.277) (-1661.594) [-1655.552] * (-1656.075) [-1653.933] (-1654.544) (-1654.284) -- 0:00:03 938500 -- [-1655.952] (-1654.451) (-1661.251) (-1655.479) * (-1656.237) (-1656.080) (-1655.609) [-1658.199] -- 0:00:03 939000 -- (-1656.465) (-1656.791) (-1654.498) [-1656.912] * [-1656.500] (-1658.337) (-1657.197) (-1655.715) -- 0:00:03 939500 -- (-1664.593) [-1661.534] (-1655.177) (-1655.513) * (-1654.696) (-1659.388) [-1655.584] (-1655.844) -- 0:00:03 940000 -- [-1660.683] (-1656.090) (-1656.221) (-1655.389) * (-1656.911) (-1658.939) [-1653.178] (-1655.039) -- 0:00:03 Average standard deviation of split frequencies: 0.006415 940500 -- (-1657.544) (-1655.615) (-1656.959) [-1657.652] * (-1655.540) (-1653.667) [-1654.877] (-1655.257) -- 0:00:03 941000 -- (-1655.825) (-1654.736) (-1657.606) [-1655.177] * (-1656.660) [-1653.588] (-1654.400) (-1655.851) -- 0:00:03 941500 -- (-1656.122) (-1653.779) (-1653.917) [-1656.980] * (-1654.599) (-1654.956) (-1653.851) [-1654.463] -- 0:00:03 942000 -- (-1658.882) [-1655.314] (-1655.758) (-1658.630) * (-1655.535) [-1655.278] (-1661.890) (-1658.484) -- 0:00:03 942500 -- (-1658.545) (-1656.293) [-1655.698] (-1656.408) * (-1654.113) (-1653.592) [-1654.749] (-1654.787) -- 0:00:03 943000 -- [-1658.172] (-1657.146) (-1654.219) (-1656.794) * (-1656.615) [-1655.523] (-1654.012) (-1653.852) -- 0:00:03 943500 -- (-1654.103) [-1655.792] (-1655.553) (-1654.952) * [-1656.272] (-1656.712) (-1654.666) (-1657.504) -- 0:00:03 944000 -- (-1655.979) (-1653.923) [-1654.889] (-1654.959) * (-1657.754) (-1656.173) [-1655.710] (-1654.685) -- 0:00:03 944500 -- (-1656.289) (-1655.468) [-1654.024] (-1655.667) * (-1654.364) [-1658.139] (-1656.388) (-1654.676) -- 0:00:03 945000 -- (-1655.591) (-1654.589) (-1655.407) [-1653.448] * [-1656.585] (-1653.642) (-1655.254) (-1654.187) -- 0:00:03 Average standard deviation of split frequencies: 0.006312 945500 -- (-1654.159) (-1656.833) [-1656.250] (-1653.710) * [-1656.727] (-1655.581) (-1655.339) (-1654.019) -- 0:00:03 946000 -- (-1654.072) (-1658.468) [-1655.985] (-1654.272) * (-1657.006) (-1657.416) (-1655.214) [-1653.921] -- 0:00:03 946500 -- (-1654.451) (-1658.779) [-1655.870] (-1654.025) * (-1657.621) (-1656.577) [-1656.223] (-1654.241) -- 0:00:03 947000 -- (-1655.665) (-1656.236) [-1657.562] (-1653.817) * (-1653.655) (-1656.095) [-1654.798] (-1655.070) -- 0:00:03 947500 -- (-1660.859) (-1658.041) [-1658.482] (-1656.209) * (-1653.721) [-1653.707] (-1656.525) (-1655.789) -- 0:00:03 948000 -- (-1658.756) [-1656.488] (-1654.786) (-1653.636) * [-1657.277] (-1654.401) (-1655.536) (-1657.122) -- 0:00:03 948500 -- (-1656.101) (-1658.945) [-1654.021] (-1654.477) * (-1657.499) [-1655.121] (-1656.151) (-1655.561) -- 0:00:03 949000 -- (-1654.191) (-1659.134) [-1654.269] (-1655.398) * (-1654.847) (-1654.349) (-1656.662) [-1659.956] -- 0:00:03 949500 -- (-1654.715) [-1656.876] (-1654.790) (-1655.411) * (-1654.738) (-1655.170) (-1656.737) [-1657.103] -- 0:00:03 950000 -- (-1654.766) (-1655.708) (-1655.290) [-1653.960] * [-1653.847] (-1654.063) (-1662.045) (-1656.475) -- 0:00:03 Average standard deviation of split frequencies: 0.006512 950500 -- (-1654.611) [-1655.692] (-1656.866) (-1654.742) * (-1654.544) (-1656.160) [-1656.609] (-1656.142) -- 0:00:03 951000 -- (-1655.741) (-1655.580) [-1654.994] (-1660.803) * (-1654.703) (-1655.547) [-1657.219] (-1655.693) -- 0:00:03 951500 -- [-1657.169] (-1655.583) (-1657.774) (-1655.958) * (-1656.681) (-1654.607) (-1654.293) [-1657.256] -- 0:00:03 952000 -- [-1654.897] (-1660.711) (-1657.450) (-1653.747) * (-1662.195) [-1654.036] (-1656.136) (-1658.480) -- 0:00:03 952500 -- (-1653.546) (-1656.660) (-1653.710) [-1654.934] * (-1655.774) [-1656.880] (-1656.617) (-1656.294) -- 0:00:03 953000 -- [-1657.347] (-1656.770) (-1654.926) (-1658.460) * (-1654.831) (-1654.561) [-1654.255] (-1655.887) -- 0:00:03 953500 -- (-1656.365) [-1655.176] (-1655.680) (-1655.720) * (-1654.529) [-1654.050] (-1657.166) (-1655.263) -- 0:00:02 954000 -- (-1655.733) (-1655.204) (-1655.469) [-1654.296] * (-1653.906) [-1655.563] (-1657.595) (-1654.377) -- 0:00:02 954500 -- (-1656.178) (-1657.467) (-1655.623) [-1655.787] * [-1653.612] (-1655.585) (-1657.325) (-1653.901) -- 0:00:02 955000 -- (-1654.658) (-1657.757) [-1655.803] (-1660.620) * [-1655.337] (-1653.988) (-1655.985) (-1654.711) -- 0:00:02 Average standard deviation of split frequencies: 0.006312 955500 -- [-1653.819] (-1656.926) (-1655.965) (-1656.243) * (-1654.685) [-1654.264] (-1655.182) (-1655.473) -- 0:00:02 956000 -- (-1654.738) (-1656.724) [-1655.382] (-1654.330) * (-1654.650) (-1656.180) [-1656.323] (-1657.311) -- 0:00:02 956500 -- [-1656.597] (-1655.783) (-1654.261) (-1655.381) * (-1659.946) [-1654.377] (-1656.666) (-1655.832) -- 0:00:02 957000 -- [-1655.885] (-1655.054) (-1654.193) (-1654.443) * (-1653.479) [-1653.986] (-1655.455) (-1655.053) -- 0:00:02 957500 -- (-1656.155) [-1657.476] (-1654.632) (-1653.456) * (-1658.736) (-1654.040) (-1658.944) [-1654.291] -- 0:00:02 958000 -- (-1654.305) (-1661.167) (-1656.043) [-1653.569] * (-1656.515) [-1655.785] (-1655.573) (-1654.466) -- 0:00:02 958500 -- [-1661.923] (-1657.202) (-1655.428) (-1655.478) * (-1657.934) [-1655.719] (-1656.535) (-1653.389) -- 0:00:02 959000 -- [-1653.594] (-1657.612) (-1654.482) (-1660.326) * (-1657.217) (-1655.799) [-1655.614] (-1653.526) -- 0:00:02 959500 -- (-1656.731) (-1658.525) [-1655.131] (-1655.675) * [-1653.815] (-1655.277) (-1654.577) (-1655.303) -- 0:00:02 960000 -- (-1657.133) (-1654.999) (-1660.588) [-1654.908] * (-1656.137) [-1658.881] (-1656.702) (-1654.247) -- 0:00:02 Average standard deviation of split frequencies: 0.006019 960500 -- (-1657.718) (-1656.021) [-1655.818] (-1654.515) * (-1663.030) (-1653.445) (-1653.724) [-1655.245] -- 0:00:02 961000 -- (-1655.183) (-1657.445) [-1655.863] (-1654.216) * [-1657.427] (-1654.097) (-1653.703) (-1655.255) -- 0:00:02 961500 -- [-1654.900] (-1658.175) (-1655.966) (-1653.628) * (-1659.926) (-1654.978) (-1654.310) [-1656.138] -- 0:00:02 962000 -- (-1658.107) (-1655.533) (-1653.558) [-1655.276] * (-1656.256) (-1657.542) [-1658.402] (-1661.109) -- 0:00:02 962500 -- [-1654.874] (-1656.056) (-1653.558) (-1656.609) * (-1660.247) (-1657.816) (-1655.053) [-1655.989] -- 0:00:02 963000 -- (-1655.996) (-1657.658) (-1656.291) [-1654.219] * (-1657.986) (-1657.293) (-1655.252) [-1657.734] -- 0:00:02 963500 -- [-1655.778] (-1659.202) (-1654.074) (-1654.794) * [-1655.898] (-1655.646) (-1654.324) (-1656.180) -- 0:00:02 964000 -- (-1656.793) [-1659.079] (-1656.087) (-1653.774) * (-1654.258) [-1657.472] (-1653.967) (-1659.167) -- 0:00:02 964500 -- (-1658.110) (-1658.680) [-1654.424] (-1655.640) * (-1655.904) (-1655.382) [-1655.837] (-1655.146) -- 0:00:02 965000 -- [-1654.992] (-1653.856) (-1653.847) (-1654.656) * (-1656.388) (-1659.003) [-1653.979] (-1655.148) -- 0:00:02 Average standard deviation of split frequencies: 0.005917 965500 -- (-1657.914) (-1655.479) (-1654.059) [-1656.073] * (-1656.118) [-1655.773] (-1654.142) (-1656.185) -- 0:00:02 966000 -- (-1659.837) (-1654.225) (-1656.889) [-1656.229] * (-1654.578) [-1655.545] (-1656.296) (-1655.001) -- 0:00:02 966500 -- [-1654.910] (-1654.821) (-1654.171) (-1657.130) * [-1654.098] (-1656.287) (-1654.338) (-1655.815) -- 0:00:02 967000 -- [-1657.523] (-1655.807) (-1656.305) (-1655.226) * [-1653.504] (-1656.922) (-1656.884) (-1657.053) -- 0:00:02 967500 -- [-1656.810] (-1656.373) (-1658.784) (-1654.448) * (-1656.509) (-1654.287) (-1660.726) [-1655.931] -- 0:00:02 968000 -- (-1655.974) [-1654.158] (-1653.933) (-1658.052) * (-1654.953) (-1656.257) (-1655.700) [-1656.239] -- 0:00:02 968500 -- (-1653.660) (-1653.689) [-1654.713] (-1657.891) * (-1653.787) [-1655.840] (-1655.226) (-1654.910) -- 0:00:02 969000 -- (-1654.806) [-1653.689] (-1654.606) (-1655.918) * (-1654.022) (-1658.766) [-1655.783] (-1655.646) -- 0:00:01 969500 -- (-1658.796) (-1654.105) (-1654.101) [-1653.813] * (-1654.306) [-1653.728] (-1657.365) (-1656.364) -- 0:00:01 970000 -- (-1654.479) (-1655.381) [-1655.757] (-1653.925) * (-1655.489) (-1654.707) (-1658.084) [-1655.845] -- 0:00:01 Average standard deviation of split frequencies: 0.006131 970500 -- (-1657.787) [-1654.844] (-1655.986) (-1655.112) * (-1654.750) [-1653.999] (-1655.614) (-1655.141) -- 0:00:01 971000 -- (-1657.660) (-1655.723) [-1655.260] (-1656.751) * (-1655.034) [-1655.239] (-1655.508) (-1654.123) -- 0:00:01 971500 -- (-1657.916) [-1655.413] (-1654.655) (-1658.143) * (-1656.769) (-1657.866) (-1655.412) [-1654.610] -- 0:00:01 972000 -- (-1657.754) (-1655.732) [-1655.706] (-1655.705) * (-1655.403) (-1658.596) [-1653.898] (-1653.215) -- 0:00:01 972500 -- (-1660.117) (-1655.395) [-1657.948] (-1656.419) * (-1654.481) [-1655.418] (-1661.614) (-1658.161) -- 0:00:01 973000 -- (-1655.892) (-1654.874) (-1654.866) [-1655.276] * (-1655.006) [-1657.008] (-1659.688) (-1660.394) -- 0:00:01 973500 -- (-1657.256) (-1656.162) (-1654.757) [-1656.009] * (-1653.830) (-1654.089) [-1658.611] (-1659.383) -- 0:00:01 974000 -- (-1659.938) [-1655.776] (-1660.917) (-1654.999) * [-1653.727] (-1655.634) (-1659.587) (-1655.882) -- 0:00:01 974500 -- (-1654.816) (-1655.822) [-1654.071] (-1660.678) * (-1655.109) (-1661.996) [-1657.318] (-1654.261) -- 0:00:01 975000 -- (-1655.551) (-1656.855) [-1653.502] (-1655.606) * [-1654.792] (-1656.706) (-1658.055) (-1655.927) -- 0:00:01 Average standard deviation of split frequencies: 0.006430 975500 -- (-1655.355) (-1661.462) [-1655.377] (-1655.343) * (-1655.656) [-1653.867] (-1656.496) (-1656.839) -- 0:00:01 976000 -- (-1658.029) (-1662.959) (-1653.950) [-1655.099] * [-1655.676] (-1655.671) (-1656.114) (-1659.805) -- 0:00:01 976500 -- (-1655.844) (-1655.724) (-1655.647) [-1654.801] * (-1653.650) (-1654.698) [-1654.174] (-1655.173) -- 0:00:01 977000 -- (-1661.433) (-1655.186) [-1655.150] (-1654.009) * (-1654.643) (-1653.708) (-1654.073) [-1659.484] -- 0:00:01 977500 -- (-1656.407) (-1653.946) (-1656.467) [-1654.490] * [-1654.743] (-1654.560) (-1654.697) (-1660.582) -- 0:00:01 978000 -- [-1654.842] (-1657.491) (-1655.569) (-1654.730) * (-1653.380) (-1653.910) (-1654.739) [-1655.566] -- 0:00:01 978500 -- (-1655.574) (-1658.532) [-1655.569] (-1654.708) * (-1653.433) (-1653.818) [-1655.676] (-1659.616) -- 0:00:01 979000 -- (-1654.985) (-1654.721) (-1657.239) [-1654.989] * (-1654.090) (-1653.267) (-1653.777) [-1656.031] -- 0:00:01 979500 -- (-1655.229) (-1654.871) [-1653.529] (-1654.323) * [-1654.614] (-1655.580) (-1657.688) (-1659.794) -- 0:00:01 980000 -- (-1654.618) [-1655.293] (-1653.923) (-1655.086) * [-1658.242] (-1653.534) (-1659.407) (-1658.595) -- 0:00:01 Average standard deviation of split frequencies: 0.006890 980500 -- (-1654.701) [-1656.328] (-1653.334) (-1655.108) * [-1658.281] (-1655.074) (-1658.660) (-1657.090) -- 0:00:01 981000 -- (-1655.105) (-1660.077) [-1656.107] (-1654.469) * (-1654.518) [-1654.714] (-1660.575) (-1653.577) -- 0:00:01 981500 -- [-1655.209] (-1656.820) (-1658.473) (-1654.544) * [-1656.939] (-1655.276) (-1655.777) (-1653.940) -- 0:00:01 982000 -- [-1655.441] (-1655.635) (-1656.565) (-1655.178) * [-1654.974] (-1654.383) (-1659.487) (-1655.770) -- 0:00:01 982500 -- [-1657.377] (-1654.520) (-1656.472) (-1655.899) * (-1655.339) (-1660.841) (-1654.311) [-1655.642] -- 0:00:01 983000 -- (-1662.787) [-1654.456] (-1661.269) (-1656.159) * (-1654.446) (-1657.258) (-1655.950) [-1655.601] -- 0:00:01 983500 -- (-1655.736) (-1654.883) [-1663.991] (-1654.524) * (-1655.219) (-1654.778) [-1654.448] (-1654.669) -- 0:00:01 984000 -- (-1656.433) (-1654.564) (-1664.082) [-1653.951] * [-1657.843] (-1655.567) (-1655.044) (-1655.481) -- 0:00:01 984500 -- (-1655.095) [-1657.522] (-1656.257) (-1653.832) * [-1656.293] (-1658.811) (-1655.831) (-1654.225) -- 0:00:00 985000 -- [-1653.736] (-1655.316) (-1656.815) (-1659.506) * (-1656.786) (-1656.835) (-1656.536) [-1655.104] -- 0:00:00 Average standard deviation of split frequencies: 0.006757 985500 -- (-1653.777) (-1654.209) [-1655.477] (-1657.533) * (-1653.880) (-1655.801) [-1655.686] (-1656.237) -- 0:00:00 986000 -- (-1656.518) (-1657.723) [-1656.433] (-1661.467) * [-1653.844] (-1658.680) (-1656.047) (-1654.814) -- 0:00:00 986500 -- (-1655.585) (-1653.883) (-1656.685) [-1654.964] * (-1653.844) [-1654.026] (-1656.917) (-1656.317) -- 0:00:00 987000 -- (-1655.923) (-1654.135) [-1654.909] (-1656.218) * [-1655.439] (-1654.769) (-1655.364) (-1657.508) -- 0:00:00 987500 -- [-1654.144] (-1654.491) (-1654.693) (-1655.544) * [-1654.620] (-1656.120) (-1656.101) (-1654.503) -- 0:00:00 988000 -- [-1653.450] (-1654.210) (-1660.476) (-1660.067) * (-1656.340) (-1655.350) (-1656.789) [-1656.244] -- 0:00:00 988500 -- (-1657.144) (-1657.342) [-1658.415] (-1657.775) * (-1653.272) [-1656.446] (-1662.285) (-1654.867) -- 0:00:00 989000 -- (-1660.605) (-1656.865) [-1655.612] (-1655.597) * (-1653.669) [-1654.688] (-1656.859) (-1655.035) -- 0:00:00 989500 -- (-1655.079) (-1655.901) [-1656.318] (-1657.550) * (-1654.973) (-1654.566) (-1656.565) [-1656.183] -- 0:00:00 990000 -- (-1656.252) (-1653.895) (-1656.399) [-1656.256] * [-1654.432] (-1654.646) (-1655.627) (-1655.581) -- 0:00:00 Average standard deviation of split frequencies: 0.006916 990500 -- [-1655.649] (-1653.870) (-1656.937) (-1655.081) * [-1656.204] (-1655.141) (-1655.449) (-1654.877) -- 0:00:00 991000 -- (-1654.982) [-1654.050] (-1656.694) (-1655.940) * (-1659.969) (-1655.176) [-1655.642] (-1656.269) -- 0:00:00 991500 -- (-1656.603) (-1657.109) [-1657.362] (-1656.825) * (-1654.853) [-1654.158] (-1655.467) (-1654.378) -- 0:00:00 992000 -- (-1654.681) (-1655.405) (-1657.243) [-1654.206] * (-1653.898) (-1654.625) (-1655.209) [-1653.558] -- 0:00:00 992500 -- (-1656.875) (-1655.159) (-1657.470) [-1656.001] * [-1654.661] (-1654.384) (-1654.487) (-1654.753) -- 0:00:00 993000 -- (-1656.282) (-1656.084) (-1654.828) [-1657.567] * (-1654.723) (-1655.706) [-1656.536] (-1658.399) -- 0:00:00 993500 -- (-1657.241) (-1658.341) [-1654.158] (-1656.212) * [-1654.265] (-1654.281) (-1656.522) (-1655.646) -- 0:00:00 994000 -- (-1655.453) (-1655.583) (-1659.777) [-1661.533] * (-1657.181) (-1655.319) [-1654.740] (-1653.620) -- 0:00:00 994500 -- (-1657.372) [-1654.805] (-1657.790) (-1655.914) * [-1654.962] (-1655.048) (-1656.210) (-1655.556) -- 0:00:00 995000 -- (-1658.610) (-1658.192) [-1655.944] (-1654.979) * (-1656.898) [-1656.342] (-1656.632) (-1654.648) -- 0:00:00 Average standard deviation of split frequencies: 0.007068 995500 -- (-1657.287) (-1654.815) [-1654.714] (-1655.395) * (-1657.554) (-1656.697) [-1655.695] (-1654.801) -- 0:00:00 996000 -- (-1658.096) (-1655.564) [-1654.485] (-1653.880) * (-1660.626) (-1658.592) (-1658.434) [-1654.072] -- 0:00:00 996500 -- (-1656.053) (-1655.307) (-1654.022) [-1655.190] * (-1656.289) (-1659.497) [-1657.053] (-1656.036) -- 0:00:00 997000 -- (-1656.026) [-1653.529] (-1657.601) (-1654.182) * [-1655.289] (-1655.420) (-1655.876) (-1655.420) -- 0:00:00 997500 -- (-1655.990) (-1655.737) (-1657.838) [-1655.080] * [-1656.775] (-1655.470) (-1655.903) (-1660.448) -- 0:00:00 998000 -- [-1656.090] (-1656.760) (-1655.776) (-1656.905) * (-1655.163) (-1655.178) (-1655.182) [-1656.672] -- 0:00:00 998500 -- (-1655.119) (-1654.672) [-1654.975] (-1656.768) * (-1656.234) (-1654.468) [-1657.021] (-1657.246) -- 0:00:00 999000 -- [-1660.691] (-1661.317) (-1654.440) (-1659.824) * [-1653.617] (-1657.151) (-1658.600) (-1654.368) -- 0:00:00 999500 -- (-1660.665) [-1654.502] (-1653.542) (-1656.939) * (-1655.654) (-1654.269) [-1655.046] (-1654.701) -- 0:00:00 1000000 -- (-1659.865) (-1654.602) (-1653.476) [-1657.413] * (-1657.725) (-1656.196) (-1654.150) [-1655.863] -- 0:00:00 Average standard deviation of split frequencies: 0.006658 Analysis completed in 1 mins 4 seconds Analysis used 62.57 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1653.13 Likelihood of best state for "cold" chain of run 2 was -1653.13 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 74.4 % ( 74 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 25.1 % ( 31 %) Dirichlet(Pi{all}) 26.7 % ( 21 %) Slider(Pi{all}) 78.4 % ( 50 %) Multiplier(Alpha{1,2}) 77.5 % ( 50 %) Multiplier(Alpha{3}) 15.3 % ( 28 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 68 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.6 % ( 86 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 21 %) Multiplier(V{all}) 97.5 % (100 %) Nodeslider(V{all}) 30.2 % ( 38 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.4 % ( 64 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 24.8 % ( 26 %) Dirichlet(Pi{all}) 27.0 % ( 22 %) Slider(Pi{all}) 78.5 % ( 53 %) Multiplier(Alpha{1,2}) 78.1 % ( 55 %) Multiplier(Alpha{3}) 15.2 % ( 21 %) Slider(Pinvar{all}) 98.5 % ( 97 %) ExtSPR(Tau{all},V{all}) 70.4 % ( 69 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 94 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 29 %) Multiplier(V{all}) 97.4 % ( 98 %) Nodeslider(V{all}) 30.7 % ( 22 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166508 0.82 0.67 3 | 166992 166821 0.84 4 | 166570 166740 166369 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166950 0.82 0.67 3 | 166106 167140 0.84 4 | 166634 166539 166631 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1654.84 | 2 | | 2 2 1 1 | | 21 1 2 1 1 1 2 | | 2 1 2 22 22 2 1 | |2 1 21 2 1 2 2 1 2 2211 1 1 1 2 2| | 1 1 1 2 1 1 * 1 1 2*1 | | 2 1 1 1 1 12 22 1* 2 2 21 2 | | 1 1 2 2 22* 21 2 1*222 2 22 *1 1| | 1 222 1 1 1 1 1 | |1 2 1 1 2 1 | | 2 2 | | 1 1 1 | | 1 | | 1 2 | | 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1656.75 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1654.87 -1658.34 2 -1654.84 -1658.49 -------------------------------------- TOTAL -1654.85 -1658.42 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.889681 0.091695 0.389242 1.542722 0.850085 1219.54 1360.27 1.000 r(A<->C){all} 0.152530 0.016973 0.000003 0.412429 0.119664 237.50 313.49 1.003 r(A<->G){all} 0.157362 0.019032 0.000071 0.452048 0.115957 172.84 235.17 1.006 r(A<->T){all} 0.168736 0.020781 0.000238 0.461045 0.130486 138.06 199.75 1.004 r(C<->G){all} 0.163163 0.019469 0.000004 0.443007 0.126294 205.02 234.54 1.009 r(C<->T){all} 0.169643 0.020161 0.000006 0.455073 0.132258 257.78 296.88 1.000 r(G<->T){all} 0.188566 0.023112 0.000134 0.487209 0.153423 246.35 250.11 1.010 pi(A){all} 0.184447 0.000120 0.163761 0.206430 0.184279 979.76 1172.11 1.000 pi(C){all} 0.312679 0.000182 0.286489 0.338848 0.312443 1243.43 1276.71 1.000 pi(G){all} 0.313480 0.000174 0.286628 0.338104 0.313384 1208.35 1292.00 1.000 pi(T){all} 0.189395 0.000127 0.168177 0.211697 0.189077 1187.56 1344.28 1.000 alpha{1,2} 0.431072 0.250555 0.000156 1.442221 0.248825 979.73 1240.36 1.000 alpha{3} 0.455859 0.229197 0.000266 1.436078 0.303634 1350.60 1390.80 1.000 pinvar{all} 0.998762 0.000002 0.996078 0.999999 0.999253 1172.27 1181.39 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- ...*.* 8 -- ..**.. 9 -- .****. 10 -- .*.*** 11 -- .***.* 12 -- .*..*. 13 -- .**... 14 -- .*...* 15 -- ..*.*. 16 -- ..*..* 17 -- .*.*.. 18 -- ....** 19 -- ..**** 20 -- ...**. 21 -- .**.** ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 460 0.153231 0.006595 0.148568 0.157895 2 8 459 0.152898 0.011777 0.144570 0.161226 2 9 447 0.148901 0.003298 0.146569 0.151233 2 10 445 0.148235 0.006124 0.143904 0.152565 2 11 444 0.147901 0.014133 0.137908 0.157895 2 12 442 0.147235 0.000942 0.146569 0.147901 2 13 435 0.144903 0.000471 0.144570 0.145237 2 14 425 0.141572 0.001413 0.140573 0.142572 2 15 422 0.140573 0.000942 0.139907 0.141239 2 16 422 0.140573 0.006595 0.135909 0.145237 2 17 414 0.137908 0.009422 0.131246 0.144570 2 18 409 0.136243 0.007066 0.131246 0.141239 2 19 403 0.134244 0.006124 0.129913 0.138574 2 20 398 0.132578 0.010364 0.125250 0.139907 2 21 385 0.128248 0.014604 0.117921 0.138574 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.097669 0.009662 0.000006 0.284786 0.067233 1.000 2 length{all}[2] 0.099537 0.010498 0.000069 0.296415 0.067981 1.000 2 length{all}[3] 0.097217 0.009308 0.000004 0.282430 0.066126 1.000 2 length{all}[4] 0.099844 0.009622 0.000029 0.290312 0.071747 1.000 2 length{all}[5] 0.101745 0.010769 0.000012 0.304196 0.069632 1.000 2 length{all}[6] 0.101796 0.010118 0.000025 0.304516 0.069512 1.000 2 length{all}[7] 0.099976 0.010828 0.000101 0.273172 0.074280 0.998 2 length{all}[8] 0.102530 0.010169 0.000115 0.295340 0.071637 1.015 2 length{all}[9] 0.090055 0.007813 0.000009 0.267221 0.060666 1.002 2 length{all}[10] 0.093545 0.008856 0.000123 0.300875 0.063622 1.005 2 length{all}[11] 0.097993 0.008864 0.000558 0.301778 0.070428 0.998 2 length{all}[12] 0.104935 0.011254 0.000193 0.315068 0.075171 1.001 2 length{all}[13] 0.102040 0.010134 0.000093 0.297067 0.073431 0.999 2 length{all}[14] 0.099877 0.010522 0.000089 0.292605 0.067797 0.998 2 length{all}[15] 0.089041 0.008921 0.000543 0.297880 0.057573 0.999 2 length{all}[16] 0.103305 0.010893 0.000373 0.313981 0.073707 1.007 2 length{all}[17] 0.092765 0.007944 0.000464 0.251984 0.067391 1.001 2 length{all}[18] 0.099118 0.009925 0.000168 0.293351 0.068425 1.001 2 length{all}[19] 0.094752 0.009551 0.000073 0.279525 0.060712 1.001 2 length{all}[20] 0.098084 0.008912 0.000252 0.281780 0.067020 0.998 2 length{all}[21] 0.094400 0.008528 0.000096 0.269743 0.065397 0.998 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.006658 Maximum standard deviation of split frequencies = 0.014604 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001 Maximum PSRF for parameter values = 1.015 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /------------------------------------------------------------------- C1 (1) | |-------------------------------------------------------------------- C2 (2) | |------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |---------------------------------------------------------------------- C5 (5) | \---------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1221 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 57 patterns at 407 / 407 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 57 patterns at 407 / 407 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 55632 bytes for conP 5016 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.077148 0.024799 0.063956 0.098308 0.057592 0.058432 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1733.203902 Iterating by ming2 Initial: fx= 1733.203902 x= 0.07715 0.02480 0.06396 0.09831 0.05759 0.05843 0.30000 1.30000 1 h-m-p 0.0000 0.0001 975.3308 ++ 1674.278427 m 0.0001 13 | 1/8 2 h-m-p 0.0005 0.0027 111.0574 ++ 1667.651136 m 0.0027 24 | 2/8 3 h-m-p 0.0000 0.0000 29404.1169 ++ 1646.062577 m 0.0000 35 | 3/8 4 h-m-p 0.0001 0.0003 185.5134 ++ 1639.602497 m 0.0003 46 | 4/8 5 h-m-p 0.0000 0.0001 225.2497 ++ 1636.131214 m 0.0001 57 | 5/8 6 h-m-p 0.0000 0.0002 504.4768 ++ 1613.680101 m 0.0002 68 | 6/8 7 h-m-p 0.0160 8.0000 25.4918 -------------.. | 6/8 8 h-m-p 0.0000 0.0002 394.4509 +++ 1580.964097 m 0.0002 102 | 7/8 9 h-m-p 1.6000 8.0000 0.0000 Y 1580.964097 0 3.3929 113 | 7/8 10 h-m-p 0.5726 8.0000 0.0000 ---------Y 1580.964097 0 0.0000 134 Out.. lnL = -1580.964097 135 lfun, 135 eigenQcodon, 810 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.053112 0.015297 0.051693 0.025555 0.054067 0.071255 0.000100 0.667313 0.303579 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 12.533707 np = 9 lnL0 = -1686.823873 Iterating by ming2 Initial: fx= 1686.823873 x= 0.05311 0.01530 0.05169 0.02555 0.05407 0.07126 0.00011 0.66731 0.30358 1 h-m-p 0.0000 0.0000 931.7675 ++ 1684.779705 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0002 415.9188 +++ 1650.349282 m 0.0002 27 | 2/9 3 h-m-p 0.0000 0.0001 400.4477 ++ 1634.809122 m 0.0001 39 | 3/9 4 h-m-p 0.0001 0.0008 260.3506 ++ 1587.695958 m 0.0008 51 | 4/9 5 h-m-p 0.0000 0.0000 4121.1835 ++ 1586.352029 m 0.0000 63 | 5/9 6 h-m-p 0.0000 0.0000 1117.6828 ++ 1586.186208 m 0.0000 75 | 6/9 7 h-m-p 0.0000 0.0000 541.1723 ++ 1586.056426 m 0.0000 87 | 7/9 8 h-m-p 0.0001 0.0066 32.4381 ---------.. | 7/9 9 h-m-p 0.0000 0.0000 395.8757 ++ 1580.964085 m 0.0000 118 | 8/9 10 h-m-p 1.6000 8.0000 0.0000 N 1580.964085 0 0.4000 130 | 8/9 11 h-m-p 0.0160 8.0000 0.0000 Y 1580.964085 0 0.0040 143 Out.. lnL = -1580.964085 144 lfun, 432 eigenQcodon, 1728 P(t) Time used: 0:00 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.107633 0.096464 0.086664 0.044608 0.078627 0.010360 0.000100 1.205712 0.148202 0.319704 1.483758 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 10.824384 np = 11 lnL0 = -1741.460977 Iterating by ming2 Initial: fx= 1741.460977 x= 0.10763 0.09646 0.08666 0.04461 0.07863 0.01036 0.00011 1.20571 0.14820 0.31970 1.48376 1 h-m-p 0.0000 0.0000 877.3933 ++ 1740.585512 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0001 591.9883 ++ 1717.395914 m 0.0001 30 | 2/11 3 h-m-p 0.0001 0.0003 208.0714 ++ 1665.220009 m 0.0003 44 | 3/11 4 h-m-p 0.0007 0.0054 82.7937 ++ 1602.647261 m 0.0054 58 | 4/11 5 h-m-p 0.0001 0.0004 50.9970 ++ 1601.981614 m 0.0004 72 | 5/11 6 h-m-p 0.0000 0.0000 488.8288 ++ 1594.447327 m 0.0000 86 | 6/11 7 h-m-p 0.0008 0.0128 23.4002 -----------.. | 6/11 8 h-m-p 0.0000 0.0000 551.9633 ++ 1585.933393 m 0.0000 123 | 7/11 9 h-m-p 0.0160 8.0000 5.2425 -------------.. | 7/11 10 h-m-p 0.0000 0.0000 396.6542 ++ 1580.964089 m 0.0000 162 | 8/11 11 h-m-p 0.1058 8.0000 0.0000 ++++ 1580.964089 m 8.0000 178 | 8/11 12 h-m-p 0.1065 8.0000 0.0004 ++++ 1580.964089 m 8.0000 197 | 8/11 13 h-m-p 0.0012 0.1067 2.8479 ++++ 1580.964087 m 0.1067 216 | 9/11 14 h-m-p 0.0680 8.0000 3.0781 ----------C 1580.964087 0 0.0000 240 | 9/11 15 h-m-p 0.0160 8.0000 0.0000 +++++ 1580.964087 m 8.0000 257 | 9/11 16 h-m-p 0.0385 8.0000 0.0017 ++++ 1580.964087 m 8.0000 275 | 9/11 17 h-m-p 0.0160 8.0000 3.9509 -----------C 1580.964087 0 0.0000 302 | 9/11 18 h-m-p 0.0160 8.0000 0.0000 Y 1580.964087 0 0.0040 316 | 9/11 19 h-m-p 0.0160 8.0000 0.0000 Y 1580.964087 0 0.0040 332 Out.. lnL = -1580.964087 333 lfun, 1332 eigenQcodon, 5994 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1580.997337 S = -1580.960469 -0.014198 Calculating f(w|X), posterior probabilities of site classes. did 10 / 57 patterns 0:02 did 20 / 57 patterns 0:02 did 30 / 57 patterns 0:02 did 40 / 57 patterns 0:02 did 50 / 57 patterns 0:02 did 57 / 57 patterns 0:02 Time used: 0:02 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.102858 0.094469 0.019308 0.099289 0.041521 0.048439 0.000100 0.862779 1.461918 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 15.416402 np = 9 lnL0 = -1736.869574 Iterating by ming2 Initial: fx= 1736.869574 x= 0.10286 0.09447 0.01931 0.09929 0.04152 0.04844 0.00011 0.86278 1.46192 1 h-m-p 0.0000 0.0000 903.6099 ++ 1736.036239 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0079 95.2976 +++++ 1680.266404 m 0.0079 29 | 2/9 3 h-m-p 0.0000 0.0002 350.9088 ++ 1651.883272 m 0.0002 41 | 3/9 4 h-m-p 0.0002 0.0009 188.7203 ++ 1624.295800 m 0.0009 53 | 4/9 5 h-m-p 0.0000 0.0001 133.1322 ++ 1617.732626 m 0.0001 65 | 5/9 6 h-m-p 0.0002 0.0010 34.5248 ----------.. | 5/9 7 h-m-p 0.0000 0.0000 541.6007 ++ 1611.936357 m 0.0000 97 | 6/9 8 h-m-p 0.0009 0.0259 7.8396 -----------.. | 6/9 9 h-m-p 0.0000 0.0002 374.7712 +++ 1580.964080 m 0.0002 131 | 7/9 10 h-m-p 1.6000 8.0000 0.0000 ++ 1580.964080 m 8.0000 143 | 7/9 11 h-m-p 0.1123 8.0000 0.0002 -----N 1580.964080 0 0.0000 162 Out.. lnL = -1580.964080 163 lfun, 1793 eigenQcodon, 9780 P(t) Time used: 0:05 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.031195 0.061859 0.051061 0.080056 0.039985 0.053055 0.000100 0.900000 0.629525 1.888055 1.256285 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 15.891064 np = 11 lnL0 = -1701.120157 Iterating by ming2 Initial: fx= 1701.120157 x= 0.03120 0.06186 0.05106 0.08006 0.03999 0.05305 0.00011 0.90000 0.62953 1.88805 1.25629 1 h-m-p 0.0000 0.0000 878.0724 ++ 1700.076720 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0006 360.1680 +++ 1630.832378 m 0.0006 31 | 2/11 3 h-m-p 0.0000 0.0000 18242.9976 ++ 1613.986658 m 0.0000 45 | 3/11 4 h-m-p 0.0006 0.0030 56.9037 ++ 1606.945653 m 0.0030 59 | 4/11 5 h-m-p 0.0000 0.0000 769859.0324 ++ 1606.042821 m 0.0000 73 | 5/11 6 h-m-p 0.0000 0.0001 1608.4059 ++ 1601.374536 m 0.0001 87 | 6/11 7 h-m-p 0.0002 0.0008 116.3043 ++ 1580.964092 m 0.0008 101 | 7/11 8 h-m-p 1.6000 8.0000 0.0000 ++ 1580.964092 m 8.0000 115 | 7/11 9 h-m-p 0.0538 8.0000 0.0056 ++++ 1580.964092 m 8.0000 135 | 7/11 10 h-m-p 0.0279 0.4771 1.5919 ---------C 1580.964092 0 0.0000 162 | 7/11 11 h-m-p 0.0160 8.0000 0.0002 +++++ 1580.964092 m 8.0000 179 | 7/11 12 h-m-p 0.0003 0.0949 5.1559 +++++ 1580.964086 m 0.0949 200 | 8/11 13 h-m-p 0.4056 2.0278 0.4424 ++ 1580.964073 m 2.0278 214 | 9/11 14 h-m-p 1.6000 8.0000 0.0020 C 1580.964073 0 0.4000 231 | 9/11 15 h-m-p 1.6000 8.0000 0.0001 Y 1580.964073 0 0.4000 247 | 9/11 16 h-m-p 0.7681 8.0000 0.0000 -----N 1580.964073 0 0.0002 268 Out.. lnL = -1580.964073 269 lfun, 3228 eigenQcodon, 17754 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1581.052217 S = -1580.965459 -0.038827 Calculating f(w|X), posterior probabilities of site classes. did 10 / 57 patterns 0:09 did 20 / 57 patterns 0:10 did 30 / 57 patterns 0:10 did 40 / 57 patterns 0:10 did 50 / 57 patterns 0:10 did 57 / 57 patterns 0:10 Time used: 0:10 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=407 NC_011896_1_WP_010908321_1_1486_MLBR_RS07030 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP NC_002677_1_NP_302000_1_872_argJ VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP NZ_AP014567_1_WP_010908321_1_1544_argJ VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP ************************************************** NC_011896_1_WP_010908321_1_1486_MLBR_RS07030 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ NC_002677_1_NP_302000_1_872_argJ DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680 DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ NZ_AP014567_1_WP_010908321_1_1544_argJ DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ ************************************************** NC_011896_1_WP_010908321_1_1486_MLBR_RS07030 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV NC_002677_1_NP_302000_1_872_argJ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680 DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV NZ_AP014567_1_WP_010908321_1_1544_argJ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV ************************************************** NC_011896_1_WP_010908321_1_1486_MLBR_RS07030 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS NC_002677_1_NP_302000_1_872_argJ HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680 HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS NZ_AP014567_1_WP_010908321_1_1544_argJ HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS ************************************************** NC_011896_1_WP_010908321_1_1486_MLBR_RS07030 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA NC_002677_1_NP_302000_1_872_argJ LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680 LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA NZ_AP014567_1_WP_010908321_1_1544_argJ LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA ************************************************** NC_011896_1_WP_010908321_1_1486_MLBR_RS07030 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD NC_002677_1_NP_302000_1_872_argJ SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680 SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD NZ_AP014567_1_WP_010908321_1_1544_argJ SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD ************************************************** NC_011896_1_WP_010908321_1_1486_MLBR_RS07030 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN NC_002677_1_NP_302000_1_872_argJ DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680 DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN NZ_AP014567_1_WP_010908321_1_1544_argJ DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN ************************************************** NC_011896_1_WP_010908321_1_1486_MLBR_RS07030 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE NC_002677_1_NP_302000_1_872_argJ GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680 GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE NZ_AP014567_1_WP_010908321_1_1544_argJ GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ************************************************** NC_011896_1_WP_010908321_1_1486_MLBR_RS07030 ENSAYSS NC_002677_1_NP_302000_1_872_argJ ENSAYSS NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030 ENSAYSS NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580 ENSAYSS NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680 ENSAYSS NZ_AP014567_1_WP_010908321_1_1544_argJ ENSAYSS *******
>NC_011896_1_WP_010908321_1_1486_MLBR_RS07030 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA GAGAATTCGGCCTACAGTTCG >NC_002677_1_NP_302000_1_872_argJ GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA GAGAATTCGGCCTACAGTTCG >NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA GAGAATTCGGCCTACAGTTCG >NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA GAGAATTCGGCCTACAGTTCG >NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680 GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA GAGAATTCGGCCTACAGTTCG >NZ_AP014567_1_WP_010908321_1_1544_argJ GTGACCAAAATAGTCGAAATAGTCAATGAGACGCGGCTGCTGCGCGCACA GGGCGTCACCGCCCCTGCGGGCTTTCAGGCCGCCGGTATCACTGCTGGAA TCAAGGTATCGGGGGCCCCGGACCTTGCCCTGGTTTTCAACGAAGGGCCC GACTATGCGGCCGCTGGAGTATTCACCCGCAACAAGGTCAAGGCTGCTCC GGTGCTGTGGACACAGCGGGTGCTGAGCACCGGTCAGCTACGTGCGGTGA TTCTCAATTCCGGTGGCGCTAACGCCTGCACCGGACCTGCGGGCTTTCAG GACGCCCACACCACCGCGGAGGCGGTCGCCGCAGCATTGTCGGATTGGGG AACTGAAACCGGGGCGATCGAGGTTGCCGTCTGCTCCACTGGGCTGATCG GTGACCGGCTGCCGATGGACAAAGTACTCGCCGGTGTCCGTGCGATCGTG CACAAGATGGCTGGTGGGGTGACCGGAGGTGACGACGCCGCCCACGCCAT CATGACCACCGACACTGTGCCCAAGCAAGTTGCGCTGCACAATCGCAACA AGTGGACGGTTGGCGGAATGGCCAAAGGCGCGGGCATGTTGGCGCCGTCG CTGGCCACCATGTTGTGTGTGCTCACCACCGATGCGGTCGTCGAGCCGGC GGCACTTGATCAGGCGCTGCGCCGCGCCACTGCTCATACATTTGACCGAC TCGACATTGATGGCTGCTGTTCCACCAACGACACTGTGCTTCTGCTGGCA TCCGGCGCCAGCGGGATCACTCCGCCGCAGGCAGATCTCGACGACGCCGT ACGGCATGCCTGTGACGACTTGTGCGCACAGTTACAAGCCGACGCCGAGG GCGTTACTAAGCGTGTCACCGTGACCGTCATCGGTGCTGCTAGCGACGAC GACGCGCTGGTCGCTGCTCGGATGATCGCCCGCGACAACCTGGTCAAGAC CGCGGTATTCGGGTCGGACCCCAACTGGGGACGGGTGCTCGCTGCCGTCG GCATGGCACCGGTCGCACTTGACCCTGACCGACTCTGCATGTCGTTCAAC GGTGCTGCTGTGTGTATAGATGGAGTCGGTACTCCGTGCGCACGCGACGT GGACCTCTCAACGGCTGATATCGATATAACCGTCGACCTACGCATTGGCG ACTCCGCTGCCACTATCCGGACCACTGACCTATCGCACACCTATGTCGAA GAGAATTCGGCCTACAGTTCG
>NC_011896_1_WP_010908321_1_1486_MLBR_RS07030 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS >NC_002677_1_NP_302000_1_872_argJ VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS >NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS >NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS >NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680 VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS >NZ_AP014567_1_WP_010908321_1_1544_argJ VTKIVEIVNETRLLRAQGVTAPAGFQAAGITAGIKVSGAPDLALVFNEGP DYAAAGVFTRNKVKAAPVLWTQRVLSTGQLRAVILNSGGANACTGPAGFQ DAHTTAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKVLAGVRAIV HKMAGGVTGGDDAAHAIMTTDTVPKQVALHNRNKWTVGGMAKGAGMLAPS LATMLCVLTTDAVVEPAALDQALRRATAHTFDRLDIDGCCSTNDTVLLLA SGASGITPPQADLDDAVRHACDDLCAQLQADAEGVTKRVTVTVIGAASDD DALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDPDRLCMSFN GAAVCIDGVGTPCARDVDLSTADIDITVDLRIGDSAATIRTTDLSHTYVE ENSAYSS
#NEXUS [ID: 8446504401] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908321_1_1486_MLBR_RS07030 NC_002677_1_NP_302000_1_872_argJ NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030 NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580 NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680 NZ_AP014567_1_WP_010908321_1_1544_argJ ; end; begin trees; translate 1 NC_011896_1_WP_010908321_1_1486_MLBR_RS07030, 2 NC_002677_1_NP_302000_1_872_argJ, 3 NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030, 4 NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580, 5 NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680, 6 NZ_AP014567_1_WP_010908321_1_1544_argJ ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06723312,2:0.06798097,3:0.06612637,4:0.07174729,5:0.0696318,6:0.06951181); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06723312,2:0.06798097,3:0.06612637,4:0.07174729,5:0.0696318,6:0.06951181); end;
Estimated marginal likelihoods for runs sampled in files "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1654.87 -1658.34 2 -1654.84 -1658.49 -------------------------------------- TOTAL -1654.85 -1658.42 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/argJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.889681 0.091695 0.389242 1.542722 0.850085 1219.54 1360.27 1.000 r(A<->C){all} 0.152530 0.016973 0.000003 0.412429 0.119664 237.50 313.49 1.003 r(A<->G){all} 0.157362 0.019032 0.000071 0.452048 0.115957 172.84 235.17 1.006 r(A<->T){all} 0.168736 0.020781 0.000238 0.461045 0.130486 138.06 199.75 1.004 r(C<->G){all} 0.163163 0.019469 0.000004 0.443007 0.126294 205.02 234.54 1.009 r(C<->T){all} 0.169643 0.020161 0.000006 0.455073 0.132258 257.78 296.88 1.000 r(G<->T){all} 0.188566 0.023112 0.000134 0.487209 0.153423 246.35 250.11 1.010 pi(A){all} 0.184447 0.000120 0.163761 0.206430 0.184279 979.76 1172.11 1.000 pi(C){all} 0.312679 0.000182 0.286489 0.338848 0.312443 1243.43 1276.71 1.000 pi(G){all} 0.313480 0.000174 0.286628 0.338104 0.313384 1208.35 1292.00 1.000 pi(T){all} 0.189395 0.000127 0.168177 0.211697 0.189077 1187.56 1344.28 1.000 alpha{1,2} 0.431072 0.250555 0.000156 1.442221 0.248825 979.73 1240.36 1.000 alpha{3} 0.455859 0.229197 0.000266 1.436078 0.303634 1350.60 1390.80 1.000 pinvar{all} 0.998762 0.000002 0.996078 0.999999 0.999253 1172.27 1181.39 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/argJ/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 407 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 4 4 4 4 4 4 TTC 4 4 4 4 4 4 | TCC 5 5 5 5 5 5 | TAC 1 1 1 1 1 1 | TGC 6 6 6 6 6 6 Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 4 4 4 4 4 4 | TCG 8 8 8 8 8 8 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 4 4 4 4 4 4 | Pro CCT 3 3 3 3 3 3 | His CAT 2 2 2 2 2 2 | Arg CGT 3 3 3 3 3 3 CTC 8 8 8 8 8 8 | CCC 3 3 3 3 3 3 | CAC 5 5 5 5 5 5 | CGC 8 8 8 8 8 8 CTA 3 3 3 3 3 3 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 2 2 2 2 2 2 CTG 14 14 14 14 14 14 | CCG 9 9 9 9 9 9 | CAG 8 8 8 8 8 8 | CGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 3 3 | Thr ACT 11 11 11 11 11 11 | Asn AAT 4 4 4 4 4 4 | Ser AGT 1 1 1 1 1 1 ATC 11 11 11 11 11 11 | ACC 21 21 21 21 21 21 | AAC 8 8 8 8 8 8 | AGC 3 3 3 3 3 3 ATA 4 4 4 4 4 4 | ACA 2 2 2 2 2 2 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0 Met ATG 9 9 9 9 9 9 | ACG 3 3 3 3 3 3 | AAG 8 8 8 8 8 8 | AGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 5 5 5 5 5 5 | Ala GCT 16 16 16 16 16 16 | Asp GAT 8 8 8 8 8 8 | Gly GGT 10 10 10 10 10 10 GTC 18 18 18 18 18 18 | GCC 26 26 26 26 26 26 | GAC 28 28 28 28 28 28 | GGC 12 12 12 12 12 12 GTA 5 5 5 5 5 5 | GCA 10 10 10 10 10 10 | Glu GAA 4 4 4 4 4 4 | GGA 8 8 8 8 8 8 GTG 13 13 13 13 13 13 | GCG 16 16 16 16 16 16 | GAG 6 6 6 6 6 6 | GGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908321_1_1486_MLBR_RS07030 position 1: T:0.10565 C:0.19902 A:0.22359 G:0.47174 position 2: T:0.26781 C:0.32924 A:0.21867 G:0.18428 position 3: T:0.19410 C:0.41032 A:0.11057 G:0.28501 Average T:0.18919 C:0.31286 A:0.18428 G:0.31368 #2: NC_002677_1_NP_302000_1_872_argJ position 1: T:0.10565 C:0.19902 A:0.22359 G:0.47174 position 2: T:0.26781 C:0.32924 A:0.21867 G:0.18428 position 3: T:0.19410 C:0.41032 A:0.11057 G:0.28501 Average T:0.18919 C:0.31286 A:0.18428 G:0.31368 #3: NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030 position 1: T:0.10565 C:0.19902 A:0.22359 G:0.47174 position 2: T:0.26781 C:0.32924 A:0.21867 G:0.18428 position 3: T:0.19410 C:0.41032 A:0.11057 G:0.28501 Average T:0.18919 C:0.31286 A:0.18428 G:0.31368 #4: NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580 position 1: T:0.10565 C:0.19902 A:0.22359 G:0.47174 position 2: T:0.26781 C:0.32924 A:0.21867 G:0.18428 position 3: T:0.19410 C:0.41032 A:0.11057 G:0.28501 Average T:0.18919 C:0.31286 A:0.18428 G:0.31368 #5: NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680 position 1: T:0.10565 C:0.19902 A:0.22359 G:0.47174 position 2: T:0.26781 C:0.32924 A:0.21867 G:0.18428 position 3: T:0.19410 C:0.41032 A:0.11057 G:0.28501 Average T:0.18919 C:0.31286 A:0.18428 G:0.31368 #6: NZ_AP014567_1_WP_010908321_1_1544_argJ position 1: T:0.10565 C:0.19902 A:0.22359 G:0.47174 position 2: T:0.26781 C:0.32924 A:0.21867 G:0.18428 position 3: T:0.19410 C:0.41032 A:0.11057 G:0.28501 Average T:0.18919 C:0.31286 A:0.18428 G:0.31368 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 18 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 24 TTC 24 | TCC 30 | TAC 6 | TGC 36 Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0 TTG 24 | TCG 48 | TAG 0 | Trp W TGG 24 ------------------------------------------------------------------------------ Leu L CTT 24 | Pro P CCT 18 | His H CAT 12 | Arg R CGT 18 CTC 48 | CCC 18 | CAC 30 | CGC 48 CTA 18 | CCA 0 | Gln Q CAA 12 | CGA 12 CTG 84 | CCG 54 | CAG 48 | CGG 42 ------------------------------------------------------------------------------ Ile I ATT 18 | Thr T ACT 66 | Asn N AAT 24 | Ser S AGT 6 ATC 66 | ACC 126 | AAC 48 | AGC 18 ATA 24 | ACA 12 | Lys K AAA 18 | Arg R AGA 0 Met M ATG 54 | ACG 18 | AAG 48 | AGG 0 ------------------------------------------------------------------------------ Val V GTT 30 | Ala A GCT 96 | Asp D GAT 48 | Gly G GGT 60 GTC 108 | GCC 156 | GAC 168 | GGC 72 GTA 30 | GCA 60 | Glu E GAA 24 | GGA 48 GTG 78 | GCG 96 | GAG 36 | GGG 42 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.10565 C:0.19902 A:0.22359 G:0.47174 position 2: T:0.26781 C:0.32924 A:0.21867 G:0.18428 position 3: T:0.19410 C:0.41032 A:0.11057 G:0.28501 Average T:0.18919 C:0.31286 A:0.18428 G:0.31368 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1580.964097 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.256285 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908321_1_1486_MLBR_RS07030: 0.000004, NC_002677_1_NP_302000_1_872_argJ: 0.000004, NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030: 0.000004, NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580: 0.000004, NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680: 0.000004, NZ_AP014567_1_WP_010908321_1_1544_argJ: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 omega (dN/dS) = 1.25629 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 905.3 315.7 1.2563 0.0000 0.0000 0.0 0.0 7..2 0.000 905.3 315.7 1.2563 0.0000 0.0000 0.0 0.0 7..3 0.000 905.3 315.7 1.2563 0.0000 0.0000 0.0 0.0 7..4 0.000 905.3 315.7 1.2563 0.0000 0.0000 0.0 0.0 7..5 0.000 905.3 315.7 1.2563 0.0000 0.0000 0.0 0.0 7..6 0.000 905.3 315.7 1.2563 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1580.964085 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.790063 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908321_1_1486_MLBR_RS07030: 0.000004, NC_002677_1_NP_302000_1_872_argJ: 0.000004, NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030: 0.000004, NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580: 0.000004, NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680: 0.000004, NZ_AP014567_1_WP_010908321_1_1544_argJ: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.79006 0.20994 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 905.3 315.7 0.2099 0.0000 0.0000 0.0 0.0 7..2 0.000 905.3 315.7 0.2099 0.0000 0.0000 0.0 0.0 7..3 0.000 905.3 315.7 0.2099 0.0000 0.0000 0.0 0.0 7..4 0.000 905.3 315.7 0.2099 0.0000 0.0000 0.0 0.0 7..5 0.000 905.3 315.7 0.2099 0.0000 0.0000 0.0 0.0 7..6 0.000 905.3 315.7 0.2099 0.0000 0.0000 0.0 0.0 Time used: 0:00 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1580.964087 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.711728 0.153057 0.000001 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908321_1_1486_MLBR_RS07030: 0.000004, NC_002677_1_NP_302000_1_872_argJ: 0.000004, NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030: 0.000004, NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580: 0.000004, NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680: 0.000004, NZ_AP014567_1_WP_010908321_1_1544_argJ: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.71173 0.15306 0.13522 w: 0.00000 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 905.3 315.7 0.2883 0.0000 0.0000 0.0 0.0 7..2 0.000 905.3 315.7 0.2883 0.0000 0.0000 0.0 0.0 7..3 0.000 905.3 315.7 0.2883 0.0000 0.0000 0.0 0.0 7..4 0.000 905.3 315.7 0.2883 0.0000 0.0000 0.0 0.0 7..5 0.000 905.3 315.7 0.2883 0.0000 0.0000 0.0 0.0 7..6 0.000 905.3 315.7 0.2883 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908321_1_1486_MLBR_RS07030) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:02 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1580.964080 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.156905 1.422572 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908321_1_1486_MLBR_RS07030: 0.000004, NC_002677_1_NP_302000_1_872_argJ: 0.000004, NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030: 0.000004, NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580: 0.000004, NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680: 0.000004, NZ_AP014567_1_WP_010908321_1_1544_argJ: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.15690 q = 1.42257 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00009 0.00076 0.00377 0.01358 0.03977 0.10132 0.23724 0.55296 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 905.3 315.7 0.0950 0.0000 0.0000 0.0 0.0 7..2 0.000 905.3 315.7 0.0950 0.0000 0.0000 0.0 0.0 7..3 0.000 905.3 315.7 0.0950 0.0000 0.0000 0.0 0.0 7..4 0.000 905.3 315.7 0.0950 0.0000 0.0000 0.0 0.0 7..5 0.000 905.3 315.7 0.0950 0.0000 0.0000 0.0 0.0 7..6 0.000 905.3 315.7 0.0950 0.0000 0.0000 0.0 0.0 Time used: 0:05 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1580.964073 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.920755 1.771344 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908321_1_1486_MLBR_RS07030: 0.000004, NC_002677_1_NP_302000_1_872_argJ: 0.000004, NZ_LVXE01000004_1_WP_010908321_1_1779_A3216_RS03030: 0.000004, NZ_LYPH01000077_1_WP_010908321_1_2612_A8144_RS12580: 0.000004, NZ_CP029543_1_WP_010908321_1_1508_DIJ64_RS07680: 0.000004, NZ_AP014567_1_WP_010908321_1_1544_argJ: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.00500 q = 1.92075 (p1 = 0.00001) w = 1.77134 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.77134 (note that p[10] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 905.3 315.7 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 905.3 315.7 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 905.3 315.7 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 905.3 315.7 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 905.3 315.7 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 905.3 315.7 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908321_1_1486_MLBR_RS07030) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.093 0.095 0.096 0.098 0.099 0.101 0.102 0.104 0.105 0.107 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.106 0.105 0.103 0.102 0.101 0.099 0.098 0.097 0.095 0.094 Time used: 0:10
Model 1: NearlyNeutral -1580.964085 Model 2: PositiveSelection -1580.964087 Model 0: one-ratio -1580.964097 Model 7: beta -1580.96408 Model 8: beta&w>1 -1580.964073 Model 0 vs 1 2.3999999939405825E-5 Model 2 vs 1 3.999999989900971E-6 Model 8 vs 7 1.3999999737279722E-5